Your browser is old and dusty. Try Google Chrome!

Details for slr1174

ORF slr1174
Accession NP_441670.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442761.1_5 Forward -120 -101 6.29264 0.268
NP_440795.1_7 Forward -114 -107 14.6904 0.0123
NP_440795.1_7 Reverse -107 -114 14.6904 0.0123
NP_441418.1_6 Reverse -106 -125 -20.7484 0.125
NP_442291.1_5 Forward -116 -100 -0.236458 0.18
NP_442538.1_2 Reverse -66 -85 18.4857 0.13
NP_441453.1_1 Forward -122 -104 14.0797 0.0938
NP_441453.1_4 Reverse -106 -114 16.539 0.00633
NP_441453.1_4 Forward -115 -107 16.539 0.00633
NP_441453.1_4 Forward -37 -29 4.73931 0.252
NP_441453.1_7 Forward -358 -351 12.9205 0.23
NP_441453.1_7 Forward -302 -295 11.9372 0.298
NP_442151.1_6 Reverse -106 -120 17.8958 0.00866
NP_442151.1_6 Reverse -154 -168 5.50613 0.274
NP_443043.1_7 Reverse -69 -88 9.24257 0.265
NP_441818.1_1 Forward -114 -103 8.80962 0.277
NP_440226.1_1 Forward -115 -96 19.8623 0.0103
NP_440226.1_1 Reverse -106 -125 10.8159 0.0588
NP_441630.1_3 Reverse -98 -117 10.2259 0.0907
NP_441630.1_3 Forward -358 -339 2.75272 0.215
NP_442173.1_1 Forward -114 -106 15.4574 0.00633
NP_442173.1_1 Reverse -107 -115 15.4574 0.00633
NP_442752.1_4 Forward -115 -108 13.8055 0.0199
NP_442752.1_4 Reverse -106 -113 13.8055 0.0199
NP_442752.1_4 Forward -37 -30 5.54565 0.194
NP_443027.1_4 Forward -117 -107 15.3197 0.0437
NP_443027.1_4 Reverse -104 -114 13.2547 0.0521
NP_442975.1_10 Forward -119 -105 12.0937 0.0477
NP_442975.1_10 Reverse -24 -38 10.9137 0.0516
NP_442975.1_10 Reverse -102 -116 3.34225 0.259
NP_440784.1_7 Forward -114 -107 15.9687 0.0123
NP_440784.1_7 Reverse -107 -114 15.9687 0.0123
NP_441250.1_3 Reverse -329 -348 1.96607 0.281
NP_442289.1_4 Reverse -98 -114 13.6282 0.203
NP_440061.1_9 Reverse -104 -118 11.012 0.117
NP_440061.1_9 Forward -327 -313 5.30886 0.29
NP_440110.1_8 Forward -117 -98 -0.197208 0.219
NP_440878.1_9 Forward -112 -93 -1.18052 0.23
NP_440878.1_9 Forward -125 -106 -2.85214 0.281
NP_442062.1_3 Forward -153 -134 -3.14714 0.274
NP_442062.1_8 Reverse -106 -116 10.3048 0.0493
NP_442062.1_8 Forward -115 -105 10.3048 0.0493
NP_440761.1_4 Forward -120 -101 -12.7836 0.257
NP_441859.1_3 Forward -246 -227 5.11187 0.206
NP_441859.1_3 Reverse -105 -124 2.16195 0.266
NP_440304.1_4 Forward -117 -107 18.9579 0.00406
NP_440304.1_4 Reverse -104 -114 10.8948 0.051
NP_440304.1_4 Reverse -164 -174 3.32329 0.299
NP_442242.1_4 Forward -114 -107 14.3954 0.0124
NP_442242.1_4 Reverse -107 -114 14.3954 0.0124
NP_441781.1_7 Forward -101 -82 -3.44213 0.296
NP_440893.1_3 Forward -252 -233 0.588665 0.273
NP_441208.1_9 Forward -118 -104 16.9125 0.0647
NP_441208.1_9 Reverse -103 -117 9.43936 0.213
NP_440370.1_10 Forward -124 -105 8.16093 0.243
NP_442110.1_7 Reverse -106 -120 11.111 0.0636
NP_442110.1_7 Forward -115 -101 1.57289 0.222
NP_442896.1_7 Reverse -34 -53 0.0977854 0.282
NP_442367.1_1 Reverse -144 -163 -11.2103 0.264
NP_440014.1_6 Forward -124 -105 11.5042 0.236
NP_440769.1_8 Reverse -1 -20 15.3391 0.15
NP_440856.1_7 Forward -325 -306 -8.94866 0.28
NP_441083.1_5 Forward -115 -105 11.2881 0.0159
NP_441083.1_5 Reverse -106 -116 11.2881 0.0159
NP_441083.1_5 Reverse -28 -38 6.96153 0.0717
NP_442827.1_8 Reverse -98 -117 6.88182 0.101
NP_441434.1_8 Reverse -329 -348 8.33225 0.29
NP_441738.1_2 Forward -113 -106 15.28 0.0102
NP_441738.1_2 Reverse -108 -115 15.28 0.0102
NP_441558.1_5 Forward -117 -98 11.9958 0.0736
NP_441558.1_5 Reverse -104 -123 11.7992 0.0766
NP_440209.1_1 Reverse -106 -114 18.1123 0.00295
NP_440209.1_1 Forward -115 -107 18.1123 0.00295
NP_440447.1_6 Forward -123 -105 6.90232 0.143
NP_441713.1_1 Forward -121 -102 31.2687 0.00022
NP_441770.1_4 Forward -244 -225 -9.53865 0.256
NP_440178.1_7 Forward -116 -97 -13.0786 0.129
NP_442570.1_3 Forward -45 -26 -2.26216 0.212
NP_441716.1_1 Reverse -106 -120 10.6193 0.0936
NP_441716.1_1 Forward -115 -101 4.52282 0.255
NP_441598.1_1 Forward -96 -77 6.19431 0.295
NP_441598.1_4 Reverse -178 -197 15.6341 0.285
NP_442111.1_3 Forward -342 -329 13.6216 0.261
NP_442111.1_4 Reverse -105 -119 19.4691 0.00416
NP_442111.1_4 Forward -116 -102 15.8309 0.0194
NP_441624.1_7 Forward -174 -160 8.55439 0.238
NP_441624.1_7 Forward -53 -39 7.17775 0.265
NP_440906.1_5 Forward -114 -107 15.8704 0.0124
NP_440906.1_5 Reverse -107 -114 15.8704 0.0124
NP_440906.1_5 Forward -36 -29 8.79057 0.149
NP_440747.1_10 Forward -118 -106 7.80712 0.00223
NP_440747.1_10 Reverse -103 -115 7.4138 0.00422
NP_440747.1_10 Forward -185 -173 -12.2524 0.254
NP_440747.1_10 Forward -40 -28 -12.3507 0.27
NP_441130.1_10 Forward -117 -103 9.5377 0.124
NP_442973.1_5 Reverse -97 -116 14.8474 0.127
NP_442634.1_2 Reverse -226 -245 3.44104 0.278
NP_442634.1_4 Reverse -104 -118 25.074 0.0027
NP_442634.1_4 Forward -117 -103 5.89945 0.051
NP_441265.1_3 Forward -121 -107 12.9793 0.0742
NP_440403.1_10 Reverse -157 -176 1.86774 0.283
NP_441012.1_4 Reverse -376 -389 6.80412 0.276
NP_443018.1_3 Forward -114 -107 14.8871 0.0123
