Your browser is old and dusty. Try Google Chrome!

Details for slr1167

ORF slr1167
Accession NP_441660.1
Symbol gldA
Category glycerol dehydrogenase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -299 -285 12.0943 0.222
NP_441061.1_2 Forward -298 -284 7.86607 0.0956
NP_440795.1_7 Forward -298 -291 14.6904 0.0123
NP_440795.1_7 Reverse -291 -298 14.6904 0.0123
NP_441418.1_6 Forward -299 -280 -10.3253 0.0339
NP_441418.1_6 Reverse -278 -297 -29.5982 0.23
NP_442291.1_5 Reverse -289 -305 1.63183 0.142
NP_441453.1_4 Reverse -290 -298 16.539 0.00633
NP_441453.1_4 Forward -299 -291 16.539 0.00633
NP_441453.1_4 Forward -338 -330 5.13263 0.179
NP_442151.1_6 Forward -299 -285 12.4876 0.0722
NP_440226.1_1 Forward -338 -319 4.916 0.174
NP_440226.1_1 Forward -299 -280 4.81767 0.178
NP_442623.1_3 Forward -298 -279 0.982764 0.0521
NP_440996.1_3 Forward -294 -276 12.8022 0.221
NP_442173.1_1 Forward -298 -290 15.4574 0.00633
NP_442173.1_1 Reverse -291 -299 15.4574 0.00633
NP_442752.1_4 Forward -299 -292 13.8055 0.0199
NP_442752.1_4 Reverse -290 -297 13.8055 0.0199
NP_443027.1_4 Reverse -288 -298 13.943 0.0452
NP_443027.1_4 Forward -301 -291 7.25653 0.24
NP_442975.1_10 Reverse -286 -300 21.6317 0.000774
NP_442975.1_10 Forward -303 -289 1.47397 0.297
NP_440784.1_7 Forward -298 -291 15.9687 0.0123
NP_440784.1_7 Reverse -291 -298 15.9687 0.0123
NP_440784.1_7 Forward -344 -337 9.97054 0.0912
NP_442909.1_7 Reverse -291 -305 10.2254 0.14
NP_440110.1_4 Forward -310 -291 5.89931 0.162
NP_440110.1_8 Forward -169 -150 -2.85214 0.282
NP_441476.1_5 Reverse -285 -304 -1.18052 0.2
NP_442062.1_8 Forward -299 -289 19.4496 0.000558
NP_442062.1_8 Reverse -290 -300 10.3048 0.0493
NP_441900.1_2 Forward -172 -154 -5.78308 0.288
NP_441859.1_3 Forward -300 -281 9.04509 0.131
NP_440304.1_4 Forward -301 -291 10.8948 0.051
NP_440304.1_4 Reverse -288 -298 9.91146 0.051
NP_442242.1_4 Forward -298 -291 14.3954 0.0124
NP_442242.1_4 Reverse -291 -298 14.3954 0.0124
NP_440044.1_8 Forward -298 -279 5.70265 0.0991
NP_440044.1_8 Reverse -291 -310 0.687771 0.193
NP_441781.1_7 Reverse -290 -309 13.7658 0.136
NP_441035.1_10 Reverse -124 -143 17.4449 0.29
NP_442981.1_1 Forward -163 -144 13.6675 0.252
NP_441619.1_8 Forward -305 -291 16.1252 0.0841
NP_441208.1_9 Forward -302 -288 16.2242 0.0671
NP_441208.1_9 Reverse -133 -147 6.6861 0.234
NP_441594.1_6 Reverse -281 -300 2.26107 0.254
NP_442742.1_9 Forward -381 -362 -9.24366 0.269
NP_442110.1_7 Forward -299 -285 10.226 0.0684
NP_442110.1_7 Reverse -290 -304 1.27789 0.233
NP_441925.1_5 Reverse -243 -257 17.4042 0.102
NP_441083.1_5 Forward -299 -289 11.3864 0.0159
NP_441083.1_5 Reverse -290 -300 11.2881 0.0159
NP_441738.1_2 Forward -297 -290 15.28 0.0102
NP_441738.1_2 Reverse -292 -299 15.28 0.0102
NP_441738.1_4 Reverse -280 -299 6.29264 0.203
NP_441558.1_5 Forward -153 -134 11.6025 0.0789
NP_441558.1_5 Reverse -288 -307 6.98095 0.198
NP_440209.1_1 Reverse -290 -298 18.1123 0.00295
NP_440209.1_1 Forward -299 -291 18.1123 0.00295
NP_442889.1_8 Reverse -287 -301 12.782 0.0599
NP_441713.1_1 Reverse -284 -303 3.6377 0.0568
NP_440178.1_7 Forward -300 -281 -12.5869 0.121
NP_440178.1_7 Reverse -289 -308 -20.3551 0.188
NP_442570.1_3 Reverse -375 -394 -5.40875 0.243
NP_442461.1_2 Forward -192 -173 12.4875 0.285
NP_441327.1_1 Forward -369 -350 6.42389 0.25
NP_442111.1_4 Forward -300 -286 9.83269 0.0575
NP_442111.1_4 Reverse -289 -303 7.17775 0.103
NP_440906.1_5 Forward -298 -291 15.8704 0.0124
NP_440906.1_5 Reverse -291 -298 15.8704 0.0124
NP_440747.1_10 Forward -302 -290 5.54551 0.0128
NP_440747.1_10 Reverse -287 -299 -2.02597 0.0196
NP_441130.1_10 Reverse -288 -302 10.0294 0.117
NP_442973.1_5 Forward -308 -289 10.0292 0.287
NP_441486.1_1 Reverse -287 -301 5.89945 0.0344
NP_441486.1_1 Forward -302 -288 4.22782 0.0475
NP_441486.1_1 Reverse -333 -347 -4.22864 0.192
NP_442634.1_4 Reverse -288 -302 -3.24533 0.161
NP_442634.1_4 Forward -301 -287 -3.63866 0.161
NP_441265.1_3 Reverse -284 -298 2.94952 0.181
NP_440470.1_5 Reverse -258 -277 14.2756 0.158
NP_440403.1_10 Reverse -281 -300 5.40766 0.243
NP_440842.1_6 Reverse -181 -200 9.83173 0.295
NP_442848.1_1 Reverse -284 -298 -3.24533 0.263
NP_442848.1_1 Forward -305 -291 -3.54032 0.268
NP_443018.1_3 Forward -298 -291 14.8871 0.0123
NP_443018.1_3 Reverse -291 -298 14.8871 0.0123
NP_441316.1_7 Reverse -288 -303 0.963207 0.177
NP_441634.1_8 Forward -301 -287 5.50613 0.114
NP_441634.1_8 Reverse -276 -290 0.589577 0.223
NP_440376.1_1 Forward -299 -290 19.4693 0.000692
NP_440376.1_1 Reverse -290 -299 19.4693 0.000692
NP_441588.1_4 Forward -297 -287 6.96153 0.178
