Your browser is old and dusty. Try Google Chrome!

Details for slr1142

ORF slr1142
Accession NP_440619.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -187 -180 14.6904 0.0123
NP_440795.1_7 Reverse -180 -187 14.6904 0.0123
NP_440815.1_5 Forward -188 -169 2.75272 0.292
NP_442291.1_5 Forward -189 -173 1.43517 0.147
NP_440897.1_6 Forward -188 -169 0.195343 0.18
NP_441453.1_4 Reverse -179 -187 16.539 0.00633
NP_441453.1_4 Forward -188 -180 16.539 0.00633
NP_441453.1_7 Reverse -127 -134 11.9372 0.298
NP_442151.1_6 Reverse -179 -193 7.37441 0.2
NP_440226.1_1 Forward -188 -169 11.5042 0.0529
NP_440226.1_1 Reverse -179 -198 8.65258 0.0836
NP_440226.1_9 Reverse -122 -141 13.5691 0.215
NP_442173.1_1 Forward -187 -179 15.4574 0.00633
NP_442173.1_1 Reverse -180 -188 15.4574 0.00633
NP_442173.1_5 Forward -17 -7 17.6531 0.221
NP_442752.1_4 Forward -188 -181 13.8055 0.0199
NP_442752.1_4 Reverse -179 -186 13.8055 0.0199
NP_443027.1_4 Forward -190 -180 5.87989 0.294
NP_441812.1_3 Reverse -178 -192 7.9644 0.254
NP_442975.1_10 Forward -192 -178 11.5037 0.0497
NP_440784.1_7 Forward -187 -180 15.9687 0.0123
NP_440784.1_7 Reverse -180 -187 15.9687 0.0123
NP_440061.1_9 Forward -190 -176 8.65209 0.167
NP_440110.1_6 Forward -269 -250 11.6025 0.296
NP_441054.1_2 Reverse -309 -328 13.5691 0.199
NP_440878.1_4 Reverse -5 -23 10.5406 0.29
NP_442062.1_8 Reverse -179 -189 19.4496 0.000558
NP_442062.1_8 Forward -188 -178 17.3846 0.00193
NP_441859.1_3 Reverse -178 -197 1.6703 0.278
NP_440304.1_4 Forward -190 -180 1.84832 0.299
NP_440304.1_4 Reverse -177 -187 1.84832 0.299
NP_442242.1_4 Forward -187 -180 14.3954 0.0124
NP_442242.1_4 Reverse -180 -187 14.3954 0.0124
NP_441781.1_7 Forward -188 -169 -3.24547 0.295
NP_440916.1_1 Reverse -218 -232 8.25939 0.273
NP_441619.1_8 Reverse -173 -187 10.6187 0.185
NP_441208.1_9 Forward -357 -343 5.40779 0.267
NP_440370.1_9 Reverse -110 -129 18.0915 0.289
NP_441925.1_4 Forward -286 -267 -16.1275 0.281
NP_440769.1_8 Reverse -148 -167 7.17762 0.283
NP_441083.1_5 Forward -188 -178 20.3345 0.00053
NP_441083.1_5 Reverse -179 -189 11.3864 0.0159
NP_441083.1_5 Forward -279 -269 2.53664 0.194
NP_442827.1_7 Forward -358 -340 13.4905 0.263
NP_441434.1_8 Forward -168 -149 15.1272 0.122
NP_441738.1_2 Forward -186 -179 15.28 0.0102
NP_441738.1_2 Reverse -181 -188 15.28 0.0102
NP_441738.1_2 Forward -285 -278 6.72528 0.236
NP_441738.1_2 Reverse -124 -131 6.52862 0.261
NP_440209.1_1 Reverse -179 -187 18.1123 0.00295
NP_440209.1_1 Forward -188 -180 18.1123 0.00295
NP_442889.1_8 Forward -191 -177 22.025 0.00162
NP_442889.1_8 Reverse -101 -115 8.65209 0.114
NP_441713.1_1 Forward -194 -175 -4.52377 0.113
NP_440659.1_9 Reverse -231 -250 11.3075 0.224
NP_441716.1_1 Forward -188 -174 4.03116 0.259
NP_442111.1_4 Forward -114 -100 9.63603 0.0593
NP_441624.1_7 Forward -385 -371 8.45605 0.24
NP_441163.1_1 Reverse -340 -357 9.08455 0.226
NP_441163.1_9 Forward -278 -259 13.5691 0.236
NP_440906.1_5 Forward -187 -180 15.8704 0.0124