NP_443018.1_3 Reverse -107 -114 14.8871 0.0123
NP_443018.1_3 Forward -244 -237 10.2655 0.107
NP_441316.1_7 Reverse -104 -119 5.3881 0.121
NP_441634.1_8 Forward -39 -25 3.73617 0.143
NP_441634.1_8 Forward -247 -233 -0.787057 0.268
NP_441634.1_8 Reverse -104 -118 -2.95034 0.295
NP_441634.1_9 Reverse -33 -52 13.7649 0.186
NP_440376.1_1 Forward -115 -106 19.4693 0.000692
NP_440376.1_1 Reverse -106 -115 19.4693 0.000692
NP_440376.1_1 Forward -37 -28 5.3096 0.137
NP_440376.1_1 Forward -182 -173 3.34298 0.206
NP_440376.1_1 Reverse -166 -175 0.491382 0.273
NP_442687.1_7 Forward -116 -106 9.02648 0.0994
NP_442687.1_7 Reverse -105 -115 9.02648 0.0994
NP_442191.1_4 Forward -114 -100 12.6414 0.198
NP_441846.1_10 Reverse -187 -206 -14.3569 0.222
NP_442530.1_2 Forward -342 -332 11.9764 0.282
NP_440642.1_10 Forward -171 -157 3.44058 0.273
NP_440642.1_10 Forward -97 -83 2.5556 0.277
NP_441422.1_7 Reverse -104 -121 -1.73112 0.194
NP_440533.1_9 Reverse -106 -125 13.1758 0.0859
NP_442658.1_1 Forward -117 -107 15.9091 0.00966
NP_442658.1_1 Reverse -104 -114 14.2375 0.0237
NP_442198.1_7 Reverse -103 -122 11.3067 0.209
NP_440141.1_3 Reverse -87 -106 1.27776 0.274
NP_440141.1_8 Forward -358 -339 8.35759 0.23
NP_442782.1_2 Reverse -39 -53 2.06454 0.278
NP_442782.1_2 Forward -115 -101 0.88457 0.282
NP_442782.1_2 Reverse -279 -293 -0.000409212 0.297
NP_442205.1_9 Reverse -100 -116 -1.02311 0.264
NP_441414.1_9 Forward -115 -96 -5.60541 0.178
NP_440720.1_1 Forward -126 -107 2.16274 0.263
NP_441487.1_6 Reverse -98 -117 -0.983855 0.283
NP_441958.1_5 Forward -116 -106 21.2195 0.000805
NP_441958.1_5 Reverse -105 -115 21.2195 0.000805
NP_441127.1_1 Forward -360 -346 11.7993 0.215
NP_440318.1_1 Forward -101 -82 0.294447 0.296
NP_440203.1_5 Forward -248 -238 12.8609 0.137
NP_440203.1_5 Reverse -109 -119 12.7626 0.138
NP_439905.1_1 Forward -114 -101 11.0324 0.204
NP_440984.1_7 Reverse -101 -115 12.3893 0.122
NP_439990.1_5 Forward -120 -107 19.3905 0.00775
NP_439990.1_5 Reverse -237 -250 7.29578 0.203
NP_442376.1_2 Reverse -101 -120 -4.72043 0.253
NP_442690.1_1 Reverse -329 -348 -0.885524 0.127
NP_442911.1_2 Reverse -96 -115 -2.75381 0.102
NP_442911.1_2 Forward -125 -106 -2.95047 0.105
NP_440153.1_5 Forward -114 -100 15.0442 0.0551
NP_441591.1_10 Forward -117 -98 5.01433 0.297
NP_442064.1_1 Forward -120 -101 -10.1286 0.259
NP_442064.1_4 Forward -192 -173 7.57013 0.242
NP_443055.1_3 Reverse -97 -116 11.1226 0.27
NP_443055.1_6 Forward -367 -349 -1.16155 0.273
NP_440993.1_2 Reverse -101 -117 12.4482 0.0735
NP_440993.1_2 Forward -120 -104 4.87675 0.249
NP_440993.1_3 Forward -125 -106 17.2065 0.0527
NP_441099.1_5 Reverse -18 -37 -10.3253 0.25
NP_440809.1_9 Forward -124 -106 -7.55234 0.225
NP_441294.1_7 Reverse -102 -116 15.0099 0.0328
NP_442438.1_10 Reverse -101 -115 4.03116 0.152
NP_442438.1_10 Forward -120 -106 2.75286 0.168
NP_441292.1_2 Forward -48 -29 -11.8986 0.296
NP_441000.1_6 Forward -116 -102 4.71948 0.0933
NP_441000.1_6 Forward -293 -279 -3.73699 0.225
NP_441000.1_6 Reverse -27 -41 -4.81863 0.252
NP_440147.1_4 Reverse -104 -117 19.0955 0.00328
NP_440147.1_4 Forward -117 -104 10.7374 0.0355
NP_441175.1_7 Forward -115 -96 14.7491 0.0952
NP_441550.1_8 Forward -117 -107 17.4824 0.00754
NP_441550.1_8 Reverse -104 -114 15.8108 0.0132
NP_441916.1_7 Forward -115 -105 18.9579 0.00144
NP_441916.1_7 Reverse -106 -116 18.9579 0.00144
NP_441041.1_4 Forward -37 -18 -2.95047 0.118
NP_441041.1_4 Reverse -154 -173 -11.5053 0.248
NP_441041.1_4 Reverse -106 -125 -11.8003 0.252
NP_441041.1_7 Forward -118 -106 14.9975 0.0309
NP_441041.1_7 Reverse -103 -115 7.32042 0.169
NP_442004.1_4 Reverse -341 -360 8.65176 0.299
NP_442004.1_6 Reverse -106 -120 4.12949 0.224
NP_442004.1_6 Forward -241 -227 4.03116 0.227
NP_441725.1_4 Forward -120 -106 4.03056 0.278
NP_441725.1_5 Reverse -107 -117 8.92815 0.0553
NP_441725.1_5 Forward -114 -104 1.94665 0.115
NP_439966.1_7 Reverse -104 -114 14.3359 0.0203
NP_439966.1_7 Forward -117 -107 13.8442 0.0234
NP_439966.1_7 Reverse -26 -36 6.46942 0.18
NP_439966.1_9 Forward -117 -108 0.983037 0.253
NP_440736.1_3 Forward -385 -366 -1.7705 0.294
NP_442941.1_3 Forward -114 -104 19.2529 0.00262
NP_442941.1_3 Reverse -107 -117 10.9931 0.0116
NP_442941.1_3 Reverse -29 -39 -0.118297 0.249
NP_440289.1_2 Reverse -25 -38 0.60927 0.156
NP_440289.1_2 Reverse -103 -116 -3.52063 0.267
NP_440289.1_2 Forward -118 -105 -4.60227 0.29
NP_440983.1_5 Reverse -154 -173 -6.49039 0.277
NP_440983.1_9 Reverse -35 -54 5.99764 0.281
NP_440260.1_8 Forward -105 -87 -2.93078 0.246
NP_440260.1_8 Forward -368 -350 -7.15901 0.295
NP_442281.1_1 Forward -120 -106 6.88214 0.113
NP_441334.1_7 Forward -117 -98 6.4893 0.0242
NP_441334.1_7 Reverse -104 -123 -10.4236 0.12
NP_441334.1_7 Forward -310 -291 -14.4552 0.263
NP_441079.1_1 Forward -131 -112 14.7491 0.264
NP_441058.2_6 Forward -362 -343 11.9958 0.268
NP_442256.1_2 Forward -117 -99 2.47742 0.107
NP_001035871.2_5 Forward -52 -34 19.0954 0.191
NP_001035871.2_7 Reverse -40 -50 13.5497 0.219