NP_441588.1_4 Reverse -292 -302 6.96153 0.178
NP_442687.1_7 Reverse -289 -299 15.8113 0.0125
NP_442687.1_7 Forward -300 -290 9.02648 0.0994
NP_442191.1_4 Forward -298 -284 15.3562 0.0603
NP_442589.1_5 Forward -289 -270 12.6841 0.265
NP_441846.1_10 Forward -163 -144 -23.6983 0.295
NP_440642.1_10 Reverse -141 -155 1.96562 0.284
NP_440642.1_10 Reverse -147 -161 1.5723 0.29
NP_441013.1_2 Forward -87 -69 -4.60241 0.299
NP_442770.1_1 Reverse -145 -159 15.8302 0.271
NP_441422.1_7 Reverse -288 -305 2.49712 0.113
NP_441422.1_7 Forward -340 -323 -5.1727 0.247
NP_442296.1_9 Forward -298 -279 -1.18052 0.198
NP_442296.1_9 Reverse -291 -310 -5.9004 0.295
NP_441763.1_10 Reverse -279 -298 8.55343 0.214
NP_442658.1_1 Reverse -288 -298 18.7607 0.00222
NP_442658.1_1 Forward -301 -291 13.0576 0.04
NP_442198.1_3 Reverse -135 -154 3.44104 0.286
NP_442205.1_9 Forward -305 -289 9.20332 0.102
NP_441414.1_9 Forward -299 -280 -3.93378 0.143
NP_440184.1_7 Reverse -242 -261 13.4144 0.28
NP_441958.1_5 Forward -300 -290 21.2195 0.000805
NP_441958.1_5 Reverse -289 -299 12.2714 0.00183
NP_441958.1_5 Reverse -328 -338 -1.98659 0.265
NP_440203.1_1 Reverse -291 -310 17.8957 0.27
NP_440203.1_5 Reverse -293 -303 8.92768 0.281
NP_440984.1_7 Reverse -285 -299 10.6193 0.122
NP_439990.1_8 Forward -232 -213 1.17943 0.283
NP_442690.1_1 Reverse -237 -256 -1.7705 0.13
NP_442911.1_2 Reverse -280 -299 8.75091 0.0195
NP_441580.1_6 Reverse -279 -298 14.6508 0.0472
NP_440153.1_5 Reverse -291 -305 5.40779 0.191
NP_440153.1_5 Forward -298 -284 3.93283 0.199
NP_442536.1_1 Forward -203 -184 3.44104 0.284
NP_440200.1_3 Forward -320 -301 9.73422 0.269
NP_440993.1_2 Forward -304 -288 3.99177 0.256
NP_440993.1_2 Reverse -285 -301 3.89344 0.256
NP_440993.1_3 Reverse -274 -293 -1.77127 0.292
NP_441099.1_3 Reverse -229 -248 -3.3438 0.299
NP_441099.1_5 Reverse -280 -299 -0.983855 0.101
NP_442002.1_9 Reverse -289 -296 10.7572 0.185
NP_440475.1_5 Forward -156 -137 11.3075 0.111
NP_441294.1_7 Reverse -286 -300 13.0902 0.0747
NP_441294.1_7 Forward -303 -289 11.2664 0.15
NP_441646.1_1 Forward -306 -287 5.50599 0.177
NP_442438.1_10 Reverse -285 -299 17.7975 0.0179
NP_442438.1_10 Forward -304 -290 5.01447 0.14
NP_441000.1_6 Reverse -289 -303 3.14618 0.118
NP_441000.1_6 Forward -300 -286 -3.34366 0.221
NP_440605.1_5 Reverse -376 -394 11.2289 0.205
NP_440147.1_4 Forward -301 -288 21.0621 0.00143
NP_440147.1_4 Reverse -288 -301 2.87088 0.202
NP_441550.1_8 Forward -301 -291 15.3192 0.0132
NP_441550.1_8 Reverse -288 -298 10.501 0.066
NP_441916.1_7 Reverse -290 -300 18.9579 0.00144
NP_441916.1_7 Forward -299 -289 18.4663 0.00144
NP_441041.1_4 Forward -299 -280 -0.590531 0.0958
NP_441041.1_7 Reverse -287 -299 19.5648 0.00277
NP_441041.1_7 Forward -302 -290 8.38938 0.137
NP_440569.1_10 Forward -380 -361 5.20389 0.24
NP_440569.1_10 Forward -256 -237 2.91208 0.28
NP_441547.1_2 Forward -310 -292 9.85225 0.193
NP_441547.1_2 Forward -317 -299 6.80398 0.215
NP_442004.1_6 Reverse -290 -304 16.1259 0.0577
NP_441725.1_5 Forward -298 -288 9.02648 0.0553
NP_441725.1_5 Reverse -291 -301 1.94665 0.115
NP_439966.1_7 Reverse -288 -298 17.4824 0.00636
NP_439966.1_7 Forward -301 -291 6.27276 0.185
NP_439966.1_9 Reverse -288 -297 10.7178 0.0863
NP_442941.1_3 Reverse -291 -301 11.0914 0.0116
NP_442941.1_3 Forward -298 -288 2.53664 0.14
NP_440289.1_2 Reverse -287 -300 12.9006 0.0132
NP_442281.1_1 Reverse -285 -299 17.6985 0.00542
NP_441334.1_7 Forward -301 -282 -11.2103 0.12
NP_441334.1_7 Reverse -288 -307 -21.0434 0.287
NP_442012.1_1 Forward -305 -286 -0.590531 0.264
NP_441457.1_7 Reverse -327 -346 7.07928 0.168
NP_441457.1_7 Forward -301 -282 1.67108 0.276
NP_441457.1_7 Reverse -288 -307 -0.885524 0.293
NP_441644.1_6 Reverse -290 -300 19.0557 0.000803
NP_441644.1_6 Forward -299 -289 10.1076 0.0628
NP_441644.1_6 Forward -338 -328 4.20782 0.245
NP_442215.1_2 Forward -301 -285 1.63183 0.13
NP_442215.1_2 Reverse -288 -304 -5.34967 0.249
NP_440253.1_2 Forward -299 -281 10.4422 0.0396
NP_440929.1_8 Forward -299 -290 19.2726 0.000701
NP_440929.1_8 Reverse -290 -299 19.2726 0.000701
NP_442933.1_6 Forward -207 -188 13.9891 0.284
NP_442933.1_10 Forward -299 -290 17.601 0.00325
NP_442933.1_10 Reverse -290 -299 17.601 0.00325
NP_441751.2_8 Reverse -291 -305 7.47274 0.0339
NP_442554.1_8 Reverse -291 -301 16.4013 0.0065
NP_442554.1_8 Forward -298 -288 16.008 0.0065
NP_442970.1_3 Reverse -351 -369 13.1486 0.208
NP_441762.1_7 Forward -300 -288 12.527 0.0142
NP_441762.1_7 Reverse -289 -301 9.47875 0.0142
NP_441762.1_7 Forward -346 -334 3.38223 0.0676
NP_442142.1_4 Reverse -287 -300 14.4733 0.0311
