Your browser is old and dusty. Try Google Chrome!

Details for slr1168

ORF slr1168
Accession NP_441661.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -111 -118 9.77388 0.169
NP_441418.1_6 Forward -104 -85 -13.4719 0.0767
NP_443032.1_8 Forward -393 -374 1.86774 0.238
NP_440897.1_9 Forward -230 -212 12.4081 0.223
NP_441453.1_7 Forward -193 -186 11.9372 0.298
NP_441818.1_6 Reverse -271 -285 11.701 0.253
NP_442655.1_2 Reverse -27 -46 0.58944 0.291
NP_441745.1_3 Reverse -352 -371 13.2733 0.288
NP_441812.1_3 Reverse -94 -108 13.4709 0.167
NP_442975.1_10 Reverse -85 -99 5.40719 0.224
NP_441250.1_3 Forward -57 -38 2.0644 0.28
NP_440110.1_8 Forward -88 -69 -3.04881 0.284
NP_441054.1_2 Reverse -364 -383 15.1424 0.148
NP_441054.1_2 Reverse -355 -374 12.5858 0.229
NP_440878.1_9 Forward -288 -269 -1.67217 0.249
NP_440761.1_4 Forward -386 -367 -20.8467 0.3
NP_440304.1_4 Forward -66 -56 4.89658 0.244
NP_440304.1_4 Reverse -370 -380 4.10993 0.272
NP_441581.1_4 Forward -115 -96 5.40766 0.272
NP_441200.1_4 Forward -353 -334 7.27595 0.272
NP_441935.1_1 Reverse -356 -375 6.4893 0.273
NP_441594.1_6 Forward -98 -79 1.27776 0.269
NP_441594.1_6 Forward -301 -282 -0.39387 0.299
NP_441925.1_4 Forward -374 -355 -13.4726 0.257
NP_441925.1_4 Forward -371 -352 -14.1609 0.261
NP_441925.1_4 Forward -380 -361 -16.8158 0.285
NP_441925.1_4 Forward -372 -353 -17.5041 0.296
NP_442804.1_1 Forward -229 -210 20.059 0.0863
NP_440856.1_7 Forward -92 -73 -3.54046 0.199
NP_441083.1_5 Forward -271 -261 -0.216628 0.261
NP_441558.1_5 Forward -97 -78 3.73603 0.299
NP_442675.1_4 Forward -106 -88 -5.88071 0.277
NP_441792.1_5 Forward -230 -214 15.6932 0.153
NP_441716.1_6 Reverse -271 -290 15.3391 0.293
NP_440747.1_10 Forward -274 -262 -12.2524 0.254
NP_440842.1_10 Reverse -363 -377 3.93283 0.254
NP_441014.1_8 Forward -372 -353 -8.45701 0.283
NP_441014.1_8 Forward -381 -362 -9.83364 0.299
NP_442848.1_4 Reverse -65 -79 10.4227 0.282
NP_442848.1_9 Reverse -263 -282 2.26107 0.252
NP_441012.1_4 Reverse -88 -101 15.5556 0.166
NP_440376.1_1 Reverse -262 -271 10.2261 0.0314
NP_441588.1_4 Reverse -292 -302 5.09324 0.297
NP_442687.1_7 Reverse -125 -135 5.38824 0.206
NP_441950.1_8 Forward -99 -85 5.99778 0.267
NP_440360.1_10 Reverse -88 -102 5.01447 0.227
NP_440141.1_8 Forward -113 -94 5.80098 0.271
NP_441971.1_5 Reverse -355 -374 22.2223 0.0254
NP_439968.1_2 Forward -380 -361 15.2399 0.252
NP_441256.1_1 Reverse -346 -365 -7.96535 0.239
NP_442937.1_5 Forward -304 -285 6.68596 0.272
NP_441127.1_1 Reverse -372 -386 8.25939 0.3