NP_001035871.2_7 Reverse -376 -386 11.7798 0.278
NP_440647.1_9 Reverse -104 -122 5.52568 0.23
NP_442012.1_1 Reverse -100 -119 0.58944 0.235
NP_442012.1_1 Reverse -139 -158 -0.983855 0.272
NP_441457.1_7 Forward -117 -98 -0.0988766 0.288
NP_440723.1_9 Reverse -161 -179 13.883 0.287
NP_440375.1_6 Reverse -156 -175 8.94757 0.239
NP_441644.1_6 Forward -115 -105 19.0557 0.000803
NP_441644.1_6 Reverse -106 -116 19.0557 0.000803
NP_441644.1_6 Forward -175 -165 10.4026 0.0628
NP_442029.1_10 Reverse -334 -353 4.916 0.29
NP_440253.1_2 Forward -37 -19 1.19912 0.166
NP_440929.1_8 Forward -115 -106 19.2726 0.000701
NP_440929.1_8 Reverse -106 -115 19.2726 0.000701
NP_442933.1_10 Forward -115 -106 17.601 0.00325
NP_442933.1_10 Reverse -106 -115 17.601 0.00325
NP_441751.2_8 Reverse -107 -121 5.01447 0.0448
NP_441751.2_8 Forward -114 -100 -2.26202 0.132
NP_442554.1_8 Reverse -107 -117 19.1546 0.00369
NP_442554.1_8 Forward -114 -104 17.2863 0.00543
NP_441762.1_7 Reverse -105 -117 2.69391 0.0676
NP_441762.1_7 Forward -116 -104 -6.74586 0.284
NP_442142.1_4 Forward -118 -105 13.49 0.0348
NP_442142.1_4 Reverse -103 -116 4.34528 0.223
NP_442142.1_4 Reverse -291 -304 2.87033 0.273
NP_442292.1_1 Forward -114 -105 17.5026 0.00435
NP_442292.1_1 Reverse -107 -116 17.5026 0.00435
NP_442476.1_3 Forward -181 -162 18.3873 0.135
NP_442476.1_6 Forward -114 -100 3.53951 0.156
NP_442476.1_6 Reverse -29 -43 -0.0987402 0.286
NP_441523.1_6 Reverse -102 -121 2.94938 0.28
NP_443009.1_5 Reverse -105 -116 15.7911 0.0107
NP_443009.1_5 Forward -116 -105 15.7911 0.0107
NP_441715.1_4 Forward -114 -104 16.7946 0.0106
NP_441715.1_4 Reverse -107 -117 7.25653 0.108
NP_440183.1_9 Forward -243 -224 -16.3235 0.276
NP_441198.1_8 Forward -117 -107 15.4199 0.0427
NP_441468.1_1 Forward -114 -107 15.8704 0.0124
NP_441468.1_1 Reverse -107 -114 15.8704 0.0124
NP_441020.2_6 Forward -117 -100 6.13536 0.275
NP_441015.1_10 Forward -120 -101 1.57275 0.159
NP_441015.1_10 Reverse -155 -174 -7.86702 0.272
NP_441673.1_1 Forward -115 -106 20.8459 0.000698
NP_441673.1_1 Reverse -106 -115 20.8459 0.000698
NP_441876.1_9 Forward -362 -352 11.091 0.28
NP_441826.1_2 Forward -121 -107 -2.55701 0.273
NP_441330.1_1 Reverse -101 -120 -12.4886 0.183
NP_441637.1_9 Reverse -333 -351 13.9821 0.12
NP_442490.1_9 Reverse -145 -164 -6.39206 0.273
NP_442868.1_6 Reverse -104 -114 10.4031 0.038
NP_442868.1_6 Forward -117 -107 8.63316 0.0555
NP_442868.1_6 Forward -39 -29 -0.216628 0.273
NP_442719.1_2 Reverse -333 -351 -8.733 0.255
NP_442719.1_2 Reverse -332 -350 -10.6013 0.278
NP_440051.1_2 Forward -181 -162 21.4356 0.0514
NP_442227.1_2 Forward -210 -191 -0.590531 0.255
NP_442427.1_3 Forward -120 -102 7.88563 0.171
NP_442808.1_1 Reverse -105 -115 8.73102 0.0481
NP_442808.1_1 Forward -116 -106 8.73102 0.0481
NP_442808.1_1 Reverse -27 -37 6.66608 0.102
NP_442808.1_1 Forward -53 -43 1.65123 0.282
NP_440871.1_3 Forward -238 -224 17.3611 0.166
NP_440145.1_3 Forward -125 -106 18.289 0.00887
NP_440145.1_5 Forward -297 -278 7.57094 0.265
NP_442542.1_9 Reverse -99 -113 4.71887 0.289
NP_442050.1_1 Reverse -185 -204 13.8641 0.187
NP_442050.1_5 Forward -117 -107 17.1874 0.00812
NP_442050.1_5 Reverse -104 -114 15.9091 0.0091
NP_442342.1_9 Reverse -104 -120 8.22001 0.194
NP_442342.1_9 Reverse -234 -250 2.61514 0.285
NP_442747.1_1 Reverse -180 -199 -15.9302 0.236
NP_440558.1_2 Forward -172 -153 4.22769 0.152
NP_440558.1_2 Forward -392 -373 -0.197208 0.198
NP_440558.1_2 Forward -99 -80 -3.54046 0.236
NP_440558.1_2 Reverse -276 -295 -5.21209 0.254
NP_442789.1_4 Reverse -155 -174 1.76941 0.185
NP_441878.1_6 Forward -116 -106 10.5014 0.0176
NP_441878.1_6 Reverse -105 -115 10.5014 0.0176
NP_441036.1_3 Forward -352 -333 -5.9004 0.298
NP_441036.1_8 Forward -116 -106 15.713 0.00724
NP_441036.1_8 Reverse -105 -115 15.713 0.00724
NP_441557.1_5 Forward -115 -106 19.9609 0.000699
NP_441557.1_5 Reverse -106 -115 19.9609 0.000699
NP_441557.1_8 Reverse -29 -39 12.7626 0.235
NP_441433.1_8 Forward -364 -345 5.60432 0.178
NP_441308.1_8 Forward -117 -107 12.4681 0.218
NP_440101.1_3 Reverse -50 -69 5.50599 0.195
NP_440101.1_3 Reverse -101 -120 2.85105 0.244
NP_440101.1_3 Reverse -149 -168 2.65439 0.25
NP_441458.1_10 Forward -98 -79 6.68596 0.197
NP_442830.1_5 Reverse -26 -40 10.8154 0.168
NP_442183.1_1 Reverse -106 -120 8.45605 0.115
NP_441549.1_9 Reverse -102 -120 -4.8974 0.198
NP_441549.1_9 Forward -119 -101 -7.749 0.212
NP_441238.1_10 Reverse -41 -55 18.0925 0.2
NP_442347.1_2 Reverse -29 -38 5.89959 0.21
NP_442347.1_2 Forward -114 -105 3.34298 0.284
NP_442347.1_2 Reverse -107 -116 3.34298 0.284
NP_442645.1_2 Forward -391 -372 -20.5517 0.288
NP_442645.1_2 Reverse -98 -117 -21.535 0.29
NP_441037.1_4 Forward -117 -107 16.5761 0.0168
NP_441037.1_4 Reverse -104 -114 7.22024 0.237
NP_442738.1_3 Reverse -152 -171 15.6341 0.162
NP_441633.1_3 Reverse -104 -117 5.91914 0.0481
NP_440136.1_2 Forward -114 -107 15.9687 0.0123
NP_440136.1_2 Reverse -107 -114 15.9687 0.0123