NP_442142.1_4 Forward -302 -289 5.0336 0.204
NP_442292.1_1 Reverse -291 -300 17.5026 0.00435
NP_442292.1_1 Forward -298 -289 9.63616 0.0183
NP_440919.1_1 Reverse -159 -178 -6.1954 0.258
NP_440895.1_3 Reverse -19 -38 16.3703 0.237
NP_443009.1_5 Forward -300 -289 19.626 0.00102
NP_443009.1_5 Reverse -289 -300 7.82632 0.118
NP_442741.1_7 Forward -299 -280 17.6007 0.196
NP_441715.1_4 Forward -298 -288 9.32148 0.097
NP_441715.1_4 Reverse -291 -301 7.35486 0.108
NP_441448.1_7 Forward -165 -146 10.0292 0.24
NP_440158.1_1 Forward -251 -232 9.97848 0.269
NP_441198.1_8 Forward -301 -291 12.783 0.116
NP_441468.1_1 Forward -298 -291 15.8704 0.0124
NP_441468.1_1 Reverse -291 -298 15.8704 0.0124
NP_441020.2_6 Forward -301 -284 14.7885 0.0483
NP_441015.1_10 Forward -304 -285 -2.45882 0.178
NP_441673.1_1 Forward -299 -290 20.8459 0.000698
NP_441673.1_1 Reverse -290 -299 20.8459 0.000698
NP_441826.1_2 Reverse -284 -298 13.9626 0.0213
NP_441826.1_2 Reverse -330 -344 -0.000409212 0.201
NP_442490.1_9 Forward -299 -280 -8.06369 0.282
NP_441764.1_4 Reverse -353 -370 11.414 0.222
NP_441764.1_8 Forward -283 -273 12.3635 0.284
NP_442868.1_6 Reverse -288 -298 8.53483 0.0555
NP_442868.1_6 Forward -301 -291 0.963343 0.205
NP_442361.1_3 Reverse -284 -297 10.5407 0.272
NP_442808.1_1 Reverse -289 -299 18.4657 0.00201
NP_442808.1_1 Forward -300 -290 8.73102 0.0481
NP_442542.1_9 Reverse -283 -297 11.9953 0.11
NP_442050.1_5 Forward -301 -291 9.22267 0.193
NP_442050.1_5 Reverse -288 -298 8.23937 0.234
NP_440342.1_1 Forward -296 -277 10.3242 0.287
NP_441518.1_3 Reverse -280 -299 -13.9635 0.264
NP_441518.1_3 Forward -283 -264 -14.6519 0.279
NP_441878.1_6 Forward -300 -290 10.5014 0.0176
NP_441878.1_6 Reverse -289 -299 10.4031 0.0176
NP_441878.1_6 Forward -152 -142 -7.68978 0.255
NP_441036.1_8 Reverse -289 -299 17.7779 0.000554
NP_441036.1_8 Forward -300 -290 15.713 0.00724
NP_441557.1_4 Reverse -81 -95 9.5377 0.291
NP_441557.1_5 Forward -299 -290 19.9609 0.000699
NP_441557.1_5 Reverse -290 -299 19.9609 0.000699
NP_442066.2_4 Forward -299 -280 -2.36049 0.211
NP_442066.2_9 Reverse -286 -299 8.37742 0.185
NP_442419.1_4 Forward -252 -234 5.91901 0.227
NP_441308.1_8 Reverse -327 -337 12.8614 0.218
NP_441308.1_8 Reverse -288 -298 9.22315 0.226
NP_440101.1_3 Forward -304 -285 9.3409 0.137
NP_442183.1_1 Forward -299 -285 11.406 0.0702
NP_441574.1_1 Forward -299 -280 -3.54046 0.239
NP_441549.1_9 Reverse -286 -304 -7.15901 0.206
NP_440861.1_2 Reverse -109 -128 20.1506 0.0924
NP_442347.1_2 Forward -298 -289 11.1111 0.056
NP_442347.1_2 Reverse -291 -300 3.34298 0.284
NP_442645.1_2 Forward -307 -288 4.916 0.0216
NP_441037.1_4 Reverse -288 -298 16.2838 0.0168
NP_441037.1_4 Forward -301 -291 15.0168 0.028
NP_441037.1_4 Forward -153 -143 12.3855 0.103
NP_441633.1_3 Forward -301 -288 11.1307 0.0286
NP_441633.1_3 Reverse -288 -301 -3.81562 0.177
NP_441633.1_3 Reverse -140 -153 -6.07724 0.236
NP_440136.1_2 Forward -298 -291 15.9687 0.0123
NP_440136.1_2 Reverse -291 -298 15.9687 0.0123
NP_442590.1_10 Reverse -290 -309 5.50599 0.258
NP_442998.1_10 Forward -297 -290 15.5754 0.0102
NP_442998.1_10 Reverse -292 -299 15.5754 0.0102
NP_440299.1_1 Reverse -286 -299 11.4251 0.0489
NP_440299.1_1 Forward -303 -290 7.09854 0.121
NP_441799.1_1 Forward -303 -289 22.32 0.00284
NP_441799.1_1 Forward -349 -335 4.62054 0.242
NP_441799.1_1 Reverse -286 -300 3.44058 0.298
NP_441007.1_10 Reverse -285 -298 3.46087 0.182
NP_441007.1_10 Forward -304 -291 3.36254 0.182
NP_442201.1_10 Forward -162 -143 -8.26035 0.213
NP_442201.1_10 Reverse -279 -298 -13.1769 0.27
NP_440256.1_1 Forward -302 -283 7.7676 0.0248
NP_441512.1_4 Forward -303 -284 19.3707 0.0476
NP_441559.1_8 Forward -304 -290 -1.08205 0.18
NP_441559.1_8 Forward -100 -86 -5.90027 0.271
NP_441559.1_8 Reverse -285 -299 -6.29359 0.276
NP_440915.1_3 Forward -165 -146 13.0775 0.214
NP_440915.1_6 Reverse -286 -300 24.9757 0.000297
NP_440915.1_6 Forward -342 -328 -1.5737 0.239
NP_440717.1_1 Forward -298 -279 6.68596 0.265
NP_440717.1_2 Forward -160 -141 -0.590531 0.227
NP_440164.1_1 Reverse -255 -274 3.53937 0.26
NP_441866.1_6 Forward -203 -184 14.0599 0.159
NP_441464.1_8 Reverse -290 -304 6.98109 0.222
NP_440026.1_4 Forward -302 -283 9.0459 0.259
NP_440188.1_4 Reverse -279 -298 7.96426 0.264
NP_441939.1_3 Forward -298 -279 10.1275 0.129
NP_441939.1_3 Reverse -291 -310 9.24257 0.151
NP_441939.1_3 Reverse -229 -248 5.11266 0.288
NP_441199.1_6 Reverse -286 -305 -1.7705 0.298
NP_442957.1_9 Forward -159 -140 8.94757 0.189
NP_442993.1_1 Reverse -290 -306 -10.7579 0.226
NP_442386.1_9 Reverse -289 -298 15.7322 0.0144