NP_441127.1_5 Forward -396 -377 13.5709 0.274
NP_442836.1_5 Forward -277 -258 14.3558 0.0588
NP_440984.1_7 Forward -276 -262 6.29277 0.219
NP_443055.1_6 Forward -381 -363 6.31156 0.172
NP_443055.1_6 Forward -382 -364 -1.84987 0.284
NP_440993.1_2 Forward -292 -276 3.20513 0.262
NP_440138.1_1 Reverse -86 -104 10.4414 0.197
NP_441129.1_3 Forward -363 -344 -17.4051 0.281
NP_440850.1_2 Forward -356 -337 8.94757 0.266
NP_440850.1_4 Forward -323 -304 21.7306 0.051
NP_440850.1_6 Forward -295 -276 8.16093 0.248
NP_440850.1_9 Forward -271 -252 17.5015 0.194
NP_442002.1_9 Reverse -371 -378 11.3472 0.185
NP_442002.1_9 Reverse -43 -50 11.1505 0.185
NP_441294.1_2 Reverse -262 -281 4.71934 0.274
NP_442431.1_10 Reverse -352 -370 5.62401 0.197
NP_441916.1_10 Forward -72 -53 16.6174 0.0888
NP_440465.1_10 Reverse -83 -102 13.2741 0.173
NP_441041.1_4 Forward -337 -318 -6.58872 0.169
NP_440703.1_9 Forward -373 -360 12.0151 0.192
NP_442281.1_1 Forward -276 -262 2.06395 0.278
NP_441860.1_1 Forward -226 -212 14.095 0.288
NP_442068.1_4 Reverse -87 -106 6.58682 0.232
NP_441644.1_6 Forward -271 -261 12.6642 0.0302
NP_441644.1_6 Forward -337 -327 5.19112 0.204
NP_441795.1_5 Reverse -210 -229 8.25926 0.245
NP_442215.1_2 Reverse -260 -276 -7.41462 0.294
NP_442029.1_1 Reverse -353 -372 -11.3086 0.229
NP_442554.1_8 Reverse -87 -97 4.10993 0.198
NP_442554.1_8 Reverse -263 -273 3.22496 0.235
NP_441762.1_7 Forward -105 -93 -5.76255 0.238
NP_441762.1_7 Reverse -268 -280 -5.86088 0.246
NP_442142.1_4 Reverse -92 -105 2.96866 0.269
NP_442142.1_4 Reverse -52 -65 2.772 0.278
NP_441525.1_1 Forward -368 -355 11.524 0.291
NP_441715.1_4 Reverse -56 -66 9.7148 0.097
NP_441448.1_1 Reverse -75 -94 15.3391 0.16
NP_440158.1_3 Reverse -350 -369 5.30933 0.239
NP_442076.1_8 Reverse -84 -103 12.6841 0.203
NP_440183.1_9 Reverse -88 -107 -2.85214 0.175
NP_441015.1_10 Reverse -350 -369 -0.0988766 0.168
NP_441015.1_10 Reverse -347 -366 -6.09707 0.241
NP_441426.1_8 Forward -48 -30 9.55725 0.246
NP_442719.1_2 Forward -389 -371 3.45998 0.158
NP_442719.1_2 Forward -388 -370 -10.4046 0.273
NP_442719.1_2 Forward -236 -218 -10.8963 0.284
NP_442719.1_2 Forward -208 -190 -11.1913 0.29
NP_442227.1_2 Forward -365 -346 1.27776 0.249
NP_442227.1_4 Forward -231 -212 10.9134 0.285
NP_442808.1_1 Forward -365 -355 3.22451 0.247
NP_442820.1_3 Reverse -358 -368 12.2709 0.293
NP_442050.1_1 Reverse -112 -131 7.17762 0.275
NP_440558.1_2 Forward -368 -349 -3.24547 0.234
NP_440558.1_2 Reverse -83 -102 -7.4737 0.294
