Your browser is old and dusty. Try Google Chrome!

Details for slr1146

ORF slr1146
Accession NP_001035871.2
Symbol
Category
Definition
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -120 -106 7.66941 0.1
NP_440795.1_7 Reverse -113 -120 11.3472 0.0978
NP_440795.1_7 Forward -120 -113 5.74231 0.279
NP_442100.1_1 Forward -216 -197 11.3154 0.184
NP_441418.1_6 Forward -249 -230 -10.227 0.0328
NP_441418.1_6 Forward -243 -224 -28.9099 0.213
NP_441418.1_6 Reverse -381 -400 -30.7781 0.296
NP_440815.1_2 Reverse -182 -196 11.1104 0.265
NP_441453.1_1 Reverse -342 -360 4.04996 0.263
NP_441453.1_4 Reverse -112 -120 6.80426 0.121
NP_441453.1_4 Forward -121 -113 6.80426 0.121
NP_442151.1_6 Forward -237 -223 7.37441 0.2
NP_441818.1_9 Reverse -381 -400 2.26107 0.189
NP_441818.1_9 Forward -249 -230 0.687771 0.191
NP_441818.1_9 Forward -243 -224 -7.57203 0.272
NP_441818.1_9 Forward -248 -229 -9.83364 0.291
NP_441098.1_3 Forward -215 -196 2.59002 0.25
NP_440996.1_3 Reverse -336 -354 9.55725 0.279
NP_442173.1_1 Reverse -113 -121 7.68924 0.142
NP_442173.1_1 Forward -120 -112 5.62429 0.206
NP_442752.1_4 Reverse -112 -119 15.0838 0.0199
NP_443027.1_4 Reverse -110 -120 14.3364 0.0452
NP_442975.1_10 Forward -125 -111 16.6169 0.0215
NP_442975.1_10 Reverse -156 -170 3.04726 0.263
NP_441225.1_2 Reverse -229 -248 14.9458 0.0584
NP_441225.1_2 Forward -352 -333 2.45773 0.217
NP_440784.1_7 Reverse -113 -120 6.43063 0.218
NP_440784.1_7 Forward -120 -113 6.23397 0.241
NP_439979.1_9 Reverse -49 -67 7.09898 0.288
NP_442062.1_3 Forward -213 -194 -1.08219 0.255
NP_442062.1_3 Forward -212 -193 -2.16383 0.269
NP_442062.1_8 Reverse -112 -122 15.8113 0.00603
NP_442062.1_8 Reverse -326 -336 3.71661 0.256
NP_441900.1_2 Reverse -218 -236 -2.73484 0.279
NP_441859.1_3 Forward -262 -243 6.29183 0.18
NP_440304.1_4 Reverse -110 -120 10.2065 0.051
NP_440044.1_8 Reverse -113 -132 -4.03212 0.298
NP_441492.1_5 Forward -216 -197 13.6686 0.161
NP_439918.1_2 Reverse -381 -400 -0.295539 0.229
NP_441200.1_4 Reverse -168 -187 7.17762 0.272
NP_440132.1_1 Forward -251 -233 10.0489 0.223
NP_442110.1_7 Forward -121 -107 4.42448 0.201
NP_441925.1_4 Reverse -224 -243 -14.7509 0.263
NP_441925.1_4 Forward -352 -333 -15.5375 0.266
NP_441925.1_4 Reverse -221 -240 -15.5375 0.266
NP_441925.1_4 Forward -345 -326 -16.3242 0.282
NP_440769.1_8 Reverse -132 -151 9.24257 0.214
NP_441083.1_5 Forward -121 -111 -0.216628 0.261
NP_441738.1_2 Forward -119 -112 11.7401 0.0647
NP_441738.1_2 Forward -387 -380 6.52862 0.261
NP_441738.1_2 Forward -333 -326 6.52862 0.261
NP_441955.1_10 Reverse -315 -329 19.0758 0.243
NP_440209.1_1 Reverse -112 -120 8.37755 0.0576
NP_441713.1_1 Forward -159 -140 -14.2585 0.257
NP_441713.1_2 Forward -295 -276 14.5524 0.291
NP_442570.1_3 Forward -251 -232 -9.24366 0.296
NP_442570.1_3 Forward -107 -88 -9.63698 0.3
NP_441025.1_6 Forward -212 -193 7.75803 0.17
NP_440343.1_3 Forward -388 -370 3.16499 0.285
NP_440906.1_5 Reverse -113 -120 12.6255 0.0384
NP_440906.1_5 Forward -120 -113 6.0373 0.262
NP_440438.2_8 Reverse -196 -215 15.2408 0.0486
NP_440438.2_8 Forward -213 -194 1.96607 0.262
NP_441486.1_1 Forward -124 -110 0.88457 0.124
NP_441486.1_1 Reverse -109 -123 -4.22864 0.192
NP_441194.1_1 Forward -216 -197 22.7744 0.0103
NP_442145.1_4 Forward -214 -195 12.4613 0.125
NP_442145.1_4 Reverse -195 -214 7.4002 0.214
NP_440470.1_5 Reverse -197 -216 5.39487 0.299