NP_442386.1_9 Forward -339 -330 11.3073 0.0971
NP_442386.1_9 Forward -300 -291 6.39082 0.219
NP_441340.1_5 Forward -298 -291 15.6737 0.0124
NP_441340.1_5 Reverse -291 -298 15.6737 0.0124
NP_442484.1_2 Reverse -279 -298 1.57275 0.229
NP_442791.1_5 Forward -307 -288 -7.57203 0.279
NP_440327.1_6 Forward -50 -31 2.55606 0.294
NP_441132.1_5 Forward -301 -282 12.2908 0.296
NP_440586.1_8 Forward -298 -291 13.2151 0.026
NP_440586.1_8 Reverse -291 -298 13.2151 0.026
NP_442251.1_6 Forward -298 -291 15.2804 0.0124
NP_442251.1_6 Reverse -291 -298 15.2804 0.0124
NP_440684.1_9 Forward -305 -291 6.98109 0.283
NP_441262.1_3 Reverse -290 -297 14.7888 0.0223
NP_441262.1_3 Forward -299 -292 14.7888 0.0223
NP_443051.1_1 Forward -300 -291 19.5676 0.00335
NP_443051.1_1 Reverse -289 -298 10.4228 0.00754
NP_443051.1_1 Reverse -328 -337 4.71961 0.111
NP_441232.1_10 Forward -310 -291 0.58944 0.296
NP_439937.1_9 Forward -300 -283 -8.22161 0.176
NP_439937.1_9 Reverse -289 -306 -16.383 0.287
NP_442294.1_3 Forward -176 -162 12.6836 0.279
NP_441595.1_5 Forward -306 -288 5.23069 0.262
NP_440408.1_3 Forward -236 -217 -6.09707 0.295
NP_440408.1_10 Forward -305 -286 12.5858 0.167
NP_440439.1_1 Forward -302 -289 11.524 0.033
NP_440439.1_1 Reverse -287 -300 9.36073 0.0465
NP_440439.1_1 Reverse -326 -339 -1.45568 0.269
NP_440372.1_2 Forward -298 -291 16.3621 0.0124
NP_440372.1_2 Reverse -291 -298 16.3621 0.0124
NP_440372.1_3 Reverse -356 -370 16.1498 0.165
NP_441181.1_6 Forward -298 -280 3.95239 0.254
NP_440819.1_5 Reverse -84 -92 7.8859 0.266
NP_441803.1_2 Forward -304 -285 8.65258 0.112
NP_440139.1_1 Forward -305 -286 5.01354 0.168
NP_441572.1_7 Reverse -284 -303 16.4207 0.026
NP_441572.1_7 Forward -298 -279 -6.58872 0.296
NP_442384.1_10 Reverse -290 -303 16.0472 0.00946
NP_442384.1_10 Forward -299 -286 2.2809 0.23
NP_442114.1_4 Forward -299 -288 12.1534 0.107
NP_442262.1_10 Forward -298 -291 14.1988 0.0123
NP_442262.1_10 Reverse -291 -298 14.1988 0.0123
NP_441689.1_4 Reverse -352 -371 19.7187 0.0845
NP_441689.1_5 Forward -301 -291 8.3377 0.132
NP_440344.1_10 Reverse -283 -300 10.5603 0.00697
NP_442123.1_3 Forward -299 -280 10.7175 0.276
NP_440189.1_2 Forward -307 -288 7.57094 0.25
NP_441965.1_3 Forward -309 -290 2.3594 0.21
NP_441965.1_10 Reverse -287 -303 8.41667 0.125
NP_442529.1_4 Reverse -281 -300 7.96426 0.278
NP_440297.1_9 Forward -298 -288 -0.216628 0.282
NP_440297.1_9 Reverse -291 -301 -0.216628 0.282
NP_442280.1_10 Reverse -57 -75 7.01283 0.268
NP_441592.1_4 Reverse -290 -309 -1.37718 0.254
NP_441896.1_3 Reverse -281 -300 1.76941 0.209
NP_440894.1_10 Reverse -285 -304 6.78429 0.211
NP_440894.1_10 Forward -235 -216 2.75272 0.283
NP_440999.1_9 Reverse -286 -300 21.1407 0.0083
NP_440888.1_2 Forward -299 -285 20.9434 0.000502
NP_440888.1_2 Reverse -290 -304 8.25877 0.167
NP_440888.1_2 Reverse -67 -81 6.48882 0.232
NP_440600.1_9 Forward -364 -345 9.7875 0.297
NP_440491.1_1 Forward -302 -283 7.30684 0.273
NP_440052.1_5 Reverse -279 -298 6.68596 0.107
NP_439969.1_3 Reverse -285 -304 -0.885524 0.271
NP_441748.1_7 Forward -344 -325 15.9216 0.151
NP_442277.1_4 Reverse -281 -300 16.8132 0.0313
NP_441543.1_2 Forward -298 -289 18.486 0.00236
NP_441543.1_2 Reverse -291 -300 15.9293 0.00518
NP_441543.1_2 Reverse -74 -83 6.39124 0.153
NP_442845.1_2 Forward -305 -291 17.0108 0.0608
NP_441469.1_8 Reverse -289 -298 16.126 0.00797
NP_441469.1_8 Forward -300 -291 6.5879 0.227
NP_443064.1_6 Reverse -290 -300 10.8217 0.13
NP_442337.1_8 Forward -57 -38 2.3594 0.217
NP_442578.1_7 Forward -298 -291 14.5921 0.026
NP_442578.1_7 Reverse -291 -298 14.5921 0.026
NP_440220.1_4 Forward -101 -82 -2.36125 0.27
NP_440148.1_1 Reverse -76 -95 -6.09707 0.246
NP_441462.1_2 Reverse -290 -300 20.2362 0.000805
NP_441462.1_2 Forward -299 -289 11.5831 0.00406
NP_441621.1_7 Reverse -288 -302 4.22782 0.0934
NP_441621.1_7 Reverse -279 -293 3.14618 0.117
NP_441621.1_7 Forward -301 -287 -3.34366 0.188
NP_443062.1_1 Forward -299 -281 17.5166 0.0251
NP_443062.1_1 Reverse -329 -347 3.47554 0.297
NP_443062.1_6 Forward -307 -288 0.392778 0.295
NP_440911.1_3 Forward -133 -119 19.1735 0.205
NP_442204.1_1 Forward -303 -292 6.74518 0.152
NP_442204.1_5 Reverse -280 -299 5.11266 0.16
NP_440255.1_9 Reverse -195 -214 15.6125 0.236
NP_440454.1_6 Forward -148 -129 24.7818 0.00516
NP_440516.1_2 Reverse -284 -302 -2.83245 0.299
NP_440516.1_8 Forward -299 -290 16.9127 0.00442
NP_440516.1_8 Reverse -290 -299 16.9127 0.00442
NP_441785.1_1 Forward -207 -193 13.8049 0.194
NP_441033.1_2 Reverse -280 -299 -10.6203 0.293
NP_442428.1_5 Forward -298 -291 15.8704 0.0124