NP_440906.1_5 Reverse -180 -187 15.8704 0.0124
NP_441209.1_5 Forward -231 -212 16.4207 0.109
NP_440747.1_10 Reverse -176 -188 14.887 0.00223
NP_440747.1_10 Forward -191 -179 5.44718 0.0137
NP_440747.1_10 Forward -116 -104 -4.68091 0.115
NP_441486.1_1 Forward -191 -177 22.9107 0.00162
NP_441486.1_1 Reverse -176 -190 13.8643 0.00743
NP_441014.1_10 Reverse -259 -278 1.27698 0.23
NP_442848.1_1 Reverse -173 -187 -2.75368 0.263
NP_442848.1_5 Forward -295 -277 9.36059 0.232
NP_443018.1_3 Forward -187 -180 14.8871 0.0123
NP_443018.1_3 Reverse -180 -187 14.8871 0.0123
NP_441634.1_8 Reverse -177 -191 5.21113 0.114
NP_441634.1_9 Forward -140 -121 15.2399 0.165
NP_440376.1_1 Forward -188 -179 19.4693 0.000692
NP_440376.1_1 Reverse -179 -188 19.4693 0.000692
NP_440376.1_1 Reverse -278 -287 0.491382 0.273
NP_441588.1_4 Reverse -181 -191 16.4996 0.0369
NP_441588.1_4 Forward -186 -176 15.9097 0.0369
NP_442687.1_7 Forward -189 -179 15.8113 0.0125
NP_442687.1_7 Reverse -178 -188 8.92815 0.0994
NP_442687.1_7 Reverse -6 -16 6.46988 0.165
NP_441077.1_6 Reverse -140 -156 3.2839 0.271
NP_441846.1_6 Reverse -34 -53 4.12936 0.205
NP_442296.1_9 Forward -187 -168 -0.39387 0.197
NP_442658.1_1 Forward -190 -180 15.9091 0.00966
NP_442658.1_1 Reverse -177 -187 6.76441 0.214
NP_442782.1_2 Reverse -279 -293 7.9644 0.202
NP_442205.1_8 Reverse -4 -23 18.1907 0.287
NP_441414.1_9 Forward -188 -169 20.4523 0.00643
NP_441414.1_9 Reverse -179 -198 10.9142 0.0193
NP_442937.1_5 Reverse -174 -193 6.78429 0.27
NP_441958.1_5 Forward -189 -179 12.2714 0.00183
NP_441958.1_5 Reverse -178 -188 12.2714 0.00183
NP_440203.1_5 Forward -285 -275 8.92768 0.281
NP_440984.1_7 Forward -193 -179 8.94771 0.133
NP_439990.1_5 Forward -193 -180 6.70579 0.223
NP_442376.1_2 Reverse -341 -360 -12.0953 0.286
NP_442911.1_2 Reverse -169 -188 13.2741 0.0118
NP_442911.1_2 Forward -198 -179 3.6377 0.0426
NP_440138.1_1 Forward -288 -270 16.9313 0.0797
NP_442002.1_9 Reverse -6 -13 11.3472 0.185
NP_442002.1_9 Forward -189 -182 10.7572 0.185
NP_441294.1_7 Forward -192 -178 13.0902 0.0747
NP_441294.1_7 Reverse -182 -196 12.0343 0.117
NP_441000.1_6 Reverse -178 -192 -3.34366 0.221
NP_441000.1_6 Forward -189 -175 -4.91696 0.254
NP_441000.1_6 Reverse -278 -292 -5.11362 0.261
NP_442771.1_1 Forward -357 -339 -7.15901 0.169
NP_440147.1_4 Forward -190 -177 12.704 0.0326
NP_440147.1_4 Reverse -177 -190 10.1474 0.0355
NP_441550.1_8 Reverse -177 -187 14.6309 0.0132
NP_441550.1_8 Forward -190 -180 8.3377 0.124
NP_441916.1_7 Reverse -179 -189 18.4663 0.00144
NP_441916.1_7 Forward -188 -178 10.3048 0.0261
NP_440206.1_4 Reverse -69 -88 -2.16459 0.293
NP_441041.1_4 Reverse -179 -198 -12.5869 0.269
NP_441041.1_7 Forward -191 -179 18.9817 0.00435
NP_441041.1_7 Forward -19 -7 8.38938 0.137
NP_442396.1_5 Reverse -175 -188 20.1771 0.00762
NP_442396.1_5 Forward -192 -179 9.45906 0.129
NP_441725.1_4 Reverse -99 -113 16.7152 0.0693
NP_441725.1_5 Forward -187 -177 2.04498 0.115
NP_441725.1_5 Reverse -180 -190 2.04498 0.115