NP_440842.1_4 Reverse -196 -215 19.3556 0.0205
NP_440842.1_10 Forward -177 -163 6.58777 0.251
NP_440842.1_10 Forward -232 -218 5.21113 0.251
NP_442848.1_9 Reverse -241 -260 5.99764 0.193
NP_441012.1_4 Reverse -44 -57 5.42749 0.297
NP_443018.1_3 Reverse -241 -248 9.38056 0.128
NP_443018.1_3 Reverse -113 -120 5.15232 0.226
NP_443018.1_3 Forward -120 -113 5.05399 0.238
NP_440376.1_1 Reverse -112 -121 7.07956 0.0869
NP_440376.1_1 Forward -121 -112 -0.0986038 0.285
NP_441857.1_5 Forward -128 -110 5.32902 0.208
NP_441588.1_4 Reverse -114 -124 7.45319 0.178
NP_440580.1_8 Reverse -313 -332 8.35677 0.266
NP_441077.1_6 Forward -209 -193 10.5144 0.16
NP_442485.1_3 Reverse -229 -248 -2.0655 0.261
NP_442485.1_5 Forward -215 -196 13.5117 0.174
NP_441846.1_10 Reverse -327 -346 -4.72043 0.175
NP_440642.1_1 Reverse -227 -246 6.78429 0.267
NP_440642.1_10 Reverse -290 -304 11.4053 0.145
NP_442658.1_1 Forward -123 -113 10.796 0.107
NP_442658.1_1 Forward -337 -327 9.12434 0.167
NP_442658.1_1 Forward -106 -96 4.7978 0.297
NP_442300.1_10 Reverse -336 -355 9.0459 0.294
NP_442937.1_5 Forward -254 -235 7.07928 0.263
NP_441958.1_5 Reverse -111 -121 10.2065 0.0145
NP_442690.1_1 Reverse -197 -216 -6.39206 0.166
NP_442911.1_1 Reverse -196 -209 15.627 0.271
NP_442911.1_2 Forward -333 -314 -9.53865 0.258
NP_441580.1_6 Reverse -315 -334 -7.08038 0.236
NP_441580.1_6 Forward -400 -381 -8.55534 0.263
NP_442064.1_4 Reverse -304 -323 6.78348 0.246
NP_443055.1_6 Reverse -232 -250 7.29487 0.161
NP_440138.1_6 Forward -120 -101 0.785326 0.292
NP_441099.1_5 Reverse -230 -249 -3.73712 0.138
NP_441294.1_7 Forward -125 -111 10.5945 0.181
NP_441424.1_2 Forward -213 -194 23.5383 0.0155
NP_442438.1_10 Forward -126 -112 -0.492064 0.264
NP_442431.1_10 Reverse -378 -396 9.0656 0.14
NP_442431.1_10 Forward -243 -225 3.3624 0.218
NP_441000.1_6 Reverse -239 -253 3.8345 0.104
NP_441000.1_6 Reverse -111 -125 -4.81863 0.252
NP_440147.1_4 Reverse -18 -31 1.49425 0.226
NP_440147.1_4 Forward -123 -110 0.510939 0.252
NP_441295.1_4 Forward -181 -162 -4.91709 0.29
NP_441916.1_2 Reverse -244 -263 22.0176 0.0322
NP_441916.1_7 Forward -121 -111 9.81313 0.0323
NP_441916.1_7 Reverse -112 -122 6.66654 0.0875
NP_440345.1_3 Reverse -33 -47 12.6166 0.233
NP_441041.1_4 Forward -121 -102 -9.63698 0.219
NP_441041.1_4 Reverse -326 -345 -13.7669 0.295
NP_441041.1_7 Forward -124 -112 16.941 0.0119
NP_441041.1_7 Forward -338 -326 6.93171 0.185
NP_440099.1_3 Reverse -89 -108 8.84924 0.262
NP_442004.1_6 Forward -121 -107 11.5043 0.115
NP_441725.1_5 Forward -120 -110 1.35667 0.137
NP_439966.1_7 Forward -337 -327 12.2709 0.0464
NP_439966.1_7 Reverse -89 -99 6.56775 0.177
NP_439966.1_7 Reverse -110 -120 5.09279 0.243
NP_442941.1_3 Forward -120 -110 10.4031 0.018
NP_440983.1_5 Reverse -36 -55 -5.99873 0.274
NP_442281.1_1 Forward -126 -112 16.6169 0.00772
NP_442281.1_1 Reverse -235 -249 5.40719 0.159
NP_441334.1_7 Forward -123 -104 -13.8652 0.235
NP_441079.1_7 Forward -209 -190 -7.08111 0.286
NP_001035871.2_1 Forward -47 -28 27.3355 0.000514
NP_001035871.2_2 Forward -24 -5 19.3744 0.154
NP_001035871.2_3 Forward -86 -67 22.9587 0.021
NP_001035871.2_4 Forward -356 -337 20.6481 0.097
NP_001035871.2_5 Forward -291 -273 19.0954 0.191
NP_001035871.2_6 Forward -311 -293 28.3385 0.00177
NP_001035871.2_7 Forward -102 -92 14.533 0.187
NP_001035871.2_7 Reverse -378 -388 14.1397 0.218