NP_442789.1_4 Forward -294 -275 -7.27704 0.292
NP_441878.1_6 Reverse -364 -374 -7.88644 0.278
NP_441878.1_6 Reverse -261 -271 -7.88644 0.278
NP_441445.1_1 Reverse -253 -272 1.86774 0.247
NP_441590.1_4 Forward -372 -353 2.26028 0.296
NP_442066.2_4 Forward -278 -259 -8.94866 0.296
NP_442135.1_3 Forward -286 -267 16.0274 0.0983
NP_442632.1_1 Forward -120 -101 11.3067 0.254
NP_442347.1_2 Forward -118 -109 4.81794 0.257
NP_442645.1_2 Forward -307 -288 -15.6352 0.206
NP_440151.1_2 Reverse -365 -383 16.8329 0.222
NP_442998.1_5 Forward -349 -339 10.7964 0.204
NP_441007.1_10 Reverse -350 -363 -0.472371 0.285
NP_442334.1_2 Reverse -362 -379 -3.99273 0.2
NP_442283.1_6 Reverse -356 -375 16.3224 0.189
NP_441559.1_8 Forward -282 -268 3.44117 0.143
NP_441559.1_8 Forward -204 -190 -7.08024 0.283
NP_440915.1_6 Reverse -368 -382 3.53951 0.101
NP_441179.1_9 Forward -366 -356 16.3025 0.236
NP_440134.1_2 Reverse -34 -53 -0.197208 0.298
NP_440026.1_7 Forward -364 -349 14.5329 0.251
NP_440787.1_5 Forward -345 -331 10.521 0.256
NP_441494.1_6 Reverse -81 -94 5.52582 0.3
NP_442993.1_1 Forward -95 -79 -13.0195 0.283
NP_442993.1_1 Reverse -262 -278 -13.2161 0.288
NP_441340.1_5 Reverse -329 -336 8.8889 0.084
NP_441271.1_8 Forward -81 -71 13.7464 0.272
NP_442791.1_5 Forward -112 -93 -7.4737 0.279
NP_440586.1_1 Forward -105 -86 -4.03212 0.277
NP_440586.1_8 Reverse -96 -103 10.7568 0.128
NP_440586.1_8 Forward -94 -87 5.8403 0.283
NP_442251.1_4 Forward -45 -26 23.5006 0.043
NP_440027.1_3 Forward -374 -356 3.26332 0.275
NP_440027.1_3 Forward -373 -355 2.37835 0.29
NP_439937.1_8 Forward -106 -87 -1.67217 0.249
NP_440408.1_7 Reverse -262 -281 12.0942 0.212
NP_441789.1_7 Forward -286 -267 5.70185 0.193
NP_440819.1_5 Forward -350 -342 7.98423 0.228
NP_440819.1_5 Forward -349 -341 7.68924 0.266
NP_440316.1_10 Reverse -371 -381 7.25653 0.251
NP_440316.1_10 Reverse -268 -278 6.37155 0.263
NP_441572.1_1 Reverse -53 -72 -0.39387 0.212
NP_440267.1_2 Forward -364 -350 14.1586 0.114
NP_440267.1_2 Forward -69 -55 5.60385 0.261
NP_442790.1_4 Reverse -363 -382 -14.3569 0.274
NP_442244.1_3 Reverse -286 -305 2.65439 0.299
NP_440163.1_9 Reverse -339 -358 11.1109 0.285
NP_440163.1_10 Reverse -89 -99 8.04317 0.292
NP_440282.1_10 Reverse -76 -95 -6.29373 0.25
NP_440531.1_6 Forward -279 -260 13.6675 0.0414
NP_440894.1_10 Forward -282 -263 7.47261 0.204
NP_440894.1_10 Forward -366 -347 3.53937 0.271
YP_680420.1_10 Forward -224 -205 14.4541 0.274
NP_442067.1_4 Forward -289 -270 3.34271 0.289