NP_440136.1_2 Forward -36 -29 4.26735 0.218
NP_442590.1_10 Reverse -99 -118 15.3391 0.113
NP_442998.1_5 Forward -342 -332 9.12481 0.252
NP_442998.1_5 Forward -353 -343 7.05986 0.3
NP_442998.1_10 Forward -113 -106 15.5754 0.0102
NP_442998.1_10 Reverse -108 -115 15.5754 0.0102
NP_440299.1_1 Forward -119 -106 12.7034 0.0356
NP_440299.1_1 Reverse -102 -115 5.0336 0.191
NP_441799.1_1 Reverse -102 -116 18.4851 0.0085
NP_441799.1_1 Forward -119 -105 7.76712 0.133
NP_441007.1_10 Forward -120 -107 3.85419 0.182
NP_441007.1_10 Reverse -101 -114 1.39592 0.203
NP_442201.1_10 Reverse -95 -114 -8.16202 0.213
NP_440256.1_1 Forward -118 -99 10.3242 0.0186
NP_441362.1_2 Forward -350 -331 3.64276 0.299
NP_441559.1_8 Forward -120 -106 10.7177 0.0574
NP_441559.1_8 Reverse -101 -115 8.65272 0.0676
NP_441559.1_8 Reverse -23 -37 -2.85201 0.195
NP_441559.1_8 Forward -106 -92 -4.7203 0.236
NP_441559.1_8 Forward -201 -187 -6.58858 0.279
NP_440915.1_5 Forward -299 -280 14.0314 0.289
NP_440915.1_6 Forward -119 -105 22.4191 0.00257
NP_440915.1_6 Reverse -102 -116 9.14437 0.0457
NP_440997.1_7 Forward -307 -288 11.1109 0.137
NP_440164.1_5 Forward -299 -280 5.01433 0.181
NP_441866.1_6 Forward -177 -158 6.48849 0.285
NP_441704.1_8 Forward -262 -243 6.68515 0.258
NP_442452.1_8 Forward -121 -107 13.7653 0.273
NP_442452.1_8 Reverse -236 -250 12.9786 0.273
NP_442452.1_10 Forward -200 -181 11.4058 0.297
NP_442866.1_1 Reverse -101 -120 -5.80207 0.245
NP_441494.1_6 Forward -120 -107 8.9674 0.227
NP_439985.1_7 Reverse -100 -119 2.3594 0.29
NP_442993.1_1 Forward -108 -92 -3.18639 0.126
NP_442993.1_1 Reverse -166 -182 -7.41462 0.146
NP_442993.1_1 Reverse -106 -122 -9.28291 0.181
NP_442993.1_1 Reverse -380 -396 -11.8395 0.26
NP_440677.1_8 Reverse -371 -390 13.4708 0.281
NP_442386.1_9 Forward -116 -107 6.39082 0.219
NP_442386.1_9 Reverse -105 -114 6.39082 0.219
NP_442386.1_9 Reverse -27 -36 5.60418 0.245
NP_441750.1_4 Reverse -112 -131 1.67108 0.276
NP_441340.1_5 Forward -114 -107 15.6737 0.0124
NP_441340.1_5 Reverse -107 -114 15.6737 0.0124
NP_441340.1_9 Forward -144 -134 8.93007 0.256
NP_442186.1_9 Forward -397 -378 10.8159 0.199
NP_441271.1_8 Forward -301 -291 14.3364 0.266
NP_442484.1_2 Forward -174 -155 3.24438 0.21
NP_442791.1_5 Forward -315 -296 -7.37537 0.279
NP_442240.1_2 Forward -114 -95 -3.63879 0.0766
NP_442950.1_1 Forward -394 -375 11.1109 0.105
NP_440586.1_8 Forward -114 -107 13.2151 0.026
NP_440586.1_8 Reverse -107 -114 13.2151 0.026
NP_440586.1_8 Forward -244 -237 9.08521 0.178
NP_442251.1_6 Forward -114 -107 15.2804 0.0124
NP_442251.1_6 Reverse -107 -114 15.2804 0.0124
NP_441262.1_3 Reverse -106 -113 14.7888 0.0223
NP_441262.1_3 Forward -115 -108 14.7888 0.0223
NP_440027.1_3 Reverse -96 -114 7.88485 0.202
NP_440027.1_3 Reverse -28 -46 1.78836 0.295
NP_443051.1_1 Reverse -105 -114 19.5676 0.00335
NP_443051.1_1 Forward -116 -107 19.5676 0.00335
NP_439937.1_8 Reverse -155 -174 -4.6221 0.286
NP_439937.1_9 Reverse -105 -122 -6.64833 0.157
NP_439937.1_9 Forward -63 -46 -15.9897 0.287
NP_440926.1_5 Reverse -369 -388 12.9791 0.23
NP_440398.1_6 Forward -59 -40 4.916 0.275
NP_440439.1_1 Reverse -103 -116 20.0788 0.0105
NP_440439.1_1 Forward -118 -105 17.2272 0.0108
NP_440439.1_1 Reverse -199 -212 -1.25902 0.259
NP_440372.1_2 Forward -114 -107 16.3621 0.0124
NP_440372.1_2 Reverse -107 -114 16.3621 0.0124
NP_442783.1_2 Forward -315 -296 9.93088 0.247
NP_440819.1_5 Forward -397 -389 7.98423 0.228
NP_440316.1_10 Forward -360 -350 8.73149 0.239
NP_440316.1_10 Reverse -202 -212 6.17489 0.265
NP_439977.1_5 Forward -121 -102 0.687771 0.205
NP_439977.1_5 Reverse -100 -119 -0.885524 0.236
NP_440139.1_1 Reverse -100 -119 4.62021 0.177
NP_441572.1_7 Forward -121 -102 17.3057 0.0223
NP_440267.1_2 Reverse -101 -115 11.012 0.125
NP_442384.1_10 Forward -115 -102 19.4888 0.00338
NP_442384.1_10 Reverse -106 -119 9.36073 0.054
NP_442384.1_10 Forward -154 -141 7.78743 0.0743
NP_442384.1_10 Reverse -28 -41 0.707601 0.282
NP_441877.1_5 Forward -142 -123 -1.86883 0.291
NP_441877.1_9 Forward -144 -127 2.39878 0.29
NP_442790.1_4 Forward -124 -105 -6.29373 0.144
NP_442262.1_10 Forward -114 -107 14.1988 0.0123
NP_442262.1_10 Reverse -107 -114 14.1988 0.0123
NP_442262.1_10 Forward -244 -237 9.18389 0.211
NP_441689.1_5 Forward -117 -107 8.43603 0.132
NP_441689.1_5 Reverse -104 -114 8.3377 0.132
NP_440344.1_10 Reverse -21 -38 0.137172 0.0369
NP_440344.1_10 Forward -122 -105 -7.53264 0.118
NP_440531.1_6 Forward -45 -26 -2.95047 0.26
NP_440531.1_6 Forward -358 -339 -4.32711 0.279
NP_440562.1_3 Reverse -107 -124 4.16874 0.201
NP_441965.1_10 Reverse -229 -245 2.51681 0.287
NP_441898.1_2 Reverse -307 -326 17.4032 0.162
NP_442693.1_6 Forward -53 -34 0.491109 0.278
NP_440297.1_1 Reverse -182 -201 10.8159 0.181
NP_440297.1_9 Forward -388 -378 6.17489 0.2
NP_440297.1_9 Forward -114 -104 -0.216628 0.282
NP_440297.1_9 Reverse -237 -247 -0.216628 0.282
NP_440297.1_9 Reverse -107 -117 -0.314959 0.282
NP_442280.1_10 Forward -173 -155 7.69463 0.268