NP_001035871.2_8 Forward -211 -192 23.3772 0.0185
NP_001035871.2_9 Forward -64 -50 20.9441 0.215
NP_441556.1_4 Reverse -231 -250 13.0901 0.201
NP_440498.1_1 Reverse -103 -121 -2.43913 0.241
NP_443030.1_1 Forward -216 -199 14.0018 0.132
NP_441644.1_6 Forward -121 -111 7.0594 0.137
NP_441644.1_6 Reverse -54 -64 4.7978 0.224
NP_441644.1_6 Reverse -240 -250 3.71617 0.267
NP_442177.1_5 Reverse -329 -343 7.66941 0.293
NP_440780.1_1 Forward -220 -201 10.3605 0.261
NP_442933.1_10 Reverse -112 -121 7.96454 0.0937
NP_442933.1_10 Forward -121 -112 7.76787 0.11
NP_442554.1_8 Forward -120 -110 7.15819 0.0975
NP_442554.1_8 Reverse -241 -251 2.14332 0.281
NP_441762.1_7 Reverse -325 -337 -3.59927 0.118
NP_441762.1_7 Forward -122 -110 -5.86088 0.246
NP_441762.1_7 Reverse -111 -123 -6.94252 0.284
NP_442142.1_4 Reverse -237 -250 9.06515 0.103
NP_442142.1_4 Forward -107 -94 5.52525 0.188
NP_442292.1_1 Forward -120 -111 7.66954 0.0634
NP_442292.1_2 Reverse -201 -215 16.9068 0.248
NP_442381.1_8 Forward -124 -105 -5.50708 0.148
NP_442381.1_8 Reverse -101 -120 -12.9802 0.267
NP_443009.1_2 Forward -397 -378 1.57275 0.216
NP_443009.1_5 Reverse -111 -122 16.6761 0.00782
NP_442301.1_2 Forward -400 -381 3.73524 0.288
NP_442408.2_1 Forward -121 -102 -4.91709 0.267
NP_441715.1_4 Forward -120 -110 5.68323 0.189
NP_440279.1_8 Forward -129 -110 12.7825 0.242
NP_440730.1_4 Forward -166 -147 -4.81876 0.298
NP_441198.1_8 Reverse -110 -120 13.5643 0.108
NP_441758.1_10 Forward -216 -197 1.86696 0.189
NP_441468.1_1 Reverse -113 -120 12.3305 0.0592
NP_441468.1_1 Forward -120 -113 6.0373 0.223
NP_442099.1_1 Forward -165 -147 14.3755 0.274
NP_441020.2_6 Reverse -110 -127 6.62702 0.26
NP_441020.2_6 Forward -123 -106 5.9387 0.284
NP_441015.1_10 Forward -260 -241 -11.2103 0.292
NP_441673.1_1 Forward -121 -112 1.27803 0.155
NP_441673.1_1 Reverse -112 -121 1.27803 0.155
NP_441764.1_4 Forward -215 -198 21.8226 0.015
NP_442868.1_6 Forward -337 -327 3.81494 0.192
NP_442559.1_3 Reverse -223 -242 7.57094 0.291
NP_442808.1_1 Forward -122 -112 7.35439 0.0814
NP_442808.1_1 Forward -337 -327 1.15957 0.292
NP_442542.1_2 Forward -251 -238 4.73917 0.298
NP_442050.1_2 Reverse -227 -246 7.57013 0.252
NP_442050.1_5 Reverse -110 -120 8.63269 0.223
NP_440342.1_1 Forward -244 -225 11.0125 0.279
NP_440558.1_2 Forward -393 -374 -3.04881 0.232
NP_440558.1_2 Reverse -103 -122 -3.44213 0.236
NP_441048.1_6 Reverse -157 -171 17.3912 0.296
NP_441878.1_6 Reverse -239 -249 0.57002 0.14
NP_441878.1_6 Reverse -219 -229 -7.59145 0.245
NP_441036.1_8 Reverse -111 -121 10.9931 0.144
NP_441036.1_8 Forward -122 -112 7.64985 0.191
NP_441036.1_8 Reverse -306 -316 6.46988 0.229
NP_441557.1_5 Reverse -112 -121 8.94785 0.0289
NP_441557.1_5 Forward -121 -112 0.688044 0.128
NP_440084.1_8 Forward -206 -192 16.8182 0.161
NP_441308.1_8 Reverse -110 -120 15.6147 0.218
NP_442830.1_5 Reverse -89 -103 6.0955 0.22
NP_442919.1_3 Forward -301 -282 5.74825 0.299
NP_442183.1_1 Forward -121 -107 15.1426 0.0239
NP_441116.1_9 Forward -167 -153 11.2093 0.291
NP_441459.1_2 Reverse -86 -105 19.3707 0.0901
NP_441574.1_1 Forward -261 -242 1.37609 0.176
NP_440058.1_7 Forward -187 -168 7.37428 0.247
NP_441549.1_9 Forward -235 -217 -5.19239 0.198
NP_442347.1_2 Forward -120 -111 6.5879 0.163
NP_442645.1_2 Reverse -104 -123 -15.2418 0.194
NP_440136.1_2 Reverse -113 -120 13.7071 0.0244
NP_440136.1_2 Reverse -327 -334 11.1505 0.0519