NP_442428.1_5 Reverse -291 -298 15.8704 0.0124
NP_442428.1_7 Forward -122 -103 7.66927 0.24
NP_442428.1_8 Forward -166 -147 1.17943 0.235
NP_441790.1_3 Forward -298 -279 5.11266 0.113
NP_441867.1_2 Forward -67 -48 -20.5517 0.292
NP_440673.1_2 Forward -309 -290 8.5361 0.266
NP_440673.1_3 Forward -297 -290 12.4288 0.0426
NP_440673.1_3 Reverse -292 -299 12.4288 0.0426
NP_440673.1_7 Reverse -279 -298 12.6841 0.097
NP_440865.1_9 Forward -305 -286 -0.0988766 0.152
NP_441052.1_2 Forward -299 -289 10.5014 0.0285
NP_441052.1_2 Reverse -290 -300 10.4031 0.0285
NP_442219.1_9 Forward -298 -289 8.35786 0.0681
NP_442219.1_9 Reverse -291 -300 8.25953 0.0681
NP_440436.1_4 Forward -298 -289 18.1905 0.00233
NP_440436.1_4 Reverse -291 -300 9.24241 0.0871
NP_440436.1_4 Reverse -330 -339 4.42421 0.265
NP_441884.1_9 Reverse -287 -306 -22.2233 0.277
NP_441884.1_9 Forward -302 -283 -22.2233 0.277
NP_441719.1_2 Forward -204 -190 16.0395 0.22
NP_441719.1_4 Forward -298 -291 16.3621 0.0124
NP_441719.1_4 Reverse -291 -298 16.3621 0.0124
NP_441733.1_10 Reverse -287 -300 10.5407 0.106
NP_441733.1_10 Reverse -326 -339 7.59077 0.153
NP_442366.1_3 Reverse -289 -307 5.52568 0.0875
NP_442366.1_3 Forward -300 -282 -1.35749 0.211
NP_442366.1_5 Forward -302 -292 17.2858 0.0141
NP_440129.1_9 Forward -163 -144 4.03102 0.299
NP_440129.1_10 Reverse -283 -297 4.32615 0.185
NP_441115.1_4 Forward -300 -282 16.0463 0.0323
NP_442694.1_4 Forward -319 -310 13.9627 0.217
NP_440328.1_4 Reverse -284 -303 5.70265 0.143
NP_443054.1_2 Forward -301 -287 12.4876 0.0722
NP_443054.1_2 Forward -146 -132 1.08123 0.251
NP_442308.1_4 Reverse -284 -303 1.0811 0.267
NP_441851.1_10 Reverse -289 -299 16.008 0.00552
NP_441851.1_10 Forward -300 -290 8.53483 0.114
NP_441851.1_10 Forward -152 -142 4.0116 0.291
NP_442622.1_1 Forward -300 -281 -11.0136 0.257
NP_442856.1_7 Reverse -281 -300 -4.52377 0.262
NP_441683.1_5 Reverse -92 -111 9.43923 0.248
NP_440593.1_3 Reverse -285 -304 2.16274 0.178
NP_440165.1_5 Forward -300 -281 -7.67036 0.274
NP_441349.1_10 Forward -309 -290 7.17762 0.0326
NP_440432.1_9 Forward -298 -283 -0.118434 0.164
NP_440474.1_8 Forward -298 -284 9.73373 0.156
NP_440474.1_8 Reverse -291 -305 8.16044 0.189
NP_440877.1_1 Forward -386 -367 8.65258 0.296
NP_442450.1_5 Forward -301 -291 7.64985 0.13
NP_440588.1_2 Forward -308 -289 20.1573 0.0104
NP_441031.1_1 Forward -257 -238 13.6676 0.125
NP_442006.1_2 Reverse -281 -298 -16.5791 0.256
NP_442006.1_2 Forward -160 -143 -17.6607 0.279
NP_442006.1_2 Forward -282 -265 -18.939 0.296
NP_441570.1_1 Forward -299 -281 -9.91228 0.153
NP_441570.1_1 Reverse -290 -308 -16.3038 0.242
NP_441078.1_4 Forward -299 -290 19.6659 0.0007
NP_441078.1_4 Reverse -290 -299 19.6659 0.0007
NP_442729.1_8 Reverse -286 -299 8.47575 0.125
NP_442348.1_2 Forward -320 -311 9.53783 0.28
NP_442443.1_2 Reverse -272 -291 17.109 0.0843
NP_442443.1_4 Forward -148 -138 16.4991 0.148
NP_440793.1_1 Reverse -139 -153 10.3237 0.291
NP_440526.1_3 Forward -298 -287 11.7595 0.0646
NP_441432.1_8 Forward -300 -291 16.8143 0.00595
NP_441432.1_8 Reverse -289 -298 8.25953 0.0755
NP_441432.1_9 Forward -36 -23 14.028 0.157
NP_441432.1_9 Forward -141 -128 8.98619 0.282
NP_442320.1_8 Reverse -284 -298 14.7492 0.0132
NP_442344.1_7 Forward -298 -279 -7.76869 0.191
NP_441732.1_2 Forward -303 -287 2.02515 0.0253
NP_441732.1_2 Reverse -286 -302 -14.9861 0.145
NP_440629.1_1 Forward -261 -243 1.78911 0.248
NP_440760.1_1 Reverse -290 -309 -12.9802 0.0969
NP_440760.1_1 Forward -299 -280 -20.4534 0.222
NP_442797.1_6 Forward -297 -278 13.5577 0.211
NP_442797.1_6 Reverse -138 -157 9.19461 0.246
NP_442298.1_10 Reverse -291 -310 12.2908 0.239
NP_442353.1_4 Reverse -284 -303 3.14526 0.22
NP_442489.1_7 Forward -299 -290 20.1576 0.000695
NP_442489.1_7 Reverse -290 -299 20.1576 0.000695
NP_442079.1_7 Forward -298 -279 5.50599 0.172
NP_442079.1_7 Forward -191 -172 2.55606 0.226
NP_440559.1_1 Forward -298 -289 8.75118 0.0586
NP_440559.1_1 Reverse -291 -300 8.65285 0.0586
NP_441659.2_1 Reverse -318 -337 30.4821 0.000031
NP_441659.2_2 Reverse -258 -277 32.7437 0.0000272
NP_441659.2_6 Reverse -238 -257 22.3197 0.0363
NP_441659.2_8 Reverse -290 -300 20.9245 0.000805
NP_441659.2_8 Forward -299 -289 11.9764 0.0147
NP_441659.2_8 Forward -338 -328 2.43831 0.2
NP_441022.1_1 Forward -384 -375 12.4095 0.232
NP_442913.1_10 Reverse -281 -300 18.4857 0.0136
NP_441040.1_2 Forward -301 -282 -15.0452 0.286
NP_440779.1_5 Forward -299 -282 -5.56602 0.149
NP_442346.1_5 Forward -300 -290 16.303 0.00248
NP_442346.1_5 Reverse -289 -299 9.02648 0.118