NP_439966.1_7 Forward -190 -180 9.91099 0.0968
NP_439966.1_7 Reverse -177 -187 7.25606 0.15
NP_439966.1_9 Forward -190 -181 0.884706 0.253
NP_442941.1_3 Forward -187 -177 11.0914 0.0116
NP_442941.1_3 Reverse -180 -190 2.63497 0.14
NP_442941.1_3 Forward -112 -102 -0.0199663 0.244
NP_440289.1_2 Forward -191 -178 12.6056 0.0139
NP_440983.1_5 Forward -287 -268 -9.047 0.3
NP_442281.1_1 Forward -193 -179 11.7003 0.0438
NP_442281.1_1 Reverse -174 -188 1.5723 0.296
NP_001035871.2_7 Forward -133 -123 14.1397 0.218
NP_442049.1_2 Reverse -309 -328 5.89931 0.283
NP_441644.1_6 Forward -188 -178 17.3841 0.00127
NP_441644.1_6 Reverse -179 -189 10.1076 0.0628
NP_442215.1_2 Reverse -177 -193 6.35172 0.0719
NP_442215.1_2 Forward -190 -174 4.97508 0.0812
NP_442215.1_2 Forward -144 -128 -6.7263 0.278
NP_440929.1_8 Forward -188 -179 19.2726 0.000701
NP_440929.1_8 Reverse -179 -188 19.2726 0.000701
NP_442933.1_1 Forward -151 -132 7.20922 0.253
NP_442933.1_10 Forward -188 -179 17.601 0.00325
NP_442933.1_10 Reverse -179 -188 17.601 0.00325
NP_441751.2_8 Forward -187 -173 -0.787057 0.129
NP_441751.2_8 Reverse -180 -194 -5.60527 0.223
NP_442554.1_8 Forward -187 -177 15.3197 0.00882
NP_442554.1_8 Reverse -180 -190 13.2547 0.0187
NP_441762.1_7 Reverse -178 -190 10.1671 0.0142
NP_441762.1_7 Forward -189 -177 9.57708 0.0142
NP_442142.1_4 Forward -191 -178 12.605 0.0434
NP_442142.1_4 Reverse -367 -380 8.57349 0.112
NP_442142.1_4 Reverse -176 -189 5.52525 0.188
NP_442292.1_1 Forward -187 -178 18.486 0.00229
NP_442292.1_1 Reverse -180 -189 9.63616 0.0183
NP_442292.1_1 Reverse -105 -114 6.19458 0.109
NP_442476.1_6 Forward -187 -173 8.45605 0.101
NP_443009.1_5 Reverse -178 -189 18.3477 0.00265
NP_443009.1_5 Reverse -278 -289 7.03967 0.141
NP_443009.1_5 Reverse -6 -17 4.67974 0.234
NP_441741.1_6 Reverse -313 -332 9.0459 0.249
NP_441715.1_4 Reverse -180 -190 9.41981 0.097
NP_441715.1_4 Forward -187 -177 7.94484 0.107
NP_441715.1_4 Forward -112 -102 4.79825 0.248
NP_440730.1_4 Forward -355 -336 -2.95047 0.297
NP_441198.1_8 Reverse -277 -287 10.9275 0.232
NP_440464.1_10 Forward -187 -177 13.0082 0.169
NP_441468.1_1 Forward -187 -180 15.8704 0.0124
NP_441468.1_1 Reverse -180 -187 15.8704 0.0124
NP_441673.1_1 Forward -188 -179 20.8459 0.000698
NP_441673.1_1 Reverse -179 -188 20.8459 0.000698
NP_442868.1_6 Reverse -177 -187 9.81313 0.038
NP_442868.1_6 Forward -190 -180 0.865012 0.205
NP_441612.1_2 Forward -188 -178 8.54929 0.21
NP_442227.1_2 Forward -286 -267 8.16093 0.173
NP_442427.1_8 Forward -197 -178 10.3242 0.165
NP_442808.1_1 Forward -189 -179 18.4657 0.00201
NP_442808.1_1 Reverse -178 -188 8.63269 0.0481
NP_440031.1_10 Forward -384 -365 -0.197208 0.282
NP_440145.1_3 Forward -123 -104 -3.54046 0.202
NP_440145.1_3 Reverse -94 -113 -5.40875 0.267
NP_442050.1_5 Reverse -102 -112 9.321 0.193
NP_442050.1_5 Reverse -177 -187 7.64939 0.243
NP_441114.1_3 Forward -14 -5 7.37455 0.239
NP_441114.1_3 Forward -286 -277 7.27622 0.247
NP_441114.1_3 Reverse -116 -125 6.5879 0.262