NP_440136.1_2 Forward -120 -113 6.13563 0.193
NP_441728.2_4 Forward -216 -197 14.6576 0.228
NP_442998.1_10 Forward -119 -112 5.74231 0.255
NP_440299.1_1 Reverse -108 -121 3.95196 0.224
NP_441007.1_10 Forward -266 -253 -0.964025 0.296
NP_440256.1_1 Reverse -109 -128 -5.40875 0.182
NP_440256.1_1 Forward -124 -105 -7.37537 0.234
NP_440256.1_1 Reverse -377 -396 -9.14533 0.275
NP_441229.1_10 Forward -131 -112 -3.3438 0.288
NP_440915.1_6 Forward -125 -111 1.17956 0.145
NP_440915.1_6 Forward -253 -239 -0.688726 0.205
NP_440717.1_3 Forward -118 -104 10.0287 0.241
NP_440702.1_2 Forward -245 -226 -4.32711 0.257
NP_440026.1_4 Forward -252 -233 11.5042 0.239
NP_441199.1_3 Forward -178 -160 2.28076 0.231
NP_441199.1_7 Forward -216 -197 5.99764 0.221
NP_442957.1_4 Reverse -87 -106 15.6341 0.139
NP_442993.1_1 Reverse -112 -128 -8.39793 0.166
NP_442386.1_9 Forward -122 -113 13.9623 0.0289
NP_442386.1_9 Forward -336 -327 11.209 0.0993
NP_442386.1_9 Forward -390 -381 6.39082 0.219
NP_442386.1_9 Reverse -325 -334 5.60418 0.245
NP_442386.1_9 Reverse -111 -120 4.81753 0.282
NP_442386.1_10 Forward -100 -87 4.64084 0.262
NP_442386.1_10 Forward -243 -230 4.54251 0.262
NP_441750.1_1 Forward -249 -230 -13.0786 0.3
NP_441750.1_4 Reverse -228 -247 1.86774 0.274
NP_441340.1_5 Reverse -113 -120 5.93897 0.198
NP_441340.1_5 Forward -120 -113 5.84064 0.208
NP_442791.1_5 Forward -397 -378 -3.63879 0.256
NP_442506.1_5 Forward -248 -229 26.3522 0.00252
NP_441912.1_3 Reverse -322 -341 9.14423 0.27
NP_440027.1_3 Forward -399 -381 7.68819 0.207
NP_440027.1_4 Reverse -197 -216 5.7632 0.186
NP_440027.1_8 Forward -339 -320 8.35677 0.249
NP_443051.1_1 Reverse -111 -120 9.83282 0.0203
NP_439937.1_8 Forward -263 -244 0.0977854 0.237
NP_439937.1_9 Forward -348 -331 -13.0398 0.279
NP_439937.1_9 Reverse -143 -160 -15.6947 0.287
NP_440398.1_6 Reverse -147 -166 5.60432 0.275
NP_443039.1_7 Forward -389 -375 6.88214 0.19
NP_440439.1_1 Reverse -109 -122 10.639 0.0362
NP_440372.1_2 Reverse -113 -120 6.62729 0.151
NP_440372.1_2 Forward -120 -113 6.52896 0.188
NP_440171.1_3 Reverse -334 -353 2.0644 0.289
NP_441138.1_5 Forward -373 -360 3.59498 0.297
NP_441946.1_7 Reverse -76 -94 12.4081 0.258
NP_440316.1_10 Forward -250 -240 15.123 0.171
NP_441803.1_2 Reverse -107 -126 7.27595 0.141
NP_439977.1_5 Forward -127 -108 2.55606 0.171
NP_440139.1_1 Forward -255 -236 11.995 0.0797
NP_440210.1_10 Forward -393 -374 6.98015 0.296
NP_442384.1_10 Forward -121 -108 13.294 0.0211
NP_442384.1_10 Forward -182 -169 2.96921 0.206
NP_442384.1_10 Forward -153 -140 0.60927 0.286
NP_441877.1_9 Reverse -195 -212 1.90713 0.292
NP_442262.1_2 Forward -230 -211 15.2449 0.247
NP_442262.1_10 Reverse -241 -248 9.47889 0.187
NP_442262.1_10 Forward -260 -253 8.20058 0.25
NP_441689.1_5 Reverse -110 -120 15.6142 0.0403
NP_440163.1_10 Reverse -377 -387 8.1415 0.287
NP_440163.1_10 Reverse -323 -333 8.1415 0.287
NP_440163.1_10 Forward -252 -242 7.84651 0.299
NP_440344.1_10 Reverse -319 -336 -0.354483 0.0414
NP_440344.1_10 Reverse -233 -250 -5.95935 0.111
NP_440344.1_10 Forward -128 -111 -8.71262 0.132
NP_440344.1_10 Reverse -105 -122 -12.0559 0.239
NP_440282.1_10 Reverse -230 -249 -8.26035 0.26
NP_440531.1_8 Forward -168 -149 12.7825 0.136
NP_442910.1_6 Reverse -96 -110 9.04604 0.24
NP_441335.1_8 Forward -177 -158 6.58763 0.281
NP_440297.1_9 Forward -248 -238 0.865012 0.282