NP_440545.1_3 Forward -303 -286 16.1651 0.0124
NP_440545.1_3 Reverse -286 -303 -0.157821 0.149
NP_440545.1_3 Reverse -274 -291 -4.77938 0.232
NP_440545.1_5 Forward -303 -286 10.9536 0.21
NP_440831.1_3 Reverse -281 -300 4.63975 0.298
NP_440743.1_10 Forward -154 -135 19.5673 0.0277
NP_441653.1_2 Reverse -279 -298 13.5795 0.0959
NP_441653.1_2 Forward -298 -279 8.65121 0.175
NP_442603.1_7 Forward -165 -151 6.19383 0.253
NP_442603.1_7 Reverse -67 -81 5.70218 0.277
NP_441233.1_6 Forward -200 -181 10.3234 0.211
NP_441888.1_7 Reverse -285 -299 2.5562 0.225
NP_440449.1_6 Reverse -282 -300 15.6478 0.0851
NP_441948.1_4 Forward -306 -288 -5.78238 0.278
NP_441833.1_4 Forward -298 -291 15.9687 0.0124
NP_441833.1_4 Reverse -291 -298 15.9687 0.0124
NP_441329.1_1 Reverse -243 -262 6.82725 0.249
NP_441329.1_3 Forward -263 -253 13.6534 0.261
NP_441895.1_2 Reverse -303 -322 -8.26035 0.166
NP_442699.1_8 Forward -191 -172 -4.22878 0.238
NP_442162.1_9 Forward -298 -291 16.2637 0.0124
NP_442162.1_9 Reverse -291 -298 16.2637 0.0124
NP_440671.1_1 Reverse -234 -253 10.5334 0.191
NP_442943.1_1 Forward -256 -241 4.06266 0.24
NP_442943.1_1 Reverse -102 -117 3.67984 0.26
NP_442199.1_5 Reverse -282 -301 -4.72043 0.229
NP_442199.1_5 Forward -295 -276 -7.27704 0.292
NP_442140.1_3 Forward -298 -288 17.4829 0.0159
NP_442140.1_3 Reverse -291 -301 6.66654 0.159
NP_442723.1_1 Reverse -286 -305 4.52188 0.276
NP_441609.1_1 Forward -39 -20 -1.67217 0.272
NP_440875.1_9 Forward -297 -287 17.619 0.0104
NP_441813.1_5 Reverse -288 -298 10.0098 0.0208
NP_441813.1_5 Forward -301 -291 8.63316 0.0367
NP_440590.1_4 Forward -298 -285 21.7504 0.00377
NP_440590.1_4 Reverse -291 -304 1.29759 0.127
NP_440567.1_1 Reverse -291 -305 17.5025 0.0153
NP_440567.1_1 Forward -298 -284 17.3058 0.0153
NP_440567.1_1 Reverse -330 -344 0.0979218 0.256
NP_442497.1_10 Reverse -291 -300 17.601 0.00813
NP_442497.1_10 Forward -298 -289 10.4228 0.0087
NP_440821.1_4 Reverse -288 -298 18.7612 0.00422
NP_440821.1_4 Forward -301 -291 2.24165 0.131
NP_440227.1_10 Forward -386 -367 13.47 0.193
NP_441239.1_9 Reverse -288 -300 16.0669 0.0175
NP_441239.1_9 Forward -301 -289 13.707 0.0355
NP_441239.1_9 Forward -340 -328 5.25052 0.223
NP_441951.1_4 Forward -305 -286 1.47442 0.283
NP_441892.1_1 Reverse -281 -298 -0.0594896 0.177
NP_442193.1_8 Reverse -287 -306 12.3883 0.234
NP_442105.1_9 Reverse -154 -168 14.0605 0.294
NP_442270.1_9 Forward -310 -291 -7.37537 0.213
NP_441508.1_1 Reverse -237 -256 14.3059 0.143
NP_440863.1_1 Forward -359 -345 12.7407 0.278
NP_441541.1_1 Forward -369 -351 -4.29515 0.273
NP_441617.1_6 Reverse -364 -383 -1.27885 0.256
NP_442138.1_1 Reverse -288 -307 1.17865 0.267
NP_440546.1_4 Reverse -290 -300 13.5365 0.0459
NP_440546.1_4 Forward -299 -289 11.8882 0.0679
NP_441230.1_5 Reverse -285 -304 8.75091 0.139
NP_440462.1_6 Reverse -288 -298 17.9746 0.00578
NP_440462.1_6 Forward -340 -330 12.5664 0.0348
NP_440462.1_6 Forward -301 -291 10.5014 0.0396
NP_442611.1_1 Forward -299 -280 -0.885524 0.273
NP_440868.1_4 Forward -303 -291 15.7719 0.0164
NP_440868.1_4 Reverse -286 -298 2.98891 0.142
NP_440638.2_5 Reverse -272 -291 14.5524 0.234
NP_442402.1_2 Forward -174 -160 16.1252 0.263
NP_442402.1_4 Forward -179 -160 -7.08111 0.27
NP_442402.1_4 Forward -101 -82 -9.53937 0.291
NP_442402.1_6 Reverse -159 -168 14.1594 0.241
NP_442402.1_10 Forward -170 -160 15.2208 0.18
NP_442402.1_10 Forward -92 -82 13.8442 0.182
NP_442402.1_10 Forward -171 -161 11.3859 0.257
NP_441848.1_4 Forward -256 -240 8.98304 0.288
NP_442039.1_4 Forward -298 -291 15.1821 0.0124
NP_442039.1_4 Reverse -291 -298 15.1821 0.0124
NP_442039.1_4 Reverse -330 -337 8.10225 0.221
NP_441811.1_8 Forward -305 -291 8.84938 0.228
NP_442409.1_3 Forward -166 -147 18.584 0.245
NP_441926.1_3 Reverse -290 -306 6.15506 0.17
NP_442837.1_3 Forward -298 -291 15.7721 0.0124
NP_442837.1_3 Reverse -291 -298 15.7721 0.0124
NP_442837.1_3 Reverse -337 -344 10.4622 0.0812
NP_442053.1_1 Forward -299 -290 18.3876 0.0007
NP_442053.1_1 Reverse -290 -299 18.3876 0.0007
NP_440505.1_3 Reverse -288 -298 14.1397 0.0235
NP_440505.1_3 Forward -301 -291 8.04317 0.147
NP_440914.1_1 Reverse -290 -300 16.3248 0.00196
NP_440914.1_1 Forward -299 -289 8.6151 0.186
NP_440914.1_1 Forward -338 -328 6.66328 0.269
NP_441011.1_8 Forward -298 -289 16.9127 0.00602
NP_441011.1_8 Reverse -291 -300 16.6177 0.00602
NP_441011.1_8 Reverse -330 -339 11.1111 0.0855
NP_442533.1_6 Forward -299 -290 17.2076 0.00137
NP_442533.1_6 Reverse -290 -299 17.2076 0.00137
NP_442232.1_3 Forward -307 -288 3.44104 0.0917
NP_442229.1_1 Forward -301 -287 8.25877 0.184
