Your browser is old and dusty. Try Google Chrome!

Details for slr1171

ORF slr1171
Accession NP_441664.1
Symbol gpx1
Category Thioredoxin, glutaredoxin, and glutathione
Definition glutathione peroxidase-like NADPH peroxidase,glutathione peroxidase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -230 -211 -20.2567 0.108
NP_441453.1_7 Forward -377 -370 14.1988 0.175
NP_441453.1_7 Forward -316 -309 14.1988 0.175
NP_441623.1_1 Forward -351 -333 -2.14413 0.241
NP_441623.1_1 Forward -377 -359 -5.09406 0.283
NP_440561.1_8 Forward -238 -219 16.1257 0.24
NP_441818.1_9 Forward -241 -222 -8.55534 0.277
NP_441818.1_9 Forward -338 -319 -9.047 0.287
NP_442287.1_5 Forward -231 -221 14.9263 0.218
NP_442173.1_1 Reverse -95 -103 5.72262 0.203
NP_440784.1_7 Forward -214 -207 7.51227 0.138
NP_440061.1_9 Forward -307 -293 13.1753 0.0839
NP_440061.1_9 Reverse -204 -218 12.0937 0.102
NP_440061.1_9 Reverse -357 -371 10.8154 0.122
NP_441476.1_5 Reverse -201 -220 -4.32711 0.25
NP_442062.1_8 Forward -368 -358 4.69992 0.201
NP_440304.1_4 Forward -105 -95 3.71661 0.293
NP_441781.1_7 Reverse -358 -377 -2.26216 0.289
NP_441620.1_2 Forward -321 -303 19.4299 0.243
NP_441208.1_9 Forward -371 -357 13.6676 0.103
NP_441208.1_9 Reverse -91 -105 8.45605 0.219
NP_441594.1_6 Reverse -356 -375 1.86774 0.261
NP_441925.1_4 Reverse -214 -233 -7.08111 0.188
NP_441925.1_4 Forward -361 -342 -14.2592 0.261
NP_441925.1_4 Reverse -293 -312 -15.0459 0.263
NP_441925.1_4 Forward -206 -187 -16.6192 0.284
NP_441083.1_5 Reverse -94 -104 5.38824 0.12
NP_441083.1_5 Reverse -221 -231 2.83163 0.191
NP_442827.1_8 Forward -111 -92 5.89851 0.113
NP_441434.1_3 Forward -106 -87 2.94938 0.194
NP_441558.1_5 Reverse -92 -111 4.62101 0.276
NP_440407.1_6 Forward -228 -214 10.7177 0.28
NP_440447.1_5 Forward -317 -307 17.8763 0.277
NP_441770.1_4 Forward -376 -357 -6.1954 0.22
NP_442570.1_3 Forward -313 -294 5.99764 0.159
NP_442570.1_3 Forward -376 -357 -2.65548 0.212
NP_441716.1_1 Reverse -206 -220 3.63784 0.259
NP_440343.1_6 Forward -330 -311 14.8474 0.238
NP_440343.1_9 Forward -240 -221 14.9458 0.139
NP_440747.1_10 Forward -218 -206 -11.8591 0.161
NP_440057.1_6 Reverse -48 -67 9.2578 0.299
NP_441014.1_10 Forward -252 -233 -1.8696 0.267
NP_442848.1_5 Reverse -221 -239 -1.16082 0.276
NP_442848.1_9 Reverse -344 -363 -1.27885 0.288
NP_441634.1_8 Forward -306 -292 -2.16369 0.295
NP_440376.1_1 Forward -368 -359 4.52295 0.156
NP_440376.1_1 Forward -322 -313 1.76968 0.242
NP_440580.1_5 Forward -326 -312 19.3708 0.157
