Your browser is old and dusty. Try Google Chrome!

Details for slr1163

ORF slr1163
Accession NP_441652.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442657.1_1 Reverse -157 -174 9.60133 0.289
NP_440815.1_2 Forward -379 -365 20.2551 0.124
NP_442272.1_2 Forward -172 -153 11.8883 0.232
NP_442272.1_2 Forward -56 -37 11.7928 0.232
NP_441623.1_1 Reverse -149 -167 1.49411 0.211
NP_441098.1_8 Forward -309 -290 2.65439 0.284
NP_440996.1_2 Reverse -32 -41 16.126 0.248
NP_441250.1_3 Reverse -156 -175 4.03102 0.252
NP_440304.1_4 Reverse -359 -369 3.12662 0.299
NP_442110.1_7 Reverse -361 -375 2.35953 0.222
NP_441925.1_4 Forward -398 -379 -17.1108 0.288
NP_441149.1_9 Forward -198 -179 -0.0996487 0.27
NP_442570.1_3 Forward -202 -183 -6.39206 0.257
NP_441327.1_1 Reverse -75 -94 2.29119 0.298
NP_441495.1_2 Reverse -1 -20 9.43923 0.299
NP_442848.1_4 Reverse -386 -400 8.84938 0.282
NP_440266.1_3 Forward -371 -355 13.9236 0.266
NP_440184.1_7 Forward -304 -285 14.6558 0.277
NP_442321.1_4 Reverse -351 -370 0.491109 0.255
NP_442690.1_1 Reverse -156 -175 -14.2585 0.271
NP_442690.1_1 Forward -42 -23 -16.3235 0.287
NP_441654.1_5 Reverse -38 -57 12.826 0.272
NP_441916.1_10 Forward -378 -359 0.294447 0.286
NP_442996.1_1 Reverse -32 -51 6.06331 0.246
NP_442996.1_7 Forward -171 -152 13.4757 0.278
NP_441079.1_7 Forward -317 -298 -4.22953 0.246
NP_440780.1_1 Forward -54 -35 7.59119 0.274
NP_442554.1_9 Reverse -378 -397 15.7429 0.217
NP_442970.1_3 Reverse -161 -179 14.278 0.174
NP_441764.1_8 Forward -170 -160 13.6076 0.284
NP_441764.1_8 Reverse -119 -129 10.8322 0.297
NP_440785.1_1 Forward -174 -155 2.0644 0.23
NP_441612.1_2 Reverse -30 -40 9.4206 0.21
NP_441612.1_2 Reverse -111 -121 8.16203 0.233
NP_442808.1_1 Reverse -183 -193 3.42118 0.24
NP_442721.1_6 Forward -170 -151 8.75091 0.197
NP_441433.1_8 Reverse -100 -119 -1.67217 0.263
NP_440084.1_8 Reverse -37 -51 12.1391 0.241
NP_442594.1_8 Forward -153 -134 7.86593 0.211
NP_440899.1_8 Forward -39 -20 3.44104 0.124
NP_441362.1_2 Reverse -123 -142 4.69551 0.265
NP_442158.1_4 Reverse -365 -375 12.3697 0.253
NP_441340.1_9 Forward -169 -159 16.0642 0.194
NP_439976.1_5 Forward -141 -127 10.6187 0.291
NP_443051.1_5 Forward -175 -156 3.73603 0.298
NP_442239.1_8 Reverse -375 -394 5.40766 0.276
NP_441138.1_5 Forward -126 -113 11.0433 0.227
