Your browser is old and dusty. Try Google Chrome!

Details for slr1161

ORF slr1161
Accession NP_441650.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -220 -201 5.30933 0.163
NP_442100.1_1 Reverse -75 -94 14.6576 0.118
NP_442100.1_1 Reverse -65 -84 7.68668 0.245
NP_441418.1_1 Reverse -184 -203 16.5674 0.0628
NP_441418.1_6 Forward -396 -377 -29.1065 0.216
NP_442272.1_1 Forward -211 -193 16.5221 0.182
NP_442272.1_2 Reverse -191 -210 11.9838 0.232
NP_442272.1_4 Reverse -64 -82 16.5508 0.247
NP_440120.1_4 Reverse -262 -276 14.2576 0.273
NP_443027.1_4 Forward -223 -213 9.32148 0.166
NP_441812.1_3 Forward -222 -208 13.3726 0.167
NP_442975.1_10 Reverse -51 -65 2.26061 0.28
NP_441250.1_3 Forward -329 -310 2.75272 0.267
NP_442972.1_1 Reverse -75 -93 8.82739 0.287
NP_440304.1_4 Forward -228 -218 4.60159 0.258
NP_441781.1_7 Forward -370 -351 4.32602 0.186
NP_441208.1_9 Forward -290 -276 11.7993 0.145
NP_441738.1_2 Reverse -110 -117 8.1019 0.204
NP_442889.1_8 Reverse -16 -30 4.62054 0.26
NP_442889.1_10 Reverse -190 -209 10.6234 0.274
NP_441716.1_2 Reverse -76 -95 -0.855322 0.277
NP_441209.1_8 Reverse -59 -77 9.80101 0.217
NP_440470.1_5 Forward -94 -75 9.21455 0.234
NP_440842.1_4 Reverse -78 -97 10.7754 0.0832
NP_441014.1_8 Reverse -368 -387 -8.55534 0.284
NP_441316.1_7 Forward -228 -213 -3.65835 0.286
NP_441634.1_8 Reverse -210 -224 1.86788 0.178
NP_441077.1_6 Reverse -188 -204 9.26113 0.176
NP_441077.1_6 Reverse -72 -88 2.03061 0.29
NP_440642.1_10 Reverse -8 -22 1.47397 0.293
NP_440667.1_2 Forward -226 -207 -5.99873 0.273
NP_440236.1_2 Reverse -188 -206 -4.40575 0.277
NP_442658.1_1 Reverse -210 -220 7.0594 0.214
NP_442782.1_2 Reverse -206 -220 0.196253 0.293
NP_442205.1_9 Forward -227 -211 -2.79306 0.272
NP_440184.1_1 Reverse -79 -98 5.17304 0.22
NP_440184.1_1 Reverse -69 -88 1.2492 0.28
NP_441958.1_2 Forward -230 -211 10.6192 0.252
NP_442690.1_1 Forward -94 -75 12.3892 0.0309
NP_442690.1_1 Forward -84 -65 1.0811 0.113
NP_442690.1_1 Reverse -72 -91 -14.9469 0.276
NP_442911.1_1 Forward -95 -82 14.863 0.275
NP_442911.1_2 Reverse -207 -226 -9.047 0.249
NP_441654.1_7 Reverse -317 -336 12.8237 0.262
NP_440345.1_5 Reverse -80 -94 14.143 0.276
NP_441725.1_5 Reverse -218 -228 -0.806614 0.271
NP_439966.1_9 Forward -223 -214 6.5879 0.253
NP_442941.1_3 Forward -220 -210 5.28991 0.122
NP_442281.1_1 Reverse -207 -221 8.3571 0.0823
NP_441457.1_7 Reverse -210 -229 0.196116 0.288
NP_440780.1_1 Reverse -71 -90 16.09 0.231
NP_442933.1_1 Forward -202 -183 9.21455 0.253
NP_442933.1_1 Forward -96 -77 9.21455 0.253
NP_442933.1_2 Reverse -80 -98 8.02331 0.257
NP_442554.1_8 Reverse -213 -223 1.74999 0.298
NP_442970.1_3 Forward -93 -75 14.3721 0.173
NP_442292.1_1 Reverse -160 -169 2.16301 0.227