NP_442687.1_7 Forward -104 -94 6.56821 0.159
NP_442687.1_7 Reverse -358 -368 3.61828 0.299
NP_442485.1_3 Forward -364 -345 4.71934 0.174
NP_441950.1_7 Forward -329 -310 -8.06369 0.283
NP_441950.1_7 Forward -230 -211 -9.44032 0.297
NP_440360.1_10 Reverse -214 -228 3.63784 0.227
NP_442782.1_2 Reverse -344 -358 11.111 0.173
NP_442205.1_9 Forward -221 -205 -3.97304 0.3
NP_442937.1_5 Forward -220 -201 12.2908 0.113
NP_441958.1_5 Forward -104 -94 -1.29827 0.236
NP_440269.1_1 Forward -364 -346 15.7521 0.286
NP_442816.1_7 Forward -31 -12 4.05798 0.281
NP_439905.1_1 Reverse -95 -108 10.934 0.204
NP_439905.1_2 Forward -358 -344 9.14437 0.234
NP_439905.1_5 Reverse -160 -174 14.4542 0.288
NP_441097.1_2 Reverse -367 -384 10.7569 0.2
NP_442119.1_6 Forward -355 -336 6.58763 0.242
NP_442210.1_9 Reverse -189 -207 11.2289 0.23
NP_442002.1_9 Reverse -295 -302 12.4288 0.185
NP_442002.1_9 Forward -104 -97 12.4288 0.185
NP_440475.1_3 Reverse -118 -137 15.0441 0.232
NP_441294.1_7 Reverse -355 -369 12.8982 0.08
NP_441294.1_7 Reverse -217 -231 9.4426 0.244
NP_440147.1_4 Forward -105 -92 5.42749 0.125
NP_440147.1_4 Reverse -357 -370 4.34585 0.164
NP_440147.1_4 Reverse -204 -217 0.0192843 0.268
NP_441331.1_5 Forward -296 -277 13.8633 0.294
NP_441916.1_10 Reverse -306 -325 5.01433 0.219
NP_441916.1_10 Reverse -8 -27 3.04771 0.236
NP_440703.1_9 Forward -208 -195 8.47516 0.226
NP_441725.1_5 Forward -352 -342 -0.314959 0.246
NP_440260.1_8 Forward -362 -344 2.18243 0.182
NP_440260.1_8 Forward -224 -206 1.88744 0.182
NP_441678.1_9 Reverse -194 -213 -4.6221 0.296
NP_441079.1_7 Forward -178 -159 -1.96793 0.212
NP_441556.1_4 Reverse -224 -243 12.4153 0.219
NP_441556.1_10 Forward -328 -314 13.3366 0.182
NP_441644.1_6 Reverse -206 -216 3.12618 0.297
NP_442215.1_2 Reverse -360 -376 -1.61309 0.186
NP_442215.1_2 Forward -325 -309 -3.48138 0.216
NP_442215.1_2 Forward -217 -201 -4.56302 0.235
NP_442933.1_1 Forward -31 -12 9.50102 0.253
NP_440382.1_2 Forward -190 -171 1.76863 0.284
NP_441762.1_7 Reverse -264 -276 -6.64753 0.284
NP_442142.1_4 Forward -218 -205 2.87033 0.273
NP_442381.1_1 Forward -366 -347 16.9669 0.287
NP_441523.1_6 Forward -207 -188 8.16093 0.19
NP_443009.1_5 Reverse -295 -306 3.5981 0.286
NP_443009.1_5 Reverse -312 -323 3.40144 0.296
NP_441198.1_4 Forward -242 -223 8.65258 0.278
NP_440464.1_10 Forward -288 -278 13.4856 0.169
NP_441020.2_6 Forward -325 -308 7.41366 0.232
NP_441015.1_10 Forward -220 -201 2.85105 0.145
NP_441015.1_10 Forward -235 -216 -10.4236 0.284