NP_440297.1_9 Forward -120 -110 -0.609952 0.292
NP_440350.1_5 Forward -381 -362 0.687771 0.158
NP_442378.1_1 Reverse -30 -47 16.1651 0.23
NP_440894.1_10 Forward -340 -321 3.14605 0.278
NP_440888.1_2 Forward -121 -107 13.9619 0.022
NP_440600.1_1 Reverse -197 -216 12.6523 0.29
NP_441949.1_5 Forward -215 -196 26.2015 0.000371
NP_441543.1_2 Forward -120 -111 6.29291 0.153
NP_441543.1_2 Reverse -113 -122 5.70292 0.181
NP_441543.1_3 Reverse -88 -102 5.99717 0.287
NP_442845.1_2 Reverse -106 -120 7.57108 0.195
NP_441834.1_4 Reverse -229 -248 8.84924 0.0782
NP_441304.1_10 Forward -297 -288 13.5694 0.239
NP_441178.1_6 Reverse -230 -249 2.55527 0.27
NP_441469.1_8 Forward -336 -327 12.6844 0.0995
NP_441469.1_8 Forward -122 -113 7.86621 0.227
NP_443064.1_6 Forward -121 -111 9.56122 0.211
NP_442578.1_7 Forward -120 -113 5.15232 0.291
NP_441462.1_2 Reverse -112 -122 0.865012 0.117
NP_441462.1_2 Forward -121 -111 0.668351 0.135
NP_443062.1_1 Reverse -240 -258 9.03346 0.142
NP_443062.1_1 Forward -121 -103 5.32818 0.231
NP_441601.1_4 Reverse -87 -106 -2.65548 0.293
NP_441601.1_4 Forward -108 -89 -3.14714 0.293
NP_440519.1_8 Forward -169 -153 5.27008 0.21
NP_442204.1_1 Reverse -108 -119 0.648657 0.281
NP_442204.1_5 Forward -131 -112 2.65439 0.209
NP_440255.1_7 Forward -216 -199 6.62702 0.299
NP_442780.1_1 Forward -211 -192 21.4356 0.0245
NP_440454.1_2 Forward -216 -202 12.8075 0.227
NP_440516.1_8 Reverse -112 -121 -0.295266 0.232
NP_440516.1_8 Forward -249 -240 -0.590259 0.283
NP_441033.1_2 Forward -131 -112 -7.37537 0.293
NP_442428.1_4 Forward -122 -103 2.65439 0.251
NP_442428.1_5 Forward -120 -113 12.3305 0.0493
NP_442428.1_5 Reverse -113 -120 6.3323 0.193
NP_441443.1_7 Forward -252 -233 -2.85214 0.28
NP_441443.1_7 Reverse -378 -397 -3.63879 0.299
NP_442120.1_10 Forward -261 -242 -11.8003 0.265
NP_442823.1_8 Forward -153 -134 12.4875 0.271
NP_442823.1_8 Reverse -107 -126 9.83255 0.299
NP_440673.1_7 Reverse -101 -120 9.93088 0.111
NP_440673.1_7 Forward -102 -83 2.55606 0.224
NP_441714.1_3 Forward -330 -312 13.883 0.204
NP_441052.1_2 Forward -121 -111 0.0783647 0.263
NP_442219.1_9 Forward -120 -111 5.3096 0.177
NP_440436.1_4 Reverse -113 -122 7.17747 0.136
NP_440436.1_4 Forward -120 -111 6.29249 0.164
NP_440436.1_4 Forward -334 -325 4.42421 0.265
NP_441884.1_8 Reverse -379 -398 -7.08038 0.241
NP_442414.1_2 Reverse -381 -400 13.9625 0.164
NP_441719.1_4 Reverse -113 -120 6.62729 0.151
NP_441719.1_4 Forward -120 -113 6.52896 0.188
NP_441733.1_10 Reverse -109 -122 5.91914 0.203
NP_441004.1_1 Forward -249 -230 -14.9469 0.271
NP_441004.1_1 Reverse -381 -400 -15.6352 0.276
NP_442139.1_10 Reverse -71 -90 12.88 0.188
NP_440296.1_10 Forward -107 -88 -7.37537 0.236
NP_442694.1_4 Forward -242 -233 12.9794 0.225
NP_442694.1_4 Reverse -381 -390 11.1111 0.279
NP_443054.1_2 Reverse -110 -124 8.35772 0.122
NP_441851.1_10 Reverse -111 -121 8.4365 0.116
NP_441851.1_10 Forward -122 -112 4.89658 0.24
NP_442001.1_1 Reverse -196 -215 -3.63955 0.276
NP_440593.1_3 Forward -328 -309 -6.98204 0.285
NP_442689.1_8 Reverse -201 -218 -4.58271 0.267
NP_441349.1_10 Forward -131 -112 -5.21209 0.194
NP_441394.1_10 Forward -345 -327 9.85146 0.263
NP_442843.1_1 Forward -248 -229 -5.80207 0.244
NP_442843.1_4 Forward -245 -227 12.6055 0.283
NP_441477.1_9 Forward -106 -87 21.9273 0.0436
NP_442168.1_5 Forward -120 -101 -0.688862 0.264
NP_442006.1_2 Forward -249 -232 -15.4975 0.227