NP_442292.1_1 Reverse -143 -152 2.16301 0.227
NP_442292.1_1 Reverse -126 -135 2.16301 0.227
NP_440039.1_2 Forward -75 -58 19.246 0.226
NP_442476.1_6 Reverse -213 -227 0.687908 0.247
NP_443009.1_5 Reverse -211 -222 3.49977 0.292
NP_440158.1_1 Reverse -80 -99 11.4109 0.214
NP_441198.1_8 Reverse -210 -220 10.2438 0.289
NP_441758.1_10 Reverse -75 -94 2.35861 0.189
NP_441468.1_1 Forward -225 -218 6.72562 0.126
NP_441468.1_1 Reverse -213 -220 3.97235 0.277
NP_441764.1_4 Forward -97 -80 16.0931 0.0893
NP_441764.1_4 Reverse -76 -93 12.2735 0.193
NP_441911.1_10 Reverse -194 -213 13.4757 0.21
NP_442113.1_10 Reverse -210 -229 -7.37537 0.265
NP_440346.1_7 Reverse -241 -260 4.81767 0.3
NP_441878.1_6 Forward -227 -217 1.06167 0.116
NP_440738.1_5 Reverse -42 -61 3.34271 0.27
NP_441458.1_8 Forward -96 -77 9.11592 0.229
NP_440086.1_4 Forward -90 -76 14.716 0.293
NP_441819.1_2 Reverse -70 -89 22.4879 0.036
NP_441819.1_5 Reverse -37 -56 10.5514 0.261
NP_441549.1_9 Forward -374 -356 -3.52077 0.198
NP_441118.1_2 Reverse -237 -256 11.6025 0.228
NP_440164.1_1 Reverse -300 -319 4.81767 0.26
NP_441866.1_4 Reverse -4 -17 12.8558 0.28
NP_441199.1_7 Reverse -192 -211 3.24438 0.245
NP_442993.1_1 Forward -221 -205 -10.7579 0.226
NP_442386.1_9 Forward -222 -213 11.4057 0.0942
NP_441340.1_9 Reverse -81 -91 12.0151 0.233
NP_440161.1_3 Reverse -106 -125 14.0608 0.126
NP_440586.1_1 Forward -231 -212 -5.21209 0.282
NP_440027.1_3 Reverse -212 -230 2.08335 0.293
NP_440027.1_8 Forward -373 -354 6.78348 0.27
NP_440439.1_1 Forward -224 -211 0.805932 0.175
NP_440372.1_3 Reverse -78 -92 13.5715 0.251
NP_439977.1_5 Reverse -211 -230 1.0811 0.196
NP_441018.1_7 Forward -231 -212 8.65258 0.241
NP_441689.1_5 Reverse -210 -220 7.84605 0.185
NP_440297.1_9 Reverse -218 -228 0.176696 0.282
NP_440350.1_5 Reverse -3 -22 4.22769 0.158
NP_440350.1_5 Forward -206 -187 3.44104 0.158
NP_440350.1_5 Forward -212 -193 2.26107 0.158
NP_442948.1_2 Forward -397 -378 6.09597 0.245
NP_442845.1_2 Reverse -206 -220 12.9793 0.1
NP_441551.1_5 Forward -225 -209 11.2676 0.174
NP_442710.1_7 Reverse -85 -104 9.01981 0.0963
NP_442710.1_7 Reverse -28 -47 -5.49277 0.292
NP_441469.1_8 Forward -222 -213 5.89959 0.246
NP_440454.1_2 Reverse -75 -89 10.7067 0.291
NP_442428.1_5 Reverse -213 -220 10.6589 0.0727
NP_442428.1_9 Forward -103 -84 20.1006 0.198
NP_440618.1_1 Reverse -272 -291 -6.68705 0.25
NP_442612.1_1 Reverse -204 -219 13.1562 0.254
NP_441052.1_2 Reverse -387 -397 3.61828 0.177
NP_440689.1_1 Forward -279 -261 7.00065 0.297
NP_441336.1_5 Reverse -4 -23 15.4374 0.0951
NP_442694.1_4 Forward -289 -280 11.3078 0.277
NP_441851.1_10 Forward -227 -217 4.99491 0.233
NP_441851.1_10 Forward -222 -212 4.50326 0.266
NP_441157.1_1 Reverse -69 -83 6.48882 0.203
NP_441982.1_6 Reverse -44 -53 11.9124 0.288