NP_440700.1_8 Reverse -279 -293 10.521 0.292
NP_440999.1_5 Reverse -229 -248 5.11187 0.291
NP_440999.1_9 Forward -119 -105 10.4227 0.0529
NP_440999.1_9 Reverse -24 -38 2.16287 0.154
NP_440999.1_9 Reverse -102 -116 -2.85201 0.279
NP_440888.1_2 Forward -115 -101 17.1085 0.00462
NP_440888.1_2 Reverse -106 -120 16.0269 0.00832
NP_440888.1_2 Forward -95 -81 8.45543 0.16
NP_440600.1_4 Reverse -98 -116 -0.865831 0.159
NP_439969.1_3 Forward -120 -101 8.94757 0.124
NP_442948.1_2 Reverse -105 -124 7.57094 0.222
NP_442277.1_4 Reverse -97 -116 10.3234 0.0949
NP_442033.1_10 Reverse -104 -123 8.06259 0.0582
NP_442033.1_10 Reverse -26 -45 7.96426 0.0582
NP_441543.1_2 Forward -114 -105 15.9293 0.00518
NP_441543.1_2 Reverse -107 -116 15.9293 0.00518
NP_441543.1_2 Reverse -29 -38 5.70292 0.181
NP_441543.1_3 Forward -54 -40 7.96378 0.286
NP_442845.1_2 Forward -121 -107 10.226 0.156
NP_442845.1_2 Reverse -226 -240 4.12949 0.267
NP_441551.1_5 Reverse -102 -118 9.69426 0.207
NP_441469.1_8 Forward -116 -107 6.5879 0.227
NP_441469.1_8 Reverse -105 -114 6.5879 0.227
NP_441469.1_8 Reverse -27 -36 6.09625 0.236
NP_443064.1_6 Forward -115 -105 10.8217 0.13
NP_443064.1_6 Reverse -106 -116 10.8217 0.13
NP_442337.1_8 Forward -48 -29 9.53756 0.169
NP_442337.1_8 Forward -371 -352 3.93269 0.21
NP_442578.1_7 Forward -114 -107 14.5921 0.026
NP_442578.1_7 Reverse -107 -114 14.5921 0.026
NP_440710.1_1 Reverse -98 -116 11.3272 0.0593
NP_441462.1_2 Forward -115 -105 20.2362 0.000805
NP_441462.1_2 Reverse -106 -116 20.2362 0.000805
NP_441621.1_7 Reverse -104 -118 4.62115 0.0934
NP_441621.1_7 Forward -117 -103 -5.11362 0.248
NP_443062.1_1 Reverse -236 -254 7.18082 0.182
NP_443062.1_1 Reverse -106 -124 6.49827 0.198
NP_440349.1_3 Forward -250 -231 10.9134 0.283
NP_442204.1_1 Forward -119 -108 11.9567 0.0565
NP_442204.1_1 Reverse -102 -113 9.59678 0.0736
NP_442204.1_1 Reverse -162 -173 1.14031 0.28
NP_441560.1_3 Reverse -179 -197 15.2604 0.159
NP_441560.1_8 Forward -120 -101 13.7526 0.205
NP_440516.1_2 Forward -121 -103 5.23069 0.132
NP_440516.1_8 Forward -115 -106 16.9127 0.00442
NP_440516.1_8 Reverse -106 -115 16.9127 0.00442
NP_440516.1_8 Forward -37 -28 -0.491928 0.262
NP_442428.1_5 Forward -114 -107 15.8704 0.0124
NP_442428.1_5 Reverse -107 -114 15.8704 0.0124
NP_441867.1_2 Forward -44 -25 -20.2567 0.291
NP_440673.1_3 Forward -113 -106 12.4288 0.0426
NP_440673.1_3 Reverse -108 -115 12.4288 0.0426
NP_440673.1_3 Forward -173 -166 6.23397 0.283
NP_441052.1_2 Reverse -28 -38 15.418 0.0117
NP_441052.1_2 Forward -115 -105 10.4031 0.0285
NP_441052.1_2 Reverse -106 -116 10.4031 0.0285
NP_442219.1_9 Forward -114 -105 8.25953 0.0681
NP_442219.1_9 Reverse -107 -116 8.25953 0.0681
NP_442219.1_9 Reverse -29 -38 5.01461 0.193
NP_440436.1_4 Forward -114 -105 9.24241 0.0871
NP_440436.1_4 Reverse -107 -116 9.24241 0.0871
NP_440436.1_4 Reverse -29 -38 4.62087 0.248
NP_441884.1_9 Forward -118 -99 -21.83 0.266
NP_442412.1_3 Forward -329 -310 12.2908 0.248
NP_440314.1_9 Reverse -107 -126 1.47442 0.0898
NP_441669.1_2 Forward -382 -368 17.5018 0.279
NP_442907.1_9 Forward -120 -101 0.491109 0.207
NP_441719.1_4 Forward -114 -107 16.3621 0.0124
NP_441719.1_4 Reverse -107 -114 16.3621 0.0124
NP_441733.1_10 Forward -118 -105 6.21414 0.199
NP_442366.1_3 Reverse -105 -123 -4.11075 0.264
NP_439949.1_7 Reverse -48 -62 12.1926 0.269
NP_440296.1_10 Forward -118 -99 -2.36049 0.209
NP_441115.1_4 Reverse -105 -123 17.3246 0.0189
NP_441115.1_4 Forward -116 -98 16.5379 0.0266
NP_442206.1_10 Reverse -106 -121 2.8315 0.198
NP_440328.1_4 Reverse -100 -119 9.43923 0.0991
NP_440094.1_2 Forward -174 -155 -3.04881 0.281
NP_443054.1_2 Reverse -104 -118 0.786239 0.254
NP_441851.1_10 Forward -116 -106 8.53483 0.114
NP_441851.1_10 Reverse -105 -115 8.53483 0.114
NP_442208.1_5 Forward -366 -347 -7.67036 0.274
NP_442622.1_1 Reverse -144 -163 -5.60541 0.257
NP_442856.1_7 Reverse -145 -164 -3.04881 0.24
NP_440593.1_3 Forward -174 -155 6.39097 0.112
NP_440593.1_3 Reverse -155 -174 -5.40875 0.259
NP_440463.1_7 Forward -295 -281 15.7325 0.239
NP_440165.1_5 Reverse -105 -124 1.76941 0.118
NP_440165.1_5 Forward -116 -97 -6.29373 0.231
NP_442709.1_4 Reverse -121 -140 8.36523 0.161
NP_442689.1_8 Reverse -333 -350 -7.43431 0.292
NP_441349.1_10 Forward -125 -106 -3.63879 0.147
NP_441349.1_10 Reverse -96 -115 -6.1954 0.223
NP_441409.1_6 Forward -121 -102 2.0644 0.0584
NP_440432.1_9 Forward -114 -99 4.69978 0.0652
NP_442843.1_1 Forward -358 -339 -9.047 0.264
NP_440474.1_8 Forward -114 -100 4.42388 0.279
NP_440588.1_2 Forward -124 -105 -2.65548 0.17
NP_441031.1_8 Reverse -192 -211 -3.24547 0.248
NP_442006.1_2 Forward -359 -342 0.137172 0.13
NP_442006.1_3 Forward -41 -23 1.39578 0.238
NP_441003.1_9 Forward -178 -159 10.9142 0.213
NP_440483.1_1 Reverse -38 -57 -8.35868 0.282
NP_441570.1_1 Forward -115 -97 1.19912 0.0325
NP_441078.1_4 Forward -115 -106 19.6659 0.0007
NP_441078.1_4 Reverse -106 -115 19.6659 0.0007
NP_441078.1_4 Reverse -28 -37 5.70292 0.111