NP_441673.1_1 Reverse -359 -368 -8.06341 0.254
NP_441826.1_2 Reverse -369 -383 -0.000409212 0.201
NP_441637.1_9 Forward -331 -313 -3.91409 0.296
NP_442868.1_6 Reverse -294 -304 2.63497 0.205
NP_442808.1_1 Reverse -311 -321 1.94622 0.281
NP_442050.1_2 Forward -290 -271 7.17681 0.264
NP_442342.1_9 Forward -217 -201 9.10498 0.171
NP_442792.1_4 Forward -223 -204 11.9958 0.288
NP_441878.1_6 Reverse -205 -215 1.06167 0.116
NP_441878.1_6 Reverse -343 -353 -7.29646 0.217
NP_441445.1_1 Forward -377 -358 3.6377 0.21
NP_441590.1_4 Forward -214 -195 5.60352 0.275
NP_441458.1_10 Forward -138 -119 2.85105 0.261
NP_442183.1_9 Forward -326 -316 9.41981 0.296
NP_440276.1_8 Forward -139 -120 8.45592 0.27
NP_441549.1_9 Forward -327 -309 -8.73231 0.237
NP_442347.1_2 Forward -288 -279 8.06287 0.116
NP_442965.1_2 Reverse -121 -140 -8.45701 0.286
NP_441633.1_3 Reverse -357 -370 2.87088 0.0834
NP_441633.1_3 Forward -257 -244 -6.66722 0.265
NP_442764.1_8 Forward -140 -121 1.47442 0.298
NP_442998.1_10 Reverse -96 -103 9.28223 0.117
NP_442333.2_5 Reverse -364 -383 -11.4069 0.246
NP_441559.1_8 Reverse -308 -322 3.8345 0.141
NP_441559.1_8 Forward -373 -359 -1.27871 0.182
NP_441559.1_8 Forward -327 -313 -6.58858 0.279
NP_440537.1_7 Reverse -165 -184 12.5568 0.202
NP_441464.1_8 Forward -103 -89 6.29277 0.241
NP_441464.1_10 Forward -332 -318 8.84938 0.267
NP_441340.1_9 Reverse -75 -85 7.19474 0.29
NP_442327.1_3 Forward -37 -18 9.21455 0.212
NP_441947.1_3 Reverse -356 -374 15.2604 0.257
NP_442484.1_2 Forward -140 -121 0.491109 0.247
NP_442791.1_5 Forward -238 -219 -6.1954 0.279
NP_440327.1_6 Forward -321 -302 4.52268 0.274
NP_440586.1_1 Forward -225 -206 -4.32711 0.278
NP_440027.1_3 Reverse -308 -326 3.16499 0.278
NP_440408.1_7 Reverse -230 -249 7.66927 0.284
NP_440439.1_1 Reverse -91 -104 1.49425 0.153
NP_442783.1_2 Forward -376 -357 31.072 0.0000195
NP_442783.1_6 Forward -346 -327 24.2872 0.034
NP_442783.1_7 Forward -242 -223 22.5172 0.0515
NP_442783.1_8 Forward -289 -270 13.6666 0.295
NP_442783.1_10 Forward -388 -378 16.8925 0.149
NP_440267.1_2 Reverse -46 -60 7.66879 0.194
NP_442384.1_10 Forward -147 -134 1.39592 0.26
NP_441018.1_3 Forward -241 -222 10.52 0.286
NP_441018.1_7 Forward -327 -308 15.9291 0.098
NP_442262.1_10 Reverse -95 -102 7.90559 0.266
NP_440282.1_7 Reverse -185 -203 21.4553 0.121
NP_440531.1_6 Reverse -112 -131 8.94757 0.0842
NP_440531.1_6 Forward -376 -357 -1.18052 0.229
NP_441060.1_3 Reverse -346 -365 17.994 0.184