NP_440338.1_4 Reverse -64 -83 5.40686 0.298
NP_442689.1_8 Forward -90 -73 8.88863 0.138
NP_440474.1_8 Reverse -213 -227 12.0937 0.0935
NP_441031.1_1 Reverse -190 -209 3.64132 0.299
NP_441432.1_9 Forward -355 -342 10.0527 0.256
NP_441333.1_1 Forward -200 -190 13.6871 0.217
NP_441333.1_1 Reverse -5 -15 12.2572 0.238
NP_440759.1_9 Reverse -195 -214 17.5024 0.0785
NP_440336.1_7 Forward -53 -34 10.4559 0.147
NP_442346.1_10 Forward -265 -246 1.27776 0.22
NP_441329.1_1 Forward -87 -68 8.6416 0.224
NP_441329.1_3 Forward -53 -43 15.3887 0.25
NP_441329.1_6 Reverse -195 -214 3.38954 0.216
NP_441329.1_6 Reverse -82 -101 1.67069 0.232
NP_441329.1_6 Reverse -335 -354 0.524783 0.253
NP_441329.1_6 Reverse -178 -197 -1.00309 0.288
NP_441329.1_6 Reverse -266 -285 -1.95801 0.293
NP_441329.1_6 Reverse -189 -208 -2.62645 0.294
NP_441329.1_6 Reverse -92 -111 -3.00842 0.294
NP_440671.1_1 Forward -97 -78 19.9124 0.0322
NP_442199.1_5 Reverse -204 -223 -2.0655 0.185
NP_442140.1_3 Reverse -213 -223 7.64985 0.133
NP_441692.1_2 Reverse -192 -211 4.32602 0.172
NP_441671.1_6 Forward -220 -201 7.7676 0.179
NP_440875.1_9 Reverse -214 -224 9.73475 0.233
NP_440821.1_4 Forward -223 -213 5.19158 0.117
NP_440227.1_2 Reverse -39 -55 10.1866 0.29
NP_441239.1_9 Forward -223 -211 8.6921 0.125
NP_442568.1_1 Forward -99 -80 3.34192 0.267
NP_441892.1_1 Reverse -382 -399 -3.40274 0.239
NP_440219.1_1 Forward -99 -80 12.7459 0.259
NP_440863.1_1 Reverse -338 -352 12.9343 0.267
NP_441541.1_1 Forward -96 -78 15.5672 0.0795
NP_441541.1_1 Forward -86 -68 8.30978 0.122
NP_442138.1_1 Forward -223 -204 3.44025 0.24
NP_442402.1_1 Forward -281 -262 11.1109 0.254
NP_442402.1_2 Forward -276 -262 10.6187 0.292
NP_442402.1_4 Forward -281 -262 -7.57277 0.276
NP_442402.1_4 Reverse -353 -372 -9.24438 0.287
NP_441848.1_4 Reverse -75 -91 10.4154 0.253
NP_441848.1_4 Reverse -181 -197 7.93263 0.288
NP_440696.1_3 Forward -225 -207 -1.35749 0.257
NP_442679.1_1 Reverse -193 -212 -5.21209 0.29
NP_442679.1_1 Reverse -175 -194 -5.21209 0.29
NP_442679.1_1 Reverse -326 -345 -5.50708 0.293
NP_442679.1_1 Reverse -187 -206 -5.80207 0.298
NP_441701.1_3 Forward -230 -213 11.4452 0.213
NP_442844.1_5 Forward -196 -177 10.7167 0.223
NP_442844.1_5 Forward -284 -265 5.01354 0.26
NP_442532.1_1 Reverse -25 -39 15.3612 0.215
NP_442532.1_1 Reverse -334 -348 8.65595 0.295
NP_440914.1_7 Forward -344 -325 8.92807 0.251
NP_442533.1_6 Reverse -217 -226 4.32629 0.184
NP_439981.1_2 Reverse -198 -217 23.2056 0.0233
NP_442597.1_5 Reverse -77 -96 18.8592 0.241
NP_442203.1_1 Reverse -28 -42 15.0039 0.228
NP_441697.1_5 Reverse -73 -92 -1.76702 0.206
NP_441697.1_5 Reverse -26 -45 -6.8281 0.237
NP_440816.1_2 Reverse -185 -204 9.62978 0.218
NP_441028.1_6 Forward -193 -183 4.30615 0.278