NP_442006.1_2 Forward -175 -158 -16.3824 0.25
NP_441003.1_7 Forward -347 -328 14.3558 0.254
NP_440483.1_1 Reverse -272 -291 0.392778 0.193
NP_441078.1_4 Forward -121 -112 7.37455 0.0688
NP_441078.1_4 Forward -229 -220 3.53964 0.136
NP_441078.1_4 Reverse -112 -121 0.0980582 0.205
NP_442348.1_2 Forward -167 -158 6.5879 0.299
NP_440707.1_9 Forward -248 -229 1.37609 0.292
NP_441432.1_8 Reverse -111 -120 7.07956 0.105
NP_441333.1_2 Forward -213 -200 16.9638 0.253
NP_442320.1_8 Reverse -320 -334 5.1128 0.0437
NP_442320.1_8 Forward -127 -113 -2.85201 0.1
NP_442320.1_8 Reverse -106 -120 -3.44199 0.122
NP_441030.1_4 Forward -217 -198 4.24897 0.293
NP_442797.1_6 Reverse -242 -261 9.09765 0.246
NP_442797.1_7 Reverse -325 -343 3.16574 0.234
NP_440199.1_7 Reverse -361 -380 14.6508 0.229
NP_440913.1_1 Forward -251 -233 4.73903 0.257
NP_440913.1_1 Reverse -379 -397 3.95239 0.285
NP_442751.1_2 Forward -400 -381 5.40686 0.261
NP_440713.1_4 Forward -247 -228 1.57275 0.284
NP_442489.1_7 Forward -121 -112 0.589713 0.17
NP_442489.1_7 Reverse -112 -121 0.589713 0.17
NP_441659.2_8 Forward -121 -111 8.82982 0.0393
NP_442346.1_1 Reverse -381 -400 15.0441 0.27
NP_442346.1_5 Reverse -111 -121 6.17489 0.212
NP_440352.1_5 Forward -306 -287 13.4344 0.189
NP_441629.1_3 Forward -349 -330 -1.27961 0.262
NP_441629.1_3 Reverse -153 -172 -1.57461 0.264
NP_441126.1_8 Reverse -387 -400 6.60746 0.291
NP_441653.1_2 Forward -260 -241 11.0671 0.119
NP_440010.1_10 Reverse -378 -397 4.22769 0.246
NP_442027.1_5 Reverse -88 -107 11.8975 0.23
NP_441233.1_2 Forward -245 -226 17.5024 0.124
NP_441888.1_7 Forward -340 -326 1.37622 0.253
NP_441833.1_4 Reverse -113 -120 6.43063 0.125
NP_441833.1_4 Forward -120 -113 6.13563 0.198
NP_442162.1_9 Reverse -113 -120 6.52896 0.178
NP_442162.1_9 Forward -120 -113 6.43063 0.208
NP_440671.1_4 Reverse -320 -334 8.25939 0.202
NP_441973.1_1 Reverse -290 -305 1.15987 0.235
NP_442140.1_3 Reverse -241 -251 7.35486 0.142
NP_442140.1_3 Reverse -113 -123 6.17489 0.184
NP_442723.1_1 Forward -346 -327 1.27698 0.298
NP_440875.1_9 Reverse -242 -252 12.7522 0.104
NP_441813.1_5 Reverse -110 -120 6.17489 0.1
NP_441813.1_5 Forward -337 -327 -0.118297 0.234
NP_441813.1_5 Forward -123 -113 -0.708283 0.272
NP_440590.1_4 Reverse -327 -340 0.904263 0.14
NP_440590.1_4 Reverse -381 -394 0.707601 0.144
NP_440590.1_4 Reverse -113 -126 -1.06236 0.21
NP_440567.1_1 Forward -120 -106 3.04785 0.154
NP_442497.1_10 Forward -120 -111 7.76787 0.0731
NP_442497.1_10 Reverse -113 -122 -1.18024 0.256
NP_440821.1_4 Reverse -110 -120 7.94484 0.0591
NP_441239.1_9 Reverse -238 -250 12.822 0.0418
NP_441239.1_9 Reverse -110 -122 6.72548 0.178
NP_442897.1_7 Reverse -332 -351 15.8307 0.228
NP_441727.1_8 Reverse -309 -328 1.47442 0.223
NP_440624.1_4 Reverse -29 -48 30.3837 0.0000611
NP_440624.1_4 Forward -46 -27 18.879 0.0574
NP_440624.1_6 Reverse -6 -24 32.4675 0.0000541
NP_440624.1_9 Reverse -50 -69 29.4987 0.000305
NP_441892.1_1 Reverse -231 -248 -5.36936 0.279
NP_442193.1_1 Forward -249 -231 9.16393 0.255
NP_442643.1_3 Forward -109 -90 -6.09707 0.261
NP_441541.1_1 Forward -214 -196 4.39461 0.171
NP_441541.1_1 Reverse -195 -213 -0.76195 0.237
NP_442216.1_9 Forward -332 -313 22.6156 0.0686
NP_440354.1_7 Reverse -106 -124 7.59063 0.26
NP_442052.1_7 Reverse -336 -350 15.0442 0.199
NP_440546.1_4 Forward -249 -239 12.7608 0.0598
NP_440546.1_4 Reverse -112 -122 10.2399 0.109