NP_441078.1_4 Reverse -173 -182 3.53964 0.136
NP_442348.1_2 Reverse -379 -388 8.1612 0.28
NP_440707.1_6 Reverse -98 -117 15.8299 0.172
NP_442443.1_1 Forward -296 -277 0.392778 0.218
NP_442443.1_1 Forward -358 -339 -3.54046 0.267
NP_440526.1_3 Reverse -107 -118 9.3996 0.0876
NP_441432.1_3 Forward -63 -44 11.7 0.275
NP_441432.1_8 Reverse -105 -114 16.8143 0.00595
NP_441432.1_8 Forward -116 -107 16.8143 0.00595
NP_441432.1_8 Reverse -165 -174 2.75299 0.287
NP_442320.1_8 Forward -121 -107 -0.688726 0.0817
NP_441732.1_2 Forward -119 -103 3.30346 0.0141
NP_441732.1_2 Reverse -102 -118 -6.52964 0.0495
NP_440629.1_4 Forward -388 -369 10.3242 0.238
NP_442815.1_2 Reverse -155 -173 12.4089 0.144
NP_440760.1_1 Reverse -106 -125 -23.2067 0.288
NP_442797.1_7 Reverse -349 -367 2.28076 0.243
NP_441805.1_2 Forward -126 -107 -4.32711 0.275
NP_441057.1_4 Forward -105 -87 5.82068 0.195
NP_442353.1_4 Reverse -22 -41 3.83357 0.21
NP_440913.1_1 Forward -117 -99 4.73903 0.257
NP_441072.1_2 Reverse -95 -114 7.47261 0.257
NP_440713.1_4 Forward -125 -106 8.84924 0.159
NP_442489.1_2 Reverse -149 -168 1.47442 0.289
NP_442489.1_7 Forward -115 -106 20.1576 0.000695
NP_442489.1_7 Reverse -106 -115 20.1576 0.000695
NP_440559.1_1 Reverse -107 -116 8.65285 0.0586
NP_440559.1_1 Forward -114 -105 8.65285 0.0586
NP_441659.2_8 Forward -115 -105 20.9245 0.000805
NP_441659.2_8 Reverse -106 -116 20.9245 0.000805
NP_441022.1_1 Forward -10 -1 11.1625 0.284
NP_442913.1_10 Reverse -97 -116 5.70265 0.0684
NP_442913.1_10 Forward -124 -105 -3.3438 0.207
NP_441040.1_2 Forward -192 -173 -9.83364 0.24
NP_439956.1_7 Reverse -32 -51 7.17762 0.257
NP_442008.1_2 Forward -118 -99 14.4541 0.0806
NP_440708.1_6 Forward -51 -32 -1.67217 0.201
NP_442776.1_2 Forward -128 -109 10.2259 0.258
NP_442346.1_5 Forward -116 -106 16.303 0.00248
NP_442346.1_5 Reverse -105 -115 16.303 0.00248
NP_440545.1_3 Forward -119 -102 23.7366 0.00452
NP_440545.1_3 Reverse -102 -119 19.3117 0.00865
NP_440545.1_3 Forward -167 -150 -4.28772 0.223
NP_440545.1_4 Forward -181 -162 17.699 0.234
NP_440545.1_5 Forward -41 -24 3.77542 0.286
NP_441856.1_3 Reverse -103 -122 10.0292 0.101
NP_441923.1_8 Reverse -341 -355 12.7826 0.286
NP_440459.1_2 Reverse -151 -168 7.80699 0.278
NP_440010.1_7 Forward -27 -8 14.3558 0.293
NP_440847.1_3 Reverse -342 -356 12.0937 0.254
NP_442603.1_7 Reverse -106 -120 10.0287 0.134
NP_440946.1_6 Forward -199 -180 1.47442 0.294
NP_440449.1_6 Forward -183 -165 14.6752 0.0924
NP_440449.1_6 Forward -123 -105 8.93668 0.191
NP_441948.1_4 Reverse -99 -117 -0.7675 0.139
NP_441948.1_4 Forward -44 -26 -1.06249 0.14
NP_441358.1_2 Forward -41 -22 7.27595 0.275
NP_441502.1_3 Forward -39 -20 6.58763 0.26
NP_441833.1_4 Forward -114 -107 15.9687 0.0124
NP_441833.1_4 Reverse -107 -114 15.9687 0.0124
NP_441895.1_2 Reverse -34 -53 -17.0118 0.188
NP_441895.1_2 Reverse -33 -52 -26.9432 0.275
NP_442162.1_9 Forward -114 -107 16.2637 0.0124
NP_442162.1_9 Reverse -107 -114 16.2637 0.0124
NP_440671.1_4 Forward -121 -107 7.9644 0.205
NP_440671.1_4 Reverse -236 -250 5.80112 0.271
NP_440671.1_4 Reverse -160 -174 5.60446 0.279
NP_442140.1_3 Reverse -107 -117 7.94484 0.124
NP_442140.1_3 Forward -114 -104 4.69992 0.238
NP_440875.1_9 Reverse -108 -118 17.5217 0.0116
NP_440875.1_9 Forward -113 -103 13.5309 0.0677
NP_442547.1_7 Reverse -150 -169 11.585 0.255
NP_441813.1_5 Reverse -104 -114 18.1713 0.00743
NP_441813.1_5 Forward -117 -107 8.73149 0.0367
NP_441813.1_5 Reverse -26 -36 -0.216628 0.237
NP_440594.1_8 Forward -114 -101 10.7368 0.159
NP_440590.1_4 Reverse -107 -120 6.4108 0.0575
NP_440590.1_4 Forward -114 -101 3.16588 0.0756
NP_440590.1_4 Forward -36 -23 2.96921 0.0783
NP_440567.1_1 Forward -114 -100 11.2093 0.0294
NP_440567.1_1 Reverse -107 -121 9.83269 0.0414
NP_440567.1_1 Reverse -284 -298 -0.393733 0.281
NP_442497.1_10 Forward -114 -105 17.601 0.00813
NP_442497.1_10 Reverse -107 -116 17.601 0.00813
NP_440821.1_4 Forward -117 -107 10.7964 0.0146
NP_440821.1_4 Reverse -104 -114 2.24165 0.131
NP_441239.1_9 Forward -117 -105 14.887 0.0247
NP_441239.1_9 Reverse -104 -116 13.0187 0.0389
NP_441892.1_1 Reverse -348 -365 -3.8944 0.251
NP_441892.1_1 Reverse -97 -114 -3.8944 0.251
NP_440665.1_2 Reverse -348 -367 0.687771 0.188
NP_440665.1_2 Forward -189 -170 -6.29373 0.265
NP_441017.1_6 Forward -249 -235 14.7486 0.138
NP_440546.1_4 Reverse -106 -116 13.5365 0.0459
NP_440546.1_4 Forward -115 -105 13.5365 0.0459
NP_440546.1_4 Forward -188 -178 7.13728 0.257
NP_440546.1_4 Forward -37 -27 6.94336 0.269
NP_440546.1_6 Forward -298 -279 9.83255 0.247
NP_440462.1_6 Forward -117 -107 19.4496 0.00371
NP_440462.1_6 Reverse -104 -114 18.7612 0.00454
NP_442611.1_1 Reverse -106 -125 12.7825 0.07
NP_440868.1_4 Reverse -102 -114 17.6402 0.0124
NP_440868.1_4 Forward -119 -107 7.4138 0.0691
NP_442402.1_4 Reverse -335 -354 2.26028 0.166
NP_442402.1_4 Reverse -326 -345 -3.34455 0.214
NP_442402.1_4 Forward -190 -171 -8.94939 0.285
NP_442402.1_10 Reverse -345 -355 13.5492 0.2