NP_440350.1_5 Reverse -380 -399 1.67108 0.158
NP_442378.1_10 Forward -59 -40 20.0051 0.165
NP_440888.1_2 Reverse -361 -375 5.40719 0.28
NP_442454.1_2 Forward -54 -35 9.7875 0.291
NP_441268.1_1 Reverse -26 -45 16.3764 0.194
NP_442845.1_2 Reverse -3 -17 5.01447 0.247
NP_442710.1_7 Reverse -33 -52 7.8665 0.0963
NP_442710.1_7 Reverse -34 -53 -1.07172 0.216
NP_442710.1_7 Forward -180 -161 -7.41496 0.295
NP_442710.1_7 Forward -60 -41 -8.27995 0.299
NP_441929.1_6 Reverse -226 -245 12.8808 0.261
NP_442204.1_1 Reverse -276 -287 1.14031 0.28
NP_442120.1_10 Reverse -355 -374 -9.24366 0.242
NP_441336.1_5 Forward -199 -180 15.4374 0.0951
NP_441004.1_4 Forward -379 -369 7.55152 0.298
NP_443054.1_2 Forward -372 -358 0.196253 0.274
NP_442689.1_8 Forward -246 -229 -6.64766 0.286
NP_441078.1_4 Forward -193 -184 3.44131 0.14
NP_442443.1_4 Reverse -188 -198 14.8275 0.202
NP_440793.1_1 Forward -128 -114 9.43874 0.293
NP_441432.1_8 Forward -352 -343 2.55633 0.298
NP_441432.1_9 Reverse -152 -165 11.4101 0.227
NP_443024.1_4 Forward -56 -42 18.8785 0.129
NP_441333.1_1 Forward -45 -35 13.0198 0.217
NP_441022.1_1 Forward -52 -43 11.1625 0.284
NP_441800.1_7 Forward -393 -375 -0.275845 0.222
NP_440352.1_5 Reverse -275 -294 10.125 0.278
NP_440025.1_3 Forward -34 -20 10.2235 0.29
NP_441786.1_1 Forward -47 -28 18.0953 0.166
NP_440743.1_8 Reverse -150 -169 13.175 0.281
NP_441329.1_6 Reverse -287 -306 9.31004 0.13
NP_441329.1_6 Reverse -21 -40 6.54077 0.179
NP_441329.1_6 Forward -182 -163 6.34979 0.182
NP_441329.1_6 Forward -179 -160 3.48503 0.216
NP_441895.1_10 Reverse -27 -46 -18.9784 0.282
NP_441112.1_6 Reverse -146 -165 0.294447 0.278
NP_441112.1_8 Reverse -290 -309 15.1424 0.106
NP_442028.1_1 Reverse -159 -172 7.60564 0.292
NP_440227.1_2 Reverse -203 -219 10.3833 0.29
NP_441508.1_4 Forward -214 -200 14.0489 0.287
NP_441017.1_8 Reverse -357 -372 8.43636 0.244
NP_440833.1_6 Forward -167 -153 13.2736 0.168
NP_440833.1_6 Forward -386 -372 6.78381 0.296
NP_440212.1_9 Forward -53 -34 7.19276 0.165
NP_440212.1_9 Reverse -194 -213 5.27058 0.177
NP_441154.1_1 Reverse -73 -87 18.0925 0.176
NP_442899.1_4 Reverse -124 -140 5.66272 0.287
NP_441848.1_4 Reverse -14 -30 10.7974 0.241
NP_439942.1_2 Reverse -20 -39 12.405 0.271
NP_442829.1_2 Reverse -228 -244 8.52763 0.287
NP_441536.1_1 Forward -227 -208 10.5209 0.278
NP_441252.1_6 Forward -153 -146 11.6422 0.288