NP_443016.1_10 Reverse -281 -300 9.63589 0.267
NP_441482.1_7 Forward -305 -291 -10.5218 0.209
NP_439944.1_9 Forward -298 -288 10.4031 0.0887
NP_439944.1_9 Reverse -291 -301 9.12481 0.1
NP_439944.1_9 Reverse -379 -389 5.78156 0.221
NP_441028.1_6 Forward -170 -160 5.48612 0.255
NP_441028.1_6 Reverse -178 -188 5.19112 0.265
NP_441028.1_6 Reverse -145 -155 3.71617 0.281
NP_440116.1_8 Forward -298 -279 9.24257 0.0354
NP_440115.1_6 Forward -302 -292 6.37155 0.186
NP_440115.1_6 Reverse -326 -336 5.19158 0.265
NP_440007.1_9 Reverse -152 -166 2.65453 0.277
NP_443045.1_9 Reverse -143 -161 7.98318 0.262
NP_441602.1_3 Forward -304 -285 2.26107 0.199
NP_441972.1_5 Forward -298 -279 8.45592 0.0745
NP_441106.1_1 Forward -300 -291 18.486 0.0028
NP_441106.1_1 Reverse -289 -298 18.191 0.0028
NP_439903.1_6 Reverse -287 -306 1.96529 0.236
NP_439903.1_6 Forward -383 -364 1.08032 0.255
NP_439903.1_7 Reverse -153 -172 11.0125 0.199
NP_442306.1_10 Forward -304 -285 -10.817 0.111
NP_441186.1_4 Forward -262 -252 14.9258 0.274
NP_441286.1_1 Forward -300 -288 5.34885 0.0259
NP_441286.1_1 Reverse -289 -301 -3.59927 0.145
NP_441286.1_1 Reverse -141 -153 -6.2542 0.254
NP_440670.1_8 Forward -299 -290 18.3876 0.000699
NP_440670.1_8 Reverse -290 -299 18.3876 0.000699
NP_440886.1_7 Reverse -289 -299 17.7774 0.0011
NP_440886.1_7 Forward -300 -290 8.04271 0.0805
NP_442072.1_9 Forward -300 -282 -3.52077 0.0363
NP_442072.1_9 Reverse -289 -307 -12.3706 0.0852
NP_442072.1_9 Reverse -328 -346 -14.4355 0.145
NP_442072.1_9 Reverse -370 -388 -16.6971 0.204
NP_442072.1_9 Forward -346 -328 -22.4986 0.241
NP_440907.2_8 Forward -298 -288 17.4824 0.00685
NP_440907.2_8 Reverse -291 -301 15.9091 0.0161
NP_440907.2_8 Forward -337 -327 12.5659 0.0624
NP_440907.2_8 Reverse -330 -340 4.10949 0.278
NP_441021.1_1 Reverse -291 -310 1.96607 0.083
NP_441021.1_1 Forward -298 -279 -6.49039 0.18
NP_441021.1_8 Forward -304 -286 5.42735 0.215
NP_441463.1_2 Reverse -252 -270 1.71619 0.247
NP_441463.1_2 Reverse -241 -259 0.851205 0.263
NP_441463.1_3 Reverse -280 -299 0.0977854 0.132
NP_441626.1_2 Forward -298 -291 15.7721 0.0124
NP_441626.1_2 Reverse -291 -298 15.7721 0.0124
NP_441626.1_6 Reverse -286 -304 5.91824 0.271
NP_440107.1_5 Forward -306 -287 -4.32711 0.186
NP_442615.1_1 Forward -308 -290 9.75391 0.0242
NP_442615.1_1 Reverse -281 -299 -2.53746 0.145
NP_442615.1_1 Reverse -327 -345 -6.07737 0.233
NP_441962.1_4 Forward -304 -285 -1.08219 0.118
NP_440387.1_1 Reverse -290 -306 24.5429 0.00118
NP_440387.1_1 Forward -299 -283 -0.531451 0.139
NP_441431.1_2 Reverse -287 -301 18.5835 0.0174
NP_441431.1_2 Forward -302 -288 9.93039 0.172
NP_441488.1_7 Forward -305 -286 8.75091 0.121
NP_441836.1_2 Forward -305 -286 -3.44213 0.238
NP_441993.1_1 Forward -299 -280 7.11193 0.175
NP_441993.1_1 Forward -305 -286 4.28566 0.222
NP_441174.1_2 Forward -302 -288 12.4876 0.248
NP_440114.1_10 Reverse -290 -304 17.5025 0.0104
NP_440114.1_10 Forward -299 -285 6.88276 0.253
NP_440114.1_10 Forward -338 -324 6.29277 0.276
NP_442437.1_8 Reverse -279 -298 13.1758 0.133
NP_442698.1_10 Forward -155 -136 2.55606 0.284
NP_442357.1_8 Reverse -29 -48 9.14423 0.241
NP_440766.1_4 Reverse -286 -300 8.35772 0.0871
NP_440766.1_4 Reverse -325 -339 2.65453 0.176
NP_440766.1_5 Reverse -106 -118 8.51522 0.277
NP_439988.1_7 Reverse -292 -306 12.6836 0.292
NP_442743.1_4 Forward -298 -279 -0.39387 0.174
NP_442743.1_5 Forward -304 -285 7.27595 0.164
NP_440457.1_1 Reverse -286 -298 5.34885 0.141
NP_440457.1_1 Forward -303 -291 2.79224 0.205
NP_440798.1_6 Reverse -291 -304 12.409 0.0468
NP_440798.1_6 Forward -298 -285 3.85419 0.147
NP_442297.1_10 Forward -193 -174 12.0942 0.288
NP_441984.1_2 Reverse -283 -302 10.0292 0.213
NP_442130.1_9 Forward -170 -151 8.65258 0.267
NP_440473.1_9 Forward -162 -143 -5.9004 0.22
NP_442509.1_9 Forward -299 -289 16.2041 0.00739
NP_442509.1_9 Reverse -290 -300 8.04271 0.192
NP_441489.1_3 Reverse -104 -118 9.6563 0.232
NP_442514.1_5 Forward -173 -154 -5.50783 0.26
NP_442514.1_5 Reverse -294 -313 -8.55607 0.285
NP_441440.1_1 Reverse -278 -297 16.8141 0.0976
NP_440554.1_4 Forward -298 -288 13.943 0.0218
NP_440554.1_4 Reverse -291 -301 8.82982 0.0646
NP_440554.1_4 Forward -337 -327 4.20827 0.198
NP_441845.1_6 Reverse -278 -296 9.85225 0.116
NP_441885.1_5 Forward -299 -289 11.4848 0.00668
NP_441885.1_5 Reverse -290 -300 11.3864 0.00668
NP_442228.1_7 Reverse -318 -332 18.5501 0.145
NP_440478.1_10 Reverse -288 -302 7.37441 0.262
NP_440649.2_8 Forward -157 -143 11.8976 0.252
NP_442703.1_9 Forward -369 -351 3.3624 0.292
NP_442341.1_7 Forward -300 -286 13.5693 0.0338