NP_440999.1_1 Forward -375 -356 9.34008 0.142
NP_440999.1_9 Forward -296 -282 1.57289 0.162
NP_440999.1_9 Forward -282 -268 -1.27871 0.232
NP_441543.1_2 Reverse -96 -105 11.3078 0.0567
NP_442845.1_2 Reverse -80 -94 7.37441 0.195
NP_441551.1_5 Forward -99 -83 6.54769 0.264
NP_441621.1_7 Reverse -267 -281 -4.81863 0.246
NP_443062.1_1 Forward -337 -319 3.37804 0.3
NP_440519.1_8 Reverse -99 -115 0.943514 0.296
NP_441351.1_8 Reverse -93 -112 1.0811 0.276
NP_440516.1_6 Reverse -86 -100 12.5853 0.196
NP_440516.1_6 Forward -364 -350 8.75042 0.246
NP_440516.1_8 Reverse -372 -381 -0.590259 0.283
NP_441443.1_7 Reverse -352 -371 0.687771 0.245
NP_441867.1_2 Reverse -363 -382 -12.2919 0.253
NP_440673.1_3 Forward -269 -262 8.8889 0.206
NP_441670.1_2 Reverse -62 -81 12.3892 0.286
NP_441052.1_2 Reverse -95 -105 1.65166 0.233
NP_442219.1_8 Reverse -91 -110 6.81424 0.287
NP_441884.1_9 Forward -107 -88 -14.9469 0.138
NP_442412.1_5 Forward -221 -202 3.53937 0.294
NP_441004.1_1 Reverse -366 -385 -14.3569 0.267
NP_441004.1_2 Reverse -361 -380 -1.18052 0.259
NP_441004.1_4 Reverse -369 -379 9.91146 0.259
NP_442366.1_3 Reverse -254 -272 -5.48739 0.288
NP_440296.1_10 Reverse -352 -371 -15.4385 0.298
NP_442694.1_4 Forward -331 -322 12.0944 0.268
NP_443054.1_2 Reverse -267 -281 -0.0987402 0.284
NP_440864.1_9 Reverse -62 -81 -7.08038 0.283
NP_442011.1_1 Reverse -261 -280 -2.85214 0.283
NP_441396.1_5 Forward -103 -94 8.35786 0.224
NP_440463.1_7 Reverse -378 -392 14.6509 0.296
NP_441046.1_2 Reverse -44 -63 0.687771 0.263
NP_441046.1_2 Forward -109 -90 -0.197208 0.276
NP_441349.1_10 Forward -74 -55 -5.99873 0.217
NP_441661.1_1 Forward -186 -167 27.8271 0.00265
NP_441661.1_2 Forward -47 -28 27.9255 0.00275
NP_441661.1_3 Forward -207 -190 28.3582 0.000976
NP_441394.1_7 Forward -105 -91 19.9608 0.119
NP_442314.1_1 Reverse -344 -362 -5.88071 0.29
NP_442843.1_1 Reverse -263 -282 -5.21209 0.243
NP_439960.1_10 Forward -281 -263 -4.11075 0.292
NP_440726.1_2 Forward -371 -352 2.45773 0.253
NP_442168.1_4 Forward -351 -337 18.5841 0.252
NP_439950.1_1 Forward -188 -179 14.4544 0.224
NP_442006.1_2 Reverse -364 -381 -17.1691 0.27
NP_440483.1_1 Forward -395 -376 -8.94866 0.297
NP_441570.1_1 Forward -337 -319 -13.7472 0.224
NP_441078.1_4 Reverse -262 -271 -1.86856 0.272
NP_442388.1_3 Reverse -352 -371 10.2259 0.216
NP_440707.1_9 Reverse -347 -366 10.4225 0.198
NP_443024.1_3 Forward -188 -178 10.0098 0.296
NP_440760.1_1 Reverse -133 -152 -23.01 0.278
NP_442489.1_7 Reverse -262 -271 -1.37691 0.195