NP_440297.1_9 Forward -352 -342 1.06167 0.282
NP_440350.1_5 Forward -32 -13 12.1925 0.134
NP_442280.1_10 Forward -139 -121 8.08424 0.268
NP_440999.1_9 Forward -348 -334 -2.36035 0.268
NP_440888.1_2 Forward -368 -354 8.65209 0.152
NP_440888.1_2 Forward -322 -308 8.16044 0.171
NP_440491.1_1 Reverse -332 -351 9.4509 0.214
NP_442710.1_7 Reverse -47 -66 -6.64608 0.294
NP_442710.1_7 Reverse -19 -38 -6.74219 0.294
NP_442315.1_2 Forward -327 -315 12.7237 0.291
NP_443064.1_6 Forward -360 -350 9.75513 0.199
NP_443064.1_6 Reverse -359 -369 8.49468 0.287
NP_442337.1_8 Forward -379 -360 8.16093 0.191
NP_441462.1_2 Forward -103 -93 -1.10161 0.281
NP_440349.1_10 Reverse -185 -204 18.6823 0.166
NP_440519.1_3 Forward -321 -302 23.7955 0.0301
NP_440519.1_6 Forward -250 -236 11.0127 0.29
NP_442204.1_1 Reverse -202 -213 -0.0396598 0.285
NP_440454.1_2 Reverse -18 -32 17.2002 0.148
NP_442872.1_1 Reverse -219 -238 -0.4922 0.184
NP_440516.1_6 Reverse -212 -226 8.75042 0.246
NP_440516.1_8 Reverse -375 -384 -0.590259 0.283
NP_440603.1_9 Forward -367 -348 6.39097 0.272
NP_440673.1_2 Reverse -334 -353 9.31652 0.248
NP_440673.1_3 Forward -243 -236 8.29892 0.221
NP_441052.1_2 Reverse -206 -216 4.20827 0.163
NP_442219.1_8 Forward -225 -206 20.1496 0.0434
NP_440314.1_9 Forward -352 -333 -8.85033 0.254
NP_441004.1_1 Forward -239 -220 -10.227 0.219
NP_441004.1_4 Forward -312 -302 14.9263 0.175
NP_442813.1_4 Forward -338 -319 -1.47551 0.239
NP_442813.1_4 Forward -386 -367 -3.93378 0.296
NP_442813.1_4 Forward -339 -320 -4.13045 0.296
NP_439949.1_10 Forward -170 -151 15.8011 0.218
NP_442873.1_9 Reverse -204 -223 3.53858 0.289
NP_440296.1_6 Forward -44 -26 10.1241 0.298
NP_441729.1_1 Reverse -345 -364 13.0775 0.297
NP_443054.1_2 Reverse -311 -325 0.982901 0.251
NP_441668.1_4 Reverse -334 -353 -1.18052 0.27
NP_441396.1_5 Forward -229 -220 8.65285 0.21
NP_440463.1_8 Forward -375 -356 8.08077 0.264
NP_441349.1_10 Reverse -196 -215 -9.34199 0.289
NP_441409.1_8 Reverse -10 -29 9.23384 0.237
NP_442843.1_1 Reverse -121 -140 -7.17871 0.245
NP_440588.1_2 Reverse -197 -216 -4.72043 0.226
NP_442006.1_2 Reverse -368 -385 -16.4808 0.254
NP_441003.1_9 Reverse -197 -216 9.63589 0.213
NP_441003.1_9 Forward -301 -282 3.34271 0.294
NP_440078.1_10 Forward -298 -279 2.45773 0.269
NP_441078.1_4 Reverse -206 -215 -1.6719 0.266
NP_440707.1_9 Forward -229 -210 3.14605 0.268
NP_441432.1_9 Forward -29 -16 8.40445 0.289
NP_441732.1_2 Reverse -202 -218 -6.7263 0.0495
NP_441732.1_2 Reverse -371 -387 -16.8544 0.207