NP_442402.1_10 Forward -57 -47 12.6642 0.204
NP_442402.1_10 Reverse -344 -354 12.3692 0.212
NP_441848.1_4 Forward -18 -2 9.36501 0.285
NP_441848.1_9 Forward -54 -43 11.2679 0.268
NP_440696.1_3 Forward -115 -97 2.0841 0.217
NP_440696.1_3 Reverse -102 -120 -2.43913 0.274
NP_442882.1_8 Forward -369 -350 5.80098 0.295
NP_442039.1_4 Forward -114 -107 15.1821 0.0124
NP_442039.1_4 Reverse -107 -114 15.1821 0.0124
NP_442039.1_7 Forward -357 -347 10.8948 0.257
NP_441811.1_1 Reverse -342 -361 5.50599 0.28
NP_441926.1_3 Forward -115 -99 4.97508 0.175
NP_442837.1_3 Forward -114 -107 15.7721 0.0124
NP_442837.1_3 Reverse -107 -114 15.7721 0.0124
NP_442837.1_3 Forward -240 -233 5.84064 0.272
NP_440160.1_9 Reverse -279 -298 17.404 0.131
NP_439994.1_3 Reverse -105 -124 16.4378 0.0785
NP_442053.1_1 Forward -115 -106 18.3876 0.0007
NP_442053.1_1 Reverse -106 -115 18.3876 0.0007
NP_442053.1_1 Forward -37 -28 4.52295 0.242
NP_440505.1_3 Reverse -104 -114 17.188 0.00332
NP_440505.1_3 Forward -39 -29 16.1063 0.00763
NP_440505.1_3 Forward -117 -107 15.418 0.0114
NP_440505.1_3 Reverse -297 -307 4.40493 0.292
NP_440505.1_7 Forward -186 -167 4.916 0.191
NP_441203.1_1 Reverse -107 -126 -4.6221 0.0797
NP_440914.1_1 Forward -115 -105 16.3248 0.00196
NP_440914.1_1 Reverse -106 -116 16.3248 0.00196
NP_441011.1_8 Forward -114 -105 16.6177 0.00602
NP_441011.1_8 Reverse -107 -116 16.6177 0.00602
NP_442533.1_1 Forward -368 -349 -17.8968 0.297
NP_442533.1_6 Forward -115 -106 17.2076 0.00137
NP_442533.1_6 Reverse -106 -115 17.2076 0.00137
NP_442533.1_6 Forward -175 -166 2.65466 0.246
NP_442541.1_10 Forward -96 -82 6.19383 0.248
NP_442322.1_4 Forward -55 -38 4.46302 0.189
NP_441482.1_7 Forward -121 -107 -0.885388 0.0612
NP_441482.1_7 Forward -389 -375 -11.4068 0.262
NP_441482.1_7 Reverse -100 -114 -12.1934 0.29
NP_439944.1_8 Forward -399 -380 10.7175 0.298
NP_439944.1_9 Reverse -107 -117 17.7779 0.00341
NP_439944.1_9 Forward -114 -104 9.12481 0.1
NP_440816.1_7 Forward -119 -100 11.4058 0.218
NP_441028.1_6 Reverse -345 -355 8.04271 0.217
NP_441028.1_6 Reverse -336 -346 5.19112 0.265
NP_441028.1_6 Reverse -346 -356 4.10949 0.278
NP_440116.1_8 Reverse -107 -126 -6.78538 0.216
NP_440115.1_6 Forward -118 -108 16.9913 0.0288
NP_440115.1_6 Reverse -103 -113 13.0581 0.0818
NP_440007.1_9 Forward -119 -105 3.44117 0.269
NP_441680.1_4 Reverse -351 -370 -3.3438 0.291
NP_441602.1_3 Forward -200 -181 -5.31042 0.282
NP_441602.1_4 Reverse -95 -114 8.94757 0.279
NP_441972.1_5 Reverse -155 -174 -5.9004 0.226
NP_441106.1_1 Reverse -105 -114 18.486 0.0028
NP_441106.1_1 Forward -116 -107 18.486 0.0028
NP_439903.1_6 Forward -178 -159 -0.197979 0.277
NP_442588.1_6 Reverse -35 -54 2.0644 0.231
NP_442928.1_3 Reverse -172 -191 10.9704 0.3
NP_442306.1_10 Reverse -101 -120 -10.227 0.11
NP_441286.1_1 Reverse -105 -117 5.25052 0.0259
NP_441286.1_1 Forward -116 -104 -3.50094 0.145
NP_440670.1_8 Forward -115 -106 18.3876 0.000699
NP_440670.1_8 Reverse -106 -115 18.3876 0.000699
NP_440886.1_7 Reverse -27 -37 14.5325 0.0475
NP_440886.1_7 Forward -116 -106 8.04271 0.0805
NP_440886.1_7 Reverse -105 -115 8.04271 0.0805
NP_442614.1_2 Forward -115 -101 6.29277 0.291
NP_442382.1_9 Forward -173 -154 8.06178 0.29
NP_442072.1_9 Forward -116 -98 -11.5839 0.0789
NP_442072.1_9 Reverse -105 -123 -22.007 0.216
NP_442072.1_9 Forward -196 -178 -23.0886 0.277
NP_441753.1_10 Reverse -97 -116 3.83436 0.206
NP_440028.1_6 Reverse -75 -93 11.8189 0.253
NP_440907.2_8 Reverse -107 -117 19.1541 0.00362
NP_440907.2_8 Forward -114 -104 9.616 0.103
NP_442264.1_2 Reverse -232 -249 14.6902 0.128
NP_442264.1_2 Forward -255 -238 7.31533 0.242
NP_441463.1_6 Forward -253 -239 7.86544 0.25
NP_441463.1_6 Reverse -240 -254 7.09237 0.265
NP_441626.1_2 Forward -114 -107 15.7721 0.0124
NP_441626.1_2 Reverse -107 -114 15.7721 0.0124
NP_442365.1_7 Forward -119 -100 0.491109 0.177
NP_442794.1_1 Forward -119 -107 3.57889 0.286
NP_442615.1_1 Forward -124 -106 14.4738 0.00979
NP_441962.1_4 Reverse -155 -174 -12.2919 0.255
NP_441962.1_9 Forward -199 -180 8.94757 0.258
NP_440387.1_1 Reverse -106 -122 8.22001 0.0282
NP_440387.1_1 Forward -115 -99 7.92501 0.0282
NP_441431.1_2 Reverse -103 -117 12.487 0.116
NP_441431.1_2 Forward -118 -104 7.66879 0.237
NP_441836.1_2 Reverse -100 -119 8.65258 0.101
NP_441836.1_2 Reverse -185 -204 -5.60541 0.284
NP_441993.1_1 Reverse -374 -393 3.89583 0.227
NP_441993.1_1 Forward -115 -96 1.4594 0.276
NP_441174.1_2 Reverse -103 -117 15.8309 0.0907
NP_440114.1_10 Forward -115 -101 16.2242 0.0194
NP_442090.1_3 Reverse -361 -380 12.2875 0.261
NP_442323.1_7 Reverse -101 -120 14.9449 0.0715
NP_440287.1_5 Reverse -19 -38 9.34008 0.286
NP_440766.1_4 Forward -119 -105 6.78443 0.0973
NP_439988.1_7 Forward -113 -99 13.1753 0.292
NP_442930.1_1 Forward -339 -329 10.1076 0.278
NP_439910.1_2 Reverse -20 -37 -22.184 0.215
NP_442278.1_3 Reverse -142 -160 14.6086 0.256
NP_440457.1_1 Reverse -102 -114 10.8554 0.092
NP_440457.1_1 Forward -119 -107 6.72548 0.113