NP_442489.1_7 Reverse -55 -64 -1.57357 0.213
NP_441830.1_2 Reverse -356 -375 -3.04881 0.275
NP_441659.2_8 Forward -271 -261 3.51995 0.157
NP_442913.1_10 Forward -110 -91 -6.1954 0.296
NP_440708.1_6 Forward -132 -113 -4.91709 0.232
NP_442346.1_5 Forward -96 -86 5.19158 0.256
NP_440545.1_3 Reverse -82 -99 -6.35267 0.276
NP_441856.1_8 Reverse -199 -218 10.1275 0.291
NP_440459.1_2 Forward -383 -366 11.4452 0.175
NP_440459.1_2 Reverse -260 -277 7.512 0.288
NP_441050.1_5 Forward -99 -81 5.03403 0.194
NP_441895.1_10 Reverse -145 -164 -9.047 0.281
NP_441973.1_1 Reverse -343 -358 -7.78825 0.293
NP_442199.1_7 Forward -314 -295 2.55527 0.259
NP_441609.1_1 Reverse -37 -56 0.294447 0.215
NP_440875.1_9 Reverse -88 -98 11.3895 0.17
NP_440875.1_9 Forward -362 -352 6.81464 0.297
NP_440590.1_9 Reverse -365 -383 6.60732 0.262
NP_441239.1_9 Reverse -84 -96 6.72548 0.178
NP_441239.1_9 Forward -289 -277 6.43049 0.189
NP_441239.1_9 Forward -383 -371 5.93884 0.202
NP_442082.1_1 Reverse -69 -88 8.55425 0.267
NP_441017.1_8 Forward -203 -188 7.25639 0.277
NP_442138.1_10 Reverse -349 -368 -7.17871 0.286
NP_440546.1_4 Forward -95 -85 10.9186 0.101
NP_442402.1_4 Forward -60 -41 1.17865 0.173
NP_442402.1_4 Reverse -332 -351 -4.03287 0.22
NP_441084.1_6 Reverse -84 -98 13.5133 0.128
NP_440696.1_3 Reverse -355 -373 -1.75081 0.265
NP_441926.1_3 Forward -278 -262 3.00846 0.247
NP_442786.1_5 Forward -92 -73 5.60432 0.294
NP_441252.1_6 Reverse -41 -48 14.3954 0.168
NP_441252.1_6 Reverse -369 -376 11.9372 0.25
NP_442532.1_7 Forward -104 -90 10.1277 0.171
NP_440009.1_4 Reverse -52 -71 6.78429 0.299
NP_442533.1_1 Reverse -355 -374 -7.67036 0.197
NP_442533.1_6 Forward -271 -262 11.8978 0.0362
NP_442533.1_6 Forward -95 -86 4.62128 0.179
NP_442533.1_6 Reverse -55 -64 2.75299 0.241
NP_442322.1_4 Forward -367 -350 -7.23831 0.279
NP_441028.1_6 Reverse -341 -351 14.6309 0.158
NP_442202.1_6 Reverse -37 -56 1.86774 0.265
NP_442664.1_10 Reverse -36 -55 8.16093 0.263
NP_440115.1_2 Reverse -362 -381 17.3057 0.264
NP_441602.1_3 Forward -100 -81 -4.6221 0.269
NP_440886.1_7 Reverse -94 -104 7.25606 0.0993
NP_440886.1_7 Forward -279 -269 6.37109 0.13
NP_442614.1_2 Reverse -262 -276 10.3243 0.234
NP_442401.1_3 Reverse -355 -374 14.2574 0.241
NP_441962.1_4 Reverse -81 -100 -6.78538 0.181
NP_441836.1_2 Reverse -80 -99 4.81767 0.132
NP_440634.1_1 Forward -280 -261 16.2241 0.223
NP_441993.1_1 Reverse -269 -288 3.21363 0.239
NP_442352.1_1 Forward -101 -88 15.6565 0.215
NP_440114.1_10 Forward -337 -323 10.0294 0.155