NP_440546.1_7 Reverse -390 -400 14.533 0.279
NP_440462.1_6 Reverse -110 -120 15.123 0.0159
NP_440462.1_6 Reverse -324 -334 3.12662 0.26
NP_441474.1_1 Reverse -224 -243 -0.0996487 0.255
NP_441474.1_1 Reverse -230 -249 -0.591301 0.255
NP_442402.1_4 Reverse -258 -277 6.1935 0.133
NP_441848.1_4 Reverse -35 -51 8.88755 0.288
NP_440653.1_10 Reverse -315 -334 16.4207 0.0798
NP_442039.1_4 Forward -120 -113 11.6422 0.0747
NP_442039.1_7 Forward -280 -270 11.2881 0.257
NP_440008.1_9 Forward -175 -156 6.39097 0.287
NP_440825.1_6 Forward -251 -232 9.14423 0.285
NP_442786.1_1 Forward -45 -26 20.649 0.0818
NP_442837.1_3 Reverse -113 -120 12.8221 0.0384
NP_442837.1_3 Forward -120 -113 12.4288 0.0594
NP_440160.1_1 Forward -217 -198 21.9222 0.0145
NP_442053.1_1 Reverse -112 -121 5.89959 0.156
NP_440505.1_3 Reverse -110 -120 14.3364 0.0224
NP_441701.1_3 Forward -172 -155 7.217 0.265
NP_441701.1_8 Reverse -91 -109 4.6407 0.271
NP_441203.1_1 Forward -120 -101 -15.0452 0.21
NP_440914.1_1 Forward -121 -111 14.4706 0.0143
NP_441011.1_8 Forward -120 -111 13.0777 0.0366
NP_441011.1_8 Reverse -113 -122 8.65285 0.144
NP_441011.1_8 Forward -334 -325 5.11294 0.283
NP_442533.1_1 Forward -246 -227 -13.5702 0.237
NP_442533.1_1 Reverse -329 -348 -16.2252 0.263
NP_442533.1_6 Forward -121 -112 6.78456 0.103
NP_442533.1_6 Reverse -112 -121 5.40793 0.14
NP_442533.1_6 Reverse -240 -249 3.7363 0.204
NP_442541.1_10 Forward -348 -334 6.68548 0.248
NP_442541.1_10 Reverse -246 -260 2.75226 0.254
NP_442322.1_4 Reverse -87 -104 0.726459 0.21
NP_442322.1_4 Reverse -152 -169 -8.90993 0.286
NP_442322.1_4 Reverse -150 -167 -9.00826 0.286
NP_442229.1_3 Reverse -217 -234 14.9851 0.234
NP_441482.1_7 Reverse -106 -120 5.99778 0.0364
NP_439944.1_9 Forward -120 -110 7.94484 0.123
NP_442597.1_5 Reverse -195 -214 15.6125 0.241
NP_441697.1_5 Reverse -191 -210 9.11906 0.135
NP_441697.1_5 Forward -218 -199 0.333799 0.195
NP_441028.1_6 Reverse -162 -172 9.02601 0.216
NP_441028.1_6 Reverse -268 -278 7.74772 0.218
NP_442202.1_10 Reverse -239 -253 6.48943 0.255
NP_440116.1_8 Forward -120 -101 -5.11376 0.187
NP_441527.1_4 Forward -218 -199 -9.2154 0.255
NP_441527.1_4 Reverse -359 -378 -12.8441 0.294
NP_441961.1_4 Reverse -306 -325 2.94938 0.281
NP_441106.1_1 Reverse -111 -120 8.75118 0.0469
NP_441106.1_1 Forward -122 -113 7.47288 0.0853
NP_442588.1_6 Forward -108 -89 6.58763 0.175
NP_441479.1_9 Forward -249 -231 16.1454 0.238
NP_441479.1_9 Forward -106 -88 14.6705 0.271
NP_440886.1_7 Forward -122 -112 6.37109 0.13
NP_440886.1_7 Forward -336 -326 3.22451 0.291
NP_440828.1_1 Forward -114 -95 6.68515 0.197
NP_442022.1_4 Reverse -381 -400 9.43923 0.245
NP_442022.1_4 Forward -243 -224 8.84924 0.264
NP_440907.2_8 Forward -120 -110 8.53436 0.117
NP_440907.2_8 Reverse -113 -123 8.43603 0.117
NP_440841.1_4 Reverse -110 -129 -9.93197 0.267
NP_441463.1_3 Forward -114 -95 -5.70374 0.232
NP_442893.1_4 Reverse -190 -209 -1.47628 0.271
NP_441626.1_2 Reverse -113 -120 6.0373 0.212
NP_441626.1_2 Forward -120 -113 5.93897 0.231
NP_442238.1_3 Reverse -375 -394 8.06259 0.197
NP_442209.1_4 Reverse -243 -262 15.4374 0.229
NP_441401.1_1 Forward -229 -210 18.879 0.135
NP_442615.1_1 Forward -130 -112 9.55725 0.0249
NP_442467.1_8 Reverse -221 -240 17.8957 0.258
NP_441962.1_4 Reverse -247 -266 -8.94866 0.21
NP_440387.1_1 Forward -121 -105 5.36841 0.0325
NP_441431.1_3 Forward -249 -230 9.43923 0.236