NP_442341.1_9 Reverse -288 -302 5.1122 0.279
NP_441756.1_5 Reverse -286 -305 2.55606 0.208
NP_441173.1_9 Forward -169 -161 13.1954 0.184
NP_443000.1_3 Forward -159 -140 12.9769 0.242
NP_443000.1_7 Forward -301 -291 10.6981 0.0345
NP_443000.1_7 Reverse -288 -298 2.04498 0.226
NP_441842.1_1 Reverse -292 -305 14.2767 0.111
NP_441842.1_10 Reverse -283 -297 21.0424 0.0073
NP_440275.1_3 Reverse -288 -298 17.9746 0.0082
NP_440275.1_3 Forward -301 -291 9.02648 0.0563
NP_440275.1_3 Reverse -327 -337 6.37155 0.111
NP_442932.1_9 Forward -157 -138 15.3391 0.14
NP_440091.1_1 Reverse -286 -298 12.6253 0.0353
NP_440091.1_1 Forward -342 -330 5.15219 0.128
NP_440091.1_1 Forward -303 -291 0.825626 0.227
NP_440679.1_10 Forward -297 -278 -17.5035 0.275
NP_441359.1_5 Forward -302 -283 2.3594 0.272
NP_442451.1_2 Reverse -282 -301 -10.227 0.265
NP_442451.1_2 Reverse -92 -111 -11.0136 0.284
NP_439962.1_4 Forward -166 -147 -1.57384 0.216
NP_439962.1_4 Reverse -279 -298 -2.85214 0.241
NP_439962.1_6 Forward -296 -278 15.2604 0.169
NP_440149.1_8 Forward -299 -280 -4.81876 0.213
NP_441730.1_2 Forward -121 -103 6.11567 0.299
NP_440216.1_1 Forward -299 -285 8.25939 0.0061
NP_440216.1_1 Reverse -290 -304 7.66941 0.00931
NP_440216.1_6 Reverse -283 -299 14.4149 0.0619
NP_440172.1_1 Reverse -290 -300 17.5813 0.00421
NP_440172.1_1 Forward -299 -289 8.73149 0.0586
NP_440172.1_1 Forward -109 -99 5.19158 0.149
NP_442015.1_10 Reverse -286 -299 3.95252 0.178
NP_442015.1_10 Forward -303 -290 2.87088 0.187
NP_441226.1_7 Forward -298 -291 14.4934 0.0123
NP_441226.1_7 Reverse -291 -298 14.4934 0.0123
NP_441226.1_7 Reverse -330 -337 9.77352 0.131
NP_441226.1_7 Reverse -279 -286 8.59356 0.197
NP_440198.1_3 Reverse -292 -311 13.7649 0.277
NP_442446.1_3 Reverse -278 -297 12.8808 0.223
NP_441111.1_7 Forward -298 -290 18.7023 0.00294
NP_441111.1_7 Reverse -291 -299 18.7023 0.00294
NP_442379.1_10 Forward -306 -289 8.39697 0.102
NP_442379.1_10 Reverse -283 -300 -3.10775 0.248
NP_441766.1_2 Forward -299 -290 17.5026 0.00297
NP_441766.1_2 Reverse -290 -299 17.5026 0.00297
NP_440416.1_9 Reverse -283 -302 -3.73712 0.0749
NP_443052.1_8 Reverse -280 -299 -5.50708 0.13
NP_443052.1_8 Forward -71 -52 -6.58872 0.143
NP_443052.1_9 Reverse -144 -163 -7.17871 0.294
NP_442116.1_6 Forward -130 -113 8.8374 0.238
NP_441135.1_5 Reverse -154 -173 13.1758 0.12
NP_442154.1_1 Forward -298 -280 -16.0088 0.229
NP_440261.1_5 Forward -298 -285 -1.06236 0.0655
NP_440261.1_5 Reverse -291 -304 -12.1738 0.272
NP_440988.1_10 Forward -295 -281 10.4172 0.187
NP_440988.1_10 Reverse -282 -296 5.96377 0.238
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCTACCCGTAATACCAAAGCCTTTCTCCTAAATTTCTTTTAATAAAAAAAGTGAGCGAGCACGGATCGCATCCTATCACGGTCTTTTTGCTTAGGGGTAGGCGATCGCCGCTGGGACGGCAAAGTTGCAATAGAGCTTTACAAAACCGTTACAAAACTTCATGCTAAGCCTGGTCACCATAGTATTAACCCAGTTTTAACCATTGATTTGATCGAGGTAAAAATGACAGTTTTCCCCAGCAGCAGGGGGAGAAGGCAAAAAGCCTCTTTTTTTCCTAAAATAGTTTTGAGCCAATTACTACCAGTGATTTTCCCGAATCTATAGCGCTGAGCTAGGCTGGAATAACCTGGTTTTCAATTGGATTTTGGCAACTATTGAGACTAAACGAACCTGCGACT

CDS

ATGGCCCCATCAATTTCCCCTGTCACCCAACCTTTGGTTTCCATGGCGATCGCCCCCACGGTGGTGATTCGTAGTGCTTTGGCTAAAGCGGGGGAACATTTGCAAAAATTGGGGAGTAAGGGCCTAGTGGTAACGGGTAGCCACTCTGCTGAGTTGGGGGAAAAGTCTTTACAAACATTGCAGAAAAATTATGGTCTGACCCTGCCTCTGGCCAGCTATTTACCTGACTGCGCCGAGTCTTCCCTCGAACAGTTGCGGCGACGGGTTCACCAGGAACAGCCAGATTTTATCCTAGGTATTGGGGGAGGCAAAGCCCTAGATACGGCTAAGTTATTGGCCCATCAAACCCAATTGGCGATCGCCACAGTACCTACCTCGGCCGCTACCTGTGCGGGTTGGACTGCCTTGGCCAATGTTTACAGCGAAACGGGGGCTTTCCGTTATGACGTGGCCCTAGACCGATGCCCGGATTTATTGATTGTGGATTATGAATTGATCCAACGGGCTGAACCAAGATTACTAGTTGCCGGCATTGGAGATGCGATCGCCAAATGGTATGAAGCTTCCGTTAGTAGTGGTCAATCCAGCGATACTTTCACCGTGGCCGCTGTACAACAAGCTCGAATTTTGCGGGATATTCTTTTCCAAAAATCCGCTGAAGCCCTGGCCCAACCGGGTAGCGAAACCTGGCGGGAAGTGGTGGATGCCAGTTTGTTGATGGCGGGGGTAATCGGTGGTTTGGGTGGTGCTAACTGCCGCACCGTCGCAGCCCATGCAGTCCACAATGGTTTGACCCAATTGCCCCAGGCCCACCATGCCCTCCACGGGGAAAAAGTCGCCTATGGCATTTTGGTGCAGTTACGCTTAGAAGAATTGGTCAGCGGTAATCAACTCGCCGCTACTGCCCGTCGCCAATTACTGAGCTTTTACGATGAGATAGGTTTACCCAAAACCCTGCAAGATCTGGGTCTGGGACGAATTTCCCTGGAGGAATTACGACAGACGGCGGAATTTACCTGTTTACCCAATTCGGACATTCACCGCTTACCCTTTACTGTGACCCCAGAAACGTTGATGGCGGCCATGGTTTCCACCCTAGTGGAGGAACAAGGTACTCGCCAATTATTTGCCCAAATTCAAGATAATTCCGGTCTTTAA

Protein

MAPSISPVTQPLVSMAIAPTVVIRSALAKAGEHLQKLGSKGLVVTGSHSAELGEKSLQTLQKNYGLTLPLASYLPDCAESSLEQLRRRVHQEQPDFILGIGGGKALDTAKLLAHQTQLAIATVPTSAATCAGWTALANVYSETGAFRYDVALDRCPDLLIVDYELIQRAEPRLLVAGIGDAIAKWYEASVSSGQSSDTFTVAAVQQARILRDILFQKSAEALAQPGSETWREVVDASLLMAGVIGGLGGANCRTVAAHAVHNGLTQLPQAHHALHGEKVAYGILVQLRLEELVSGNQLAATARRQLLSFYDEIGLPKTLQDLGLGRISLEELRQTAEFTCLPNSDIHRLPFTVTPETLMAAMVSTLVEEQGTRQLFAQIQDNSGL