NP_442437.1_8 Forward -103 -84 2.94938 0.296
NP_442323.1_7 Reverse -291 -310 2.85027 0.258
NP_440287.1_6 Reverse -326 -345 3.24438 0.226
NP_441720.1_2 Reverse -324 -343 7.57013 0.213
NP_441133.1_1 Reverse -358 -377 13.4708 0.243
NP_440801.1_8 Forward -296 -277 2.94938 0.229
NP_441984.1_6 Forward -379 -367 14.1986 0.258
NP_442514.1_5 Forward -381 -362 -7.76943 0.28
NP_441885.1_5 Reverse -262 -272 -0.609952 0.215
NP_442341.1_9 Forward -273 -259 5.01387 0.284
NP_441756.1_5 Reverse -346 -365 2.65439 0.206
NP_441173.1_9 Forward -233 -225 13.1954 0.184
NP_441173.1_9 Forward -155 -147 13.1954 0.184
NP_441173.1_9 Reverse -342 -350 9.75379 0.284
NP_442354.1_2 Forward -103 -84 1.57275 0.299
NP_442275.1_1 Reverse -355 -374 1.17943 0.284
NP_441902.1_1 Forward -370 -351 11.2084 0.282
NP_441902.1_3 Forward -75 -65 13.9535 0.226
NP_440679.1_10 Forward -111 -92 -12.2919 0.192
NP_439962.1_4 Reverse -364 -383 -6.78538 0.285
NP_440149.1_10 Forward -381 -362 -12.2919 0.285
NP_442214.1_1 Forward -221 -202 16.7157 0.164
NP_441105.1_3 Reverse -374 -393 -4.52377 0.201
NP_440216.1_1 Forward -278 -264 -11.8001 0.219
NP_440172.1_1 Reverse -372 -382 2.53664 0.277
NP_440172.1_1 Reverse -55 -65 2.24165 0.279
NP_442371.1_1 Forward -190 -180 15.1225 0.176
NP_441226.1_7 Forward -270 -263 8.59356 0.197
NP_440416.1_9 Forward -282 -263 -15.1435 0.186
NP_440416.1_9 Forward -366 -347 -19.1751 0.27
NP_443052.1_8 Reverse -318 -337 -8.65367 0.177
NP_443052.1_9 Forward -282 -263 -4.42544 0.258
NP_442154.1_1 Reverse -356 -374 0.510803 0.102
NP_442154.1_1 Reverse -347 -365 -6.76569 0.141
NP_441430.1_2 Forward -385 -366 -3.44213 0.262
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCAGTCCACAATGGTTTGACCCAATTGCCCCAGGCCCACCATGCCCTCCACGGGGAAAAAGTCGCCTATGGCATTTTGGTGCAGTTACGCTTAGAAGAATTGGTCAGCGGTAATCAACTCGCCGCTACTGCCCGTCGCCAATTACTGAGCTTTTACGATGAGATAGGTTTACCCAAAACCCTGCAAGATCTGGGTCTGGGACGAATTTCCCTGGAGGAATTACGACAGACGGCGGAATTTACCTGTTTACCCAATTCGGACATTCACCGCTTACCCTTTACTGTGACCCCAGAAACGTTGATGGCGGCCATGGTTTCCACCCTAGTGGAGGAACAAGGTACTCGCCAATTATTTGCCCAAATTCAAGATAATTCCGGTCTTTAAATGTGAATGATCAAAA

CDS

ATGTTAACCGTTACTAATTATCCCCATATTCGTAAAATAGACGACCAGCCAGCCCATCTGGAAAGATTGCCTCGCATTCAAGTTGCCCATATTGTGATGGACTATCTTTCCCATGGTTGGTCTGTGGATGAAATGTGCCGCCAACATCCCTATCTAAAGCCTTCGGAAGCATATTCTGCTATGGGCTATTATTTCGATCATCAAGAAGAAGTTGATCAACAGATTCAAGAACAGTGGCAGTCAATCCAGGAAGCAGATTCTCAACCAAAATCACCTTTTTACTCCCGTCTGAGAAGCAGAGGTATTTTATAA

Protein

MLTVTNYPHIRKIDDQPAHLERLPRIQVAHIVMDYLSHGWSVDEMCRQHPYLKPSEAYSAMGYYFDHQEEVDQQIQEQWQSIQEADSQPKSPFYSRLRSRGIL