NP_441028.1_6 Forward -212 -202 4.20782 0.278
NP_439945.1_2 Forward -85 -68 17.4789 0.237
NP_441527.1_4 Reverse -267 -286 3.77151 0.111
NP_441527.1_4 Reverse -190 -209 3.19856 0.119
NP_441527.1_4 Reverse -189 -208 -0.334645 0.146
NP_441527.1_4 Reverse -193 -212 -4.24981 0.182
NP_441527.1_4 Reverse -238 -257 -9.78835 0.262
NP_441527.1_4 Reverse -181 -200 -9.97933 0.263
NP_441527.1_4 Reverse -268 -287 -10.2658 0.268
NP_441527.1_4 Reverse -195 -214 -11.7937 0.284
NP_441347.1_9 Forward -95 -82 12.2639 0.171
NP_441106.1_1 Reverse -211 -220 4.62128 0.213
NP_439995.1_5 Reverse -98 -117 4.12936 0.289
NP_442072.1_9 Forward -227 -209 -22.6953 0.253
NP_440907.2_8 Reverse -213 -223 4.89613 0.235
NP_441463.1_2 Forward -90 -72 7.77111 0.14
NP_442893.1_4 Reverse -72 -91 1.27698 0.212
NP_440143.1_9 Reverse -28 -47 6.29183 0.121
NP_442805.1_6 Reverse -334 -353 10.8159 0.292
NP_440293.1_3 Forward -233 -214 -4.03212 0.257
NP_439910.1_2 Reverse -204 -221 -22.2823 0.22
NP_440457.1_1 Forward -230 -218 4.95553 0.15
NP_442680.1_5 Reverse -273 -292 8.18053 0.171
NP_440554.1_4 Forward -220 -210 5.68323 0.135
NP_441275.1_1 Forward -110 -92 1.78911 0.227
NP_440628.1_1 Reverse -190 -200 14.8387 0.248
NP_442703.1_1 Reverse -78 -97 9.7875 0.228
NP_442703.1_1 Reverse -184 -203 9.69201 0.228
NP_441842.1_1 Reverse -214 -227 10.3434 0.3
NP_440091.1_1 Forward -225 -213 -0.256015 0.273
NP_441397.1_8 Reverse -271 -284 12.4757 0.259
NP_441207.1_7 Reverse -189 -203 8.86815 0.282
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCTGTGGACCACGATGGTAGTCTGTTACTGGGCATACACTTCCCATATACCTCTTTTTCTTAATTCATAGGTCTAATGTGTTGCGACTAATGTTTAGCGTCCTACACACCTGGCTTTTTTTCTCACCTCTTTCCACTGCACTTACTGCTTTTTCTCTCAGGTCAATACTGTAGGGGGCTGGCATCGCTTTTTCCTTATCTTTATCTTTTTCCTATATTATGTCCTAATCTATGCTATGTCCTAATCTATGCTATGTCCTAATCTATGCTATGTCCTAATCTATGCGATTTTTGCTATATGGCTTTATTAATTTTTATTAAGATTTGATTAAATCTTGAGACATCTTTTTTTCAGAAATGTACATTAACTTTATTGTTAGCAGGTAAAGTAAAAAAAATC

CDS

ATGTCATTTTCAGAATCTAAAATTATTGACCGCTTACTTTCAGTGATTGAACAGGATATTGTTCCTAAAACCCGGGAGGGGGTTAAAGCCGGAAACAAACTATTTGGTGCGGCAATTCTTAAAAAGGAAGACCTATCAACGTTAGTATCCAGTACGAATACAGAAACGGAAAACCCTCTCTGGCATGGTGAAGTCCACACCATGAAAAAACTCTATGAACTTCCCCGGAAAAAGCGTCCTAATCCCCGGGATTGCATTTTTCTTGCCACCCACGAGCCCTGTTCACTTTGTTTATCAGCTATTACCTGGGGCGGATACGATAATTTTTATTATCTTTTTAGTTTTGAAGATTCTCGTGATTCATTTAATATTCCCCATGACCTGCGTATCTTAAAAGAGGTATTCAAGGTAGAAAATGGGGACTATTCCCATGATAATTACTATTGGAAAAGTCATGATTTGGTCAAGCTAGTTGATGGCTATCAAGGAGAATTAAAGCGGTCTTTTCTGGACCGCATTGAAAATCTAAAGGCTGTTTATGCTGAAATGTCTGATGTGTATCAATCCAGTAAAGGAGATGCAGACATTCCTTTAGATTAA

Protein

MSFSESKIIDRLLSVIEQDIVPKTREGVKAGNKLFGAAILKKEDLSTLVSSTNTETENPLWHGEVHTMKKLYELPRKKRPNPRDCIFLATHEPCSLCLSAITWGGYDNFYYLFSFEDSRDSFNIPHDLRILKEVFKVENGDYSHDNYYWKSHDLVKLVDGYQGELKRSFLDRIENLKAVYAEMSDVYQSSKGDADIPLD