NP_441732.1_2 Reverse -310 -326 -17.5427 0.27
NP_442797.1_7 Reverse -220 -238 -0.669169 0.284
NP_441945.1_10 Forward -142 -123 9.73422 0.258
NP_442489.1_7 Reverse -206 -215 -1.37691 0.195
NP_442489.1_7 Forward -368 -359 -1.77023 0.247
NP_442489.1_7 Reverse -94 -103 -1.77023 0.247
NP_441659.2_8 Forward -298 -288 -0.0199663 0.282
NP_441659.2_8 Forward -215 -205 -0.314959 0.298
NP_441800.1_3 Reverse -201 -219 9.65558 0.286
NP_441800.1_7 Reverse -354 -372 -2.73412 0.265
NP_440335.1_9 Reverse -15 -33 9.65558 0.292
NP_442346.1_5 Reverse -119 -129 8.73149 0.128
NP_442346.1_5 Forward -130 -120 7.64985 0.162
NP_440545.1_3 Forward -219 -202 -6.15601 0.27
NP_440545.1_5 Forward -234 -217 4.95539 0.244
NP_440486.1_9 Forward -357 -343 14.7492 0.215
NP_441943.1_8 Reverse -304 -323 -12.7836 0.261
NP_442027.1_5 Forward -336 -317 14.7491 0.12
NP_441948.1_4 Forward -329 -311 -3.81576 0.207
NP_441047.1_2 Reverse -345 -364 -1.7705 0.27
NP_441779.1_5 Reverse -276 -295 17.7965 0.226
NP_440671.1_4 Reverse -369 -383 14.0609 0.0698
NP_442943.1_1 Forward -65 -50 4.34977 0.235
NP_441671.1_1 Forward -364 -345 7.57094 0.226
NP_441239.1_9 Forward -355 -343 4.95553 0.234
NP_441239.1_9 Reverse -92 -104 3.97222 0.269
NP_441892.1_1 Reverse -366 -383 -5.76269 0.288
NP_442193.1_1 Reverse -181 -199 10.5406 0.228
NP_441508.1_4 Forward -196 -182 13.5715 0.297
NP_440212.1_9 Forward -44 -25 5.65501 0.169
NP_441526.1_6 Forward -226 -207 6.09597 0.265
NP_442052.1_6 Reverse -243 -261 19.5862 0.0923
NP_440551.1_5 Reverse -363 -382 10.8159 0.194
NP_442041.1_2 Reverse -193 -211 7.98396 0.293
NP_440675.1_3 Forward -245 -226 4.916 0.297
NP_440675.1_10 Reverse -191 -210 13.1758 0.228
NP_442899.1_4 Reverse -47 -63 13.8241 0.232
NP_440401.1_9 Reverse -317 -324 12.6251 0.287
NP_442499.1_1 Forward -352 -333 5.30933 0.225
NP_440374.1_6 Forward -63 -44 11.3075 0.174
NP_442479.1_9 Reverse -94 -113 -1.18052 0.21
NP_440638.2_3 Reverse -227 -246 7.37428 0.258
NP_440812.1_10 Forward -228 -215 12.114 0.259
NP_442402.1_4 Reverse -305 -324 2.85027 0.154
NP_442402.1_9 Forward -372 -353 8.45592 0.291
NP_439942.1_2 Reverse -45 -64 13.7641 0.236
NP_440696.1_3 Forward -368 -350 -4.01242 0.294
NP_442039.1_4 Reverse -376 -383 7.02061 0.269
NP_442696.1_6 Reverse -355 -374 -11.4069 0.235
NP_440160.1_2 Reverse -295 -314 -8.65367 0.286
NP_440160.1_9 Reverse -343 -362 11.3075 0.217
NP_439994.1_1 Forward -374 -355 11.7992 0.142
NP_442360.1_5 Forward -110 -100 12.8614 0.298
NP_441252.1_6 Forward -106 -99 11.9372 0.25