NP_440798.1_6 Forward -114 -101 13.0973 0.0445
NP_442680.1_5 Forward -353 -334 2.51449 0.237
NP_440801.1_9 Reverse -137 -151 21.2706 0.0375
NP_442297.1_4 Reverse -102 -121 17.101 0.128
NP_442297.1_4 Forward -41 -22 11.8488 0.294
NP_441984.1_3 Forward -393 -375 6.214 0.273
NP_440054.1_7 Reverse -267 -286 15.9291 0.126
NP_442509.1_9 Reverse -106 -116 8.04271 0.192
NP_442509.1_9 Forward -115 -105 8.04271 0.192
NP_441253.1_8 Reverse -369 -383 14.8231 0.128
NP_442514.1_5 Forward -367 -348 -9.73604 0.298
NP_440554.1_4 Forward -114 -104 17.9746 0.0131
NP_440554.1_4 Reverse -107 -117 15.418 0.0199
NP_442862.1_3 Reverse -332 -349 5.64371 0.268
NP_441885.1_5 Forward -115 -105 11.3864 0.00668
NP_441885.1_5 Reverse -106 -116 11.3864 0.00668
NP_441885.1_5 Reverse -28 -38 7.55152 0.0511
NP_441885.1_5 Reverse -173 -183 -1.78992 0.284
NP_440478.1_10 Forward -117 -103 7.37441 0.262
NP_442341.1_7 Reverse -105 -119 2.35953 0.259
NP_442341.1_9 Reverse -104 -118 11.012 0.133
NP_442341.1_9 Forward -321 -307 4.62054 0.296
NP_441756.1_5 Forward -119 -100 15.4374 0.0803
NP_441756.1_5 Forward -186 -167 -3.93378 0.29
NP_441173.1_9 Reverse -346 -354 11.3271 0.226
NP_442395.2_4 Reverse -105 -124 -0.0996487 0.282
NP_442534.1_7 Reverse -98 -117 14.8474 0.181
NP_443000.1_7 Reverse -104 -114 20.3345 0.00223
NP_443000.1_7 Forward -117 -107 10.7964 0.0345
NP_443000.1_7 Forward -39 -29 0.668351 0.293
NP_441842.1_1 Forward -113 -100 15.6533 0.0619
NP_441842.1_1 Reverse -30 -43 12.605 0.197
NP_440275.1_3 Forward -117 -107 18.6629 0.0082
NP_440275.1_3 Reverse -104 -114 16.1063 0.0155
NP_440560.1_5 Forward -59 -40 10.679 0.259
NP_440091.1_1 Reverse -102 -114 0.825626 0.227
NP_440679.1_10 Reverse -276 -295 -19.9617 0.283
NP_440149.1_10 Reverse -166 -185 -11.3086 0.285
NP_441105.1_3 Forward -126 -107 1.96607 0.108
NP_441105.1_3 Forward -299 -280 -6.49039 0.236
NP_441105.1_3 Reverse -168 -187 -7.37537 0.251
NP_441105.1_3 Reverse -369 -388 -9.14533 0.284
NP_442373.1_2 Forward -43 -24 -5.50708 0.22
NP_440216.1_1 Forward -115 -101 27.2373 0.000481
NP_440216.1_1 Reverse -106 -120 -2.45868 0.0513
NP_440216.1_9 Reverse -238 -247 7.76787 0.286
NP_440216.1_9 Reverse -162 -171 7.37455 0.286
NP_440172.1_1 Forward -115 -105 17.5813 0.00421
NP_440172.1_1 Reverse -106 -116 17.5813 0.00421
NP_442371.1_1 Forward -355 -345 14.8275 0.183
NP_442015.1_10 Forward -119 -106 4.54251 0.167
NP_442015.1_10 Reverse -102 -115 4.14919 0.178
NP_442015.1_10 Reverse -112 -125 4.05085 0.178
NP_441226.1_7 Forward -114 -107 14.4934 0.0123
NP_441226.1_7 Reverse -107 -114 14.4934 0.0123
NP_441111.1_7 Forward -114 -106 18.7023 0.00294
NP_441111.1_7 Reverse -107 -115 18.7023 0.00294
NP_442379.1_10 Reverse -99 -116 15.1818 0.0453
NP_441766.1_2 Forward -115 -106 17.5026 0.00297
NP_441766.1_2 Reverse -106 -115 17.5026 0.00297
NP_440416.1_9 Forward -252 -233 -16.9135 0.226
NP_440416.1_9 Reverse -99 -118 -17.9951 0.25
NP_440416.1_9 Forward -213 -194 -18.0934 0.251
NP_440416.1_9 Forward -190 -171 -18.7818 0.264
NP_440416.1_9 Forward -170 -151 -20.65 0.287
NP_440416.1_9 Forward -122 -103 -20.7484 0.288
NP_443052.1_9 Reverse -340 -359 -4.6221 0.259
NP_441940.1_4 Forward -118 -99 6.98095 0.286
NP_441974.1_3 Reverse -44 -61 13.9495 0.294
NP_442403.1_9 Forward -200 -181 4.12936 0.244
NP_442154.1_1 Reverse -39 -57 -19.0571 0.289
NP_442564.1_10 Reverse -348 -362 9.5377 0.296
NP_440261.1_5 Reverse -107 -120 6.4108 0.0368
NP_440261.1_5 Forward -114 -101 5.03416 0.0478
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAACGGGAAGAAGCCAAGACCCTTGCTAATTTGACTGGTTGGCCCCTGGGGGAAATTGAGGACAAAATTAACTATCTGGAAGGCCCCCGGGATTCTATTCCCTGGTGGCGCAAACTCTGGCCCCGTTAAAGTTGAAGTAACTTATACATCTCAATTGCCATGGATCCCTTAACCAAATTAGTTTTAAGCGCCACTACCCTGCCCGTGCTTTCCGCCCTGGGTTTAGCCCGTTGCCTTGGTCAACGCAGTGAAGCCCTAGGTAAACTTTCCGAAGAAGTGTTCCGAGGCGATCGCCTGCCGGTGTTACCCTTTCCCGTCGAAGAAGAAGCAGGTTAAAGTGAATACTCCCCCCAAACCTTGGCTGGGGATAGCGGGTGAGTTGTAATTTGACTAAAACTTT

CDS

ATGGGTCATTTTCCCCACAAACTGCGGGTGCTGTTGAGCGTTTACTTTGCCCAAATGGTGGAGTACCGGGCAGAAATTTTCTTTTGGATTTTGTCCGGCTCCCTGCCTCTAATTTTGATGGGCGTGTGGGTGAAAGCAGCGGAGAGTGGCGACTTTACCCTTGACGCGATCCAGGTGGCCCGGTATTTTTTTGCTGTCTTTGTGGTGCGCCAGATGACCACCATCTGGGTAATTTGGGAATTTGAAAAGGAAGTGCTGGAAGGAGTTTTATCTTTCCGTTTACTGCAACCCCTAGATCCGGTGTGGCATCATATAGCCCGCCACTGGGCCGAAAAAATGACCCGCCTGCCCATTCTGGCTATTTTGACTGTTCTTTTTTTCTCCCTCTATCCCGAAGCCTTTTGGCTGCCCGATCCCTGGCATTTTATCCAAGGGCTAATTGGCATTGTCTGTTCCTTTACCTTGTACTTTTTGATTCAGTACACCTTTGCCCTCTGTGCCTTTTGGACGGAACGGGCCAGCGCCCTCCAAGACCTCTGGTTTTTGTTTTATATTTTTCTGTCGGGCGTTATTGCTCCCCTAGAGACCTTTCCCGACGCAGTAAGGCAAATTGTTTTACTCACCCCGTTCCCCTACGGTGTTTACTTCCCCGCCGCCGCTTTGGTGGGTTTACCTTTGCCCTTCTTCAAGAGTTTATTAATTATTGGTGTTTGGATTGGCATATTTGCCCTGCTTAACCGTTGGCTATGGCGACAGGGTTTGAAACAATATTCTGGCATGGGAGCGTAG

Protein

MGHFPHKLRVLLSVYFAQMVEYRAEIFFWILSGSLPLILMGVWVKAAESGDFTLDAIQVARYFFAVFVVRQMTTIWVIWEFEKEVLEGVLSFRLLQPLDPVWHHIARHWAEKMTRLPILAILTVLFFSLYPEAFWLPDPWHFIQGLIGIVCSFTLYFLIQYTFALCAFWTERASALQDLWFLFYIFLSGVIAPLETFPDAVRQIVLLTPFPYGVYFPAAALVGLPLPFFKSLLIIGVWIGIFALLNRWLWRQGLKQYSGMGA