NP_441431.1_3 Forward -255 -236 2.55606 0.283
NP_441993.1_1 Forward -248 -229 2.1416 0.262
NP_440143.1_9 Reverse -199 -218 6.29183 0.121
NP_440114.1_10 Reverse -112 -126 11.7993 0.103
NP_440114.1_10 Reverse -240 -254 8.65272 0.198
NP_440935.1_6 Reverse -194 -211 6.54559 0.267
NP_442090.1_10 Forward -175 -162 11.1307 0.268
NP_440766.1_4 Reverse -108 -122 0.491246 0.28
NP_439988.1_3 Forward -253 -239 7.66941 0.273
NP_440324.1_7 Forward -234 -217 14.6902 0.226
NP_441133.1_1 Forward -243 -224 15.0441 0.2
NP_439910.1_1 Reverse -308 -322 19.6658 0.265
NP_439910.1_2 Forward -129 -112 -13.8258 0.163
NP_440457.1_1 Reverse -108 -120 4.5622 0.158
NP_440213.1_5 Reverse -303 -322 7.07928 0.297
NP_440473.1_9 Forward -107 -88 0.58944 0.123
NP_442509.1_5 Forward -350 -333 13.9027 0.255
NP_442509.1_9 Forward -358 -348 12.5659 0.0871
NP_442514.1_5 Reverse -232 -251 -6.88445 0.275
NP_440554.1_4 Forward -120 -110 6.27322 0.123
NP_441845.1_6 Reverse -100 -118 -1.55415 0.289
NP_441885.1_5 Reverse -112 -122 0.471689 0.145
NP_441885.1_5 Forward -121 -111 -0.609952 0.215
NP_442341.1_9 Forward -251 -237 9.04542 0.159
NP_443000.1_7 Reverse -110 -120 7.94484 0.0589
NP_440507.2_3 Reverse -103 -122 17.7965 0.0518
NP_441842.1_10 Reverse -105 -119 6.09611 0.299
NP_440091.1_1 Forward -125 -113 3.38223 0.163
NP_442451.1_2 Reverse -149 -168 -8.16202 0.241
NP_442451.1_2 Forward -397 -378 -11.1119 0.287
NP_439962.1_4 Reverse -87 -106 13.8641 0.106
NP_439962.1_4 Forward -108 -89 -6.39206 0.283
NP_440149.1_8 Forward -121 -102 -2.16383 0.166
NP_440149.1_8 Reverse -380 -399 -7.37537 0.283
NP_441105.1_3 Forward -260 -241 -3.63879 0.184
NP_441105.1_3 Reverse -241 -260 -4.6221 0.203
NP_441718.1_10 Forward -255 -236 15.9291 0.209
NP_441226.1_7 Forward -120 -113 11.5435 0.0757
NP_441111.1_7 Forward -120 -112 8.86921 0.0589
NP_441766.1_2 Reverse -112 -121 8.1612 0.0645
NP_442417.1_5 Forward -121 -107 8.06273 0.164
NP_442252.1_3 Reverse -319 -337 13.5888 0.108
NP_443052.1_9 Forward -340 -321 1.37609 0.185
NP_443052.1_9 Forward -400 -381 -2.16383 0.233
NP_443052.1_9 Reverse -87 -106 -7.27704 0.295
NP_440072.1_5 Reverse -375 -393 -0.964162 0.252
NP_440072.1_5 Forward -249 -231 -2.0458 0.269
NP_440072.1_5 Forward -176 -158 -4.01242 0.288
NP_442154.1_1 Reverse -382 -400 3.65739 0.0602
NP_442154.1_1 Forward -248 -230 -0.177514 0.109
NP_442154.1_1 Forward -251 -233 -16.1071 0.232
NP_442564.1_9 Reverse -261 -275 13.9287 0.267
NP_440261.1_5 Forward -230 -217 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCACCAGCGGCACCAATCCCTGTTCCGTTTCTTCTTGATTTAGATAAACGCCGCACCAGTCCACCCGCAATCCCTGTTGCAAAAGCCGAACCTGTGACTGACAAAGGGAAATTAACCCAGCACTGGGGGAATACATTGATGAGATGGAACCGGCCATGGGGCTTGTGGTGGGGCTAGACCCCAGAAATGTTAAGAAATATTAAGATTTGAATTGGTCTACTTATGGCCCTAGGGGGCAGTTTTAGGGGGTGAAACCCTACCTAAATGGTGTTTAGAATCAGCGATCCCCTTAGCGCCGCAAGGGCTTGAGGGGCTTGATATTTAGAATTAGACCGGATATAATCGGCACGGCTTTTGTAACTATCATTACAGCATATAGCTGAAATAGGAGGTAACTGGG

CDS

TTGGCACGTAAACGCAAACGGAAGAGTCGTCGTCGTCAAGAAGGTCGTAAGATTTTGGAGCTTGTTCCTCAGTTTAATATTGAAAGCGGCGAGGATAAGCCTGTCACGGCCGCTCGTCGCTACATCCAAGCTAACGAAATTCAGCCCCCGGCCTTGCTCATTGTAAAACGAAATGAGCACACTACTGATCGATATTTTTGGGCCGAGAAGGGACTGTTTGGGGCCCAGTATGTGGAAGAGAATCATTTTCTATTCCCCAGTCTGCGGGAGTATCAACTACCCACCCCTAGCACCAAAACTCCTGTAGGCGCTGGAACTCGTTAA

Protein

MARKRKRKSRRRQEGRKILELVPQFNIESGEDKPVTAARRYIQANEIQPPALLIVKRNEHTTDRYFWAEKGLFGAQYVEENHFLFPSLREYQLPTPSTKTPVGAGTR