NP_441408.2_7 Reverse -336 -355 -1.57384 0.253
NP_441408.2_7 Forward -217 -198 -3.73712 0.277
NP_441408.2_7 Reverse -118 -137 -5.11376 0.291
NP_442174.1_9 Forward -143 -124 6.39097 0.288
NP_440914.1_1 Reverse -359 -369 10.6645 0.129
NP_440914.1_1 Forward -103 -93 7.73678 0.224
NP_442533.1_1 Forward -227 -208 -13.7669 0.238
NP_442533.1_1 Forward -233 -214 -14.6519 0.247
NP_442533.1_1 Forward -230 -211 -14.8485 0.247
NP_442533.1_1 Forward -326 -307 -17.7985 0.295
NP_442533.1_6 Forward -215 -206 5.01461 0.16
NP_442533.1_6 Reverse -206 -215 4.32629 0.184
NP_442533.1_6 Reverse -344 -353 2.85133 0.236
NP_442533.1_6 Reverse -120 -129 2.16301 0.27
NP_442322.1_4 Forward -360 -343 -6.84499 0.277
NP_441482.1_7 Reverse -369 -383 -9.73518 0.209
NP_441482.1_7 Reverse -200 -214 -11.0135 0.229
NP_441028.1_6 Forward -300 -290 4.10949 0.278
NP_441527.1_4 Reverse -16 -35 -2.81744 0.161
NP_441527.1_4 Reverse -17 -36 -3.58137 0.17
NP_441527.1_4 Reverse -12 -31 -7.21006 0.231
NP_441527.1_4 Reverse -15 -34 -8.73794 0.25
NP_440115.1_6 Reverse -293 -303 11.6814 0.115
NP_440007.1_9 Reverse -371 -385 0.687908 0.292
NP_439965.1_5 Forward -329 -310 8.65176 0.299
NP_441680.1_4 Reverse -281 -300 1.96607 0.246
NP_439903.1_6 Forward -218 -199 1.37531 0.248
NP_442674.1_3 Reverse -367 -386 4.22689 0.294
NP_440670.1_8 Forward -103 -94 5.11294 0.171
NP_441705.1_3 Forward -119 -100 4.71934 0.21
NP_441930.1_3 Reverse -47 -66 5.65597 0.263
NP_440886.1_7 Reverse -220 -230 5.97777 0.151
NP_440886.1_7 Reverse -358 -368 5.68278 0.168
NP_440886.1_7 Reverse -208 -218 3.8145 0.265
NP_441001.1_10 Forward -231 -212 4.12936 0.295
NP_442072.1_9 Forward -104 -86 -14.7305 0.156
NP_442072.1_9 Forward -149 -131 -22.2037 0.225
NP_442401.1_2 Reverse -220 -239 10.52 0.178
NP_439967.1_3 Reverse -322 -340 14.1693 0.284
NP_441021.1_1 Forward -220 -201 -11.3086 0.259
NP_442842.1_4 Forward -322 -303 18.7807 0.0458
NP_442842.1_10 Forward -269 -250 -0.311184 0.283
NP_440107.1_5 Reverse -279 -298 -7.57203 0.3
NP_441962.1_4 Forward -134 -115 -13.7669 0.277
NP_441796.1_8 Forward -336 -318 8.18062 0.297
NP_441742.1_7 Reverse -202 -221 15.5357 0.245
NP_440387.1_1 Forward -103 -87 -4.95634 0.208
NP_441836.1_2 Reverse -332 -351 -5.50708 0.283
NP_441993.1_1 Forward -221 -202 9.64582 0.135
NP_441993.1_1 Forward -303 -284 1.36194 0.28
NP_440114.1_10 Reverse -132 -146 6.6861 0.26
NP_442090.1_2 Reverse -63 -82 7.97315 0.281
NP_440766.1_4 Reverse -371 -385 0.982901 0.259
NP_441311.1_2 Forward -90 -76 13.9619 0.229