NP_442532.1_1 Forward -174 -160 11.8628 0.215
NP_442532.1_1 Forward -90 -76 8.8503 0.292
NP_442532.1_3 Forward -284 -265 16.8071 0.256
NP_441235.1_8 Forward -348 -329 15.5357 0.163
NP_442597.1_6 Reverse -157 -176 15.8035 0.292
NP_441697.1_5 Reverse -34 -53 -8.16498 0.256
NP_441697.1_5 Forward -51 -32 -8.83343 0.268
NP_441697.1_5 Forward -52 -33 -8.92892 0.268
NP_441697.1_5 Reverse -150 -169 -10.6478 0.28
NP_441527.1_4 Forward -181 -162 5.29938 0.106
NP_441527.1_4 Reverse -288 -307 -5.77769 0.208
NP_441527.1_4 Forward -180 -161 -6.25514 0.215
NP_441527.1_4 Reverse -24 -43 -10.2658 0.268
NP_441527.1_4 Reverse -321 -340 -10.9342 0.277
NP_441527.1_4 Forward -182 -163 -12.7486 0.293
NP_441527.1_4 Reverse -22 -41 -12.7486 0.293
NP_440404.1_10 Reverse -290 -303 18.5506 0.233
NP_439958.1_2 Reverse -251 -265 10.816 0.297
NP_441401.1_1 Forward -192 -173 8.06259 0.299
NP_441401.1_4 Reverse -230 -243 13.0973 0.29
NP_441425.1_3 Reverse -23 -33 15.2213 0.273
NP_441425.1_4 Forward -170 -156 18.3875 0.282
NP_442090.1_2 Forward -196 -177 7.30471 0.281
NP_441156.1_2 Forward -180 -164 19.7736 0.175
NP_440287.1_5 Forward -200 -181 6.88182 0.286
NP_440293.1_3 Forward -201 -182 0.58944 0.216
NP_440293.1_10 Reverse -373 -392 -0.4922 0.251
NP_442743.1_8 Reverse -152 -171 9.78869 0.255
NP_442930.1_1 Forward -297 -287 9.22267 0.289
NP_442703.1_9 Reverse -227 -245 4.9357 0.244
NP_442703.1_9 Reverse -240 -258 4.14905 0.26
NP_440727.1_8 Forward -166 -152 19.8739 0.18
NP_441635.1_1 Reverse -33 -52 3.67602 0.279
NP_441635.1_2 Reverse -284 -303 11.7928 0.25
NP_441207.1_7 Forward -182 -168 15.7419 0.179
NP_441207.1_7 Reverse -33 -47 9.2554 0.282
NP_441207.1_7 Reverse -287 -301 9.06177 0.282
NP_441207.1_7 Reverse -227 -241 8.77134 0.282
NP_440216.1_9 Forward -375 -366 12.3894 0.241
NP_440216.1_9 Forward -374 -365 6.19458 0.289
NP_442116.1_6 Forward -245 -228 5.2087 0.299
NP_440591.1_1 Forward -56 -37 25.7622 0.00676
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGCAGGAAAACCAACAACACTAGCCCAATGGAAAATGCCTCTTATAGTGGAAATGGGATTATATCCTATGGTGCTTATCCAAACTAAGTTCCTTGGTTTTCTAAATATTTTTCCATTACCTGTGGTTCTTTTAATCAATACCTTGTGCTCCTGTATTTTGCTTCAATATTTTGTAATTCCAGTTATTCAAAAAATGATGCGTTTTTGGCTTTACCCGCAAAAATATTATAAAGAAAAAATTGACTTTTGGGGAAGTGTAATAGTGGCTTTATATTTGCTGTTTATCTGCAGAGTAATGGTGTTTGTATTTTAATAATTGAAGTTGTCTGAAGCGTCTCAATATATCAAAAAAGCTTTATTATTTTTCGCACTATTTTCTCGACTCATCCCTTCTCCATC