NP_440457.1_1 Reverse -371 -383 1.21895 0.244
NP_440457.1_1 Reverse -292 -304 0.727295 0.25
NP_441801.1_4 Reverse -304 -314 2.63497 0.29
NP_440801.1_8 Reverse -205 -224 7.27595 0.157
NP_441332.1_6 Reverse -220 -230 13.583 0.184
NP_442509.1_9 Reverse -313 -323 11.6809 0.119
NP_442514.1_5 Reverse -213 -232 -3.04956 0.222
NP_442703.1_9 Reverse -11 -29 4.24738 0.26
NP_442341.1_7 Forward -385 -371 1.57289 0.286
NP_442341.1_7 Reverse -381 -395 1.27789 0.295
NP_442341.1_9 Reverse -219 -233 5.01387 0.284
NP_442275.1_1 Reverse -349 -368 0.58944 0.285
NP_440175.1_7 Reverse -189 -207 8.87516 0.285
NP_442495.1_4 Forward -211 -201 11.8781 0.258
NP_440149.1_8 Forward -384 -365 -7.4737 0.285
NP_441105.1_3 Forward -140 -121 -6.68705 0.239
NP_440216.1_1 Forward -305 -291 -11.4068 0.184
NP_440216.1_9 Reverse -309 -318 11.6028 0.254
NP_440172.1_1 Forward -103 -93 2.7333 0.268
NP_440167.1_3 Forward -225 -206 9.83255 0.247
NP_441045.1_6 Reverse -226 -244 15.2596 0.284
NP_441766.1_2 Forward -384 -375 1.1797 0.299
NP_443052.1_8 Reverse -349 -368 -12.0953 0.248
NP_443052.1_9 Reverse -214 -233 -3.63879 0.251
NP_442403.1_8 Forward -327 -308 6.4893 0.187
NP_442403.1_8 Reverse -177 -196 -2.65548 0.278
NP_442154.1_1 Reverse -182 -200 -11.6822 0.215
NP_442046.1_9 Reverse -18 -32 17.0108 0.26
NP_440261.1_5 Reverse -95 -108 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTAATTAGCGCTGAGTCCCAATCTCCCTGGGTGGTGTTTGCCGGCTCAGCCCTAGCCCTAATTTCCACTAGTCTGTTGGGGGTTTCCCTGGGGTATTGGATTGCCCGCCGTCTTGATCCGCAAATCCTCGATTTCTCTGTGGCTCTGTTATTGCTCCTCATTGCTGGGTTGCTGATGGGGGACGTGGTCAGCGCCTAGGCTCAGCACCACAAACATTCCGATATTGAATTTCATTATTCTTGCCTAAAAACGTGGTAAAGCCCCTAGCTTTAGTCATGGCTAGTATAGGAACCTTGGGGCAATCTGCTCCCCTCTAAGTTTTTGTTAGACTACAGAAATTGTTGATTGATTTGTTGAGTTAGACAAGTCTTTTTTTACTGTTTTTACTTCGCTAAATTCT

CDS

ATGACTGCCCAAGCCAACAACACAATCTACGGTTTTTCTGCCAATGCCTTGGATGGTTCCCCCGTAGCTCTGAGGGACTTTGAAGGTAAAGTGCTGTTAATTGTCAACACCGCCAGTCAATGTGGCTTCACTCCCCAATACCAAGGACTCCAGGCTCTATACAATCGATTCGGCGATCGGGGTTTTACGGTGCTTGGTTTTCCCTGTAATCAGTTTGGCCAGCAGGAACCCGGTGGCTCAGGGGAAATTAAAAACTTTTGCGAAACCCGTTATGGAGTAACTTTTCCCTTATTTGAAAAAGTGGAAGTCAATGGTCCCAACGCCCATCCCCTATTTAAGTTTTTAACCGCAGCTAGCCCTGGTATGGCCATTCCTTTTTTGGGTGGTGCGGAGGACATTAAATGGAATTTCACTAAGTTTTTGGTCGATCGCCAAGGTAAAGTGGTCAAACGCTACGGTTCCATCGCCAAACCCGATGAAATTGCGGCGGACATCGAGAAATTGTTGTAA

Protein

MTAQANNTIYGFSANALDGSPVALRDFEGKVLLIVNTASQCGFTPQYQGLQALYNRFGDRGFTVLGFPCNQFGQQEPGGSGEIKNFCETRYGVTFPLFEKVEVNGPNAHPLFKFLTAASPGMAIPFLGGAEDIKWNFTKFLVDRQGKVVKRYGSIAKPDEIAADIEKLL