CDS

ATGACTTTTTATTATTTGCTTTTTGGTGTGCAGGATTTAGGATTAATACTGTTTTCTAAATTTCTTTCTGCAAATTCTAACTATTCTTGGCTTAAGCTTAGCCTCACTTTGGCGATCGCCATCTTTCCCCAGTCGAAAATTCTGGCCGAGTCTATGCCAGAAGAGGAAGTTGGCAAGATAAATTTAGTTACAGAAATAGAATTTGATGATCAAAATAATAGTAAAAACAAAGAAAATATAGATATATTTCTTAATAAACAATCCCAGTTTCATTTTGCTAAAGATGTTAGAATCAGTCCTTTAAAAGCTTTAACTCCAGGAGAATTAGGGGACTGGCAAGAAGAGGCTGTGCATTATGCCCAGATATTACAGATAAACAATTTTGACCCAGACCATGATCACCATCATGAACCCCATCAATCCGTAGTCGCTATCAGTGGCAACCCCGCCGCCTCTAACATGTTAGTGGGTACAGGACAACTAGGTCAATGGTTAGGGTTAGACGAAAACAGTCCCCTTCGTTTAGGGGGCATTTTTATGGGCAATATTAGTCAACAAATTTCCGGCGGCAATCAGCCTGGTTCCACCGATTTTAATGGAGCTTTAATTTTAGGTTTGGGAATAGATTTAGAAAAAGCAGTGGGTTGGAAAAATGCTTTTTTTGAAGTGGAAGGTTTGCAATATAACGGCCAACCAGTCAACTTTGCGGCAGGTTCTGTCCAGGGCTATAACTCCATTGAAGCCGGGCCCCCTTTGAATCGCACGGAATTGTACCAACTCTGGCTCAATCAAACCTTTCTTGATAATCGCCTTTCTTTTCGGGTGGGCAAGTTAATCCCTTCGATGAATTTTGGTTATGTGGGGCGACCCTTTGTGACCCAAACCAATCCGCAATTATTCACTTCCACCACCGGCTTAATTTATACTCCCGTATTTGTAGGGCCGGCCATGTTGGGCTTCATTCCCGGCTACTACAATTCAGCTTTTGGTTTATATGGTTCATGGAAATCCTGGGGTGCCCCCGGCGACAATCCCGCTACTCCCAATGGTTGGTACACCCAAGCGGGAATTTATGACGGCAGAGGCGCACAGGGAGTACAAACGGGTTTAACTTGGCCTAATTTTTCCGGTGCGTTGTTCAGCGTGGCAGAAGTGGGGGGAACCTGGACTCCCTACGCTGATGATCCGGCAACCGGTTGGGGCAGTGTGGCGGTAGGGGGATGGCGACAGAGTGGTCCGCTAACGGCCCCTGGGGGCGCATTTGAAGCCCAAACGGGGGGCATGTATGCTTACTTGGTGCAAAAACTAGGTAAATTCCGGGATAGCGAAGATCAAAACGGTATTGTTGGCTTTGTCCAAGGTGGTTGGAACAGCTCCAGCACAGCTTTAATGCATAGTTCCCTCGGCTTTGGTTTAACTTTCATTGCCCCCTTTGGCGATCGCCCGTTGGACAGTTACGGTTTCGGTTTTTCCTGGGCCAGGCTAAATGCTAATCCCCTAGCGGGCTACGGCTTTAATAGTTACGAAACCATGATCCAGCTTTATGCCCAGTACCATCTGGTGGGTAATTTATTTATTCAACCGGTGCTGACGGTTTTACCTACTCCCGGTAGTGGTGGGGCTGGGGCTCCTAGTGTAAGTGGCACTGTACAACTCACTTTCCCCTTCTAA

Protein

MTFYYLLFGVQDLGLILFSKFLSANSNYSWLKLSLTLAIAIFPQSKILAESMPEEEVGKINLVTEIEFDDQNNSKNKENIDIFLNKQSQFHFAKDVRISPLKALTPGELGDWQEEAVHYAQILQINNFDPDHDHHHEPHQSVVAISGNPAASNMLVGTGQLGQWLGLDENSPLRLGGIFMGNISQQISGGNQPGSTDFNGALILGLGIDLEKAVGWKNAFFEVEGLQYNGQPVNFAAGSVQGYNSIEAGPPLNRTELYQLWLNQTFLDNRLSFRVGKLIPSMNFGYVGRPFVTQTNPQLFTSTTGLIYTPVFVGPAMLGFIPGYYNSAFGLYGSWKSWGAPGDNPATPNGWYTQAGIYDGRGAQGVQTGLTWPNFSGALFSVAEVGGTWTPYADDPATGWGSVAVGGWRQSGPLTAPGGAFEAQTGGMYAYLVQKLGKFRDSEDQNGIVGFVQGGWNSSSTALMHSSLGFGLTFIAPFGDRPLDSYGFGFSWARLNANPLAGYGFNSYETMIQLYAQYHLVGNLFIQPVLTVLPTPGSGGAGAPSVSGTVQLTFPF