NP_441878.1_6 Forward -189 -179 10.4031 0.0176
NP_441878.1_6 Reverse -178 -188 10.4031 0.0176
NP_441878.1_6 Reverse -278 -288 -7.49312 0.231
NP_441036.1_8 Forward -189 -179 17.7779 0.000554
NP_441036.1_8 Reverse -178 -188 8.33817 0.174
NP_441557.1_5 Forward -188 -179 19.9609 0.000699
NP_441557.1_5 Reverse -179 -188 19.9609 0.000699
NP_441445.1_1 Forward -197 -178 6.39097 0.15
NP_442066.2_9 Forward -192 -179 9.2624 0.176
NP_441564.1_2 Reverse -278 -297 10.2259 0.0727
NP_442919.1_3 Reverse -131 -150 6.70529 0.272
NP_442183.1_1 Reverse -179 -193 4.62115 0.254
NP_440356.1_1 Reverse -327 -346 12.6833 0.25
NP_442347.1_2 Forward -187 -178 12.4878 0.056
NP_442347.1_2 Reverse -180 -189 11.1111 0.056
NP_442645.1_2 Reverse -171 -190 -2.75381 0.0487
NP_442888.1_6 Forward -27 -8 4.12936 0.228
NP_441037.1_4 Forward -190 -180 14.7245 0.028
NP_441037.1_4 Reverse -177 -187 7.9999 0.237
NP_442508.1_8 Reverse -265 -282 9.18362 0.292
NP_441633.1_3 Reverse -177 -190 8.57408 0.0377
NP_441633.1_3 Forward -190 -177 3.46087 0.0699
NP_441633.1_3 Reverse -49 -62 -2.144 0.173
NP_440136.1_2 Forward -187 -180 15.9687 0.0123
NP_440136.1_2 Reverse -180 -187 15.9687 0.0123
NP_442998.1_5 Reverse -344 -354 10.5998 0.207
NP_442998.1_5 Forward -330 -320 8.82982 0.261
NP_442998.1_5 Reverse -314 -324 7.25653 0.298
NP_442998.1_10 Forward -186 -179 15.5754 0.0102
NP_442998.1_10 Reverse -181 -188 15.5754 0.0102
NP_440299.1_1 Reverse -175 -188 18.9965 0.00298
NP_440299.1_1 Forward -117 -104 11.4251 0.0489
NP_440299.1_1 Forward -192 -179 2.18201 0.294
NP_441799.1_1 Reverse -175 -189 17.4035 0.011
NP_441799.1_1 Forward -192 -178 14.5519 0.0228
NP_441007.1_5 Reverse -225 -244 9.14423 0.24
NP_440256.1_1 Forward -191 -172 -5.50708 0.184
NP_440087.1_1 Reverse -270 -289 -8.35868 0.278
NP_441559.1_8 Forward -292 -278 -4.32697 0.222
NP_441559.1_8 Forward -360 -346 -5.40861 0.261
NP_441559.1_8 Forward -193 -179 -6.39192 0.277
NP_440915.1_6 Reverse -175 -189 0.687908 0.155
NP_440915.1_6 Forward -192 -178 -3.34366 0.293
NP_441464.1_8 Reverse -179 -193 4.62115 0.269
NP_442993.1_1 Reverse -179 -195 -0.138127 0.0696
NP_442386.1_9 Forward -189 -180 15.7322 0.0144
NP_442386.1_9 Reverse -178 -187 13.8639 0.0289
NP_441750.1_1 Forward -344 -325 -4.32711 0.204
NP_441340.1_5 Forward -187 -180 15.6737 0.0124
NP_441340.1_5 Reverse -180 -187 15.6737 0.0124
NP_440168.1_9 Reverse -268 -287 -4.42544 0.296
NP_440327.1_6 Reverse -267 -286 2.55606 0.294
NP_440161.1_3 Forward -71 -52 7.27595 0.299
NP_442714.1_7 Forward -187 -168 -1.7705 0.292
NP_441160.1_9 Forward -287 -268 8.75091 0.264
NP_440586.1_8 Forward -187 -180 13.2151 0.026
NP_440586.1_8 Reverse -180 -187 13.2151 0.026
NP_442251.1_6 Forward -187 -180 15.2804 0.0124
NP_442251.1_6 Reverse -180 -187 15.2804 0.0124
NP_440684.1_9 Reverse -173 -187 9.5377 0.218
NP_441262.1_3 Reverse -179 -186 14.7888 0.0223
NP_441262.1_3 Forward -188 -181 14.7888 0.0223
NP_443051.1_1 Reverse -178 -187 10.4228 0.00754
NP_443051.1_1 Forward -189 -180 10.4228 0.00754
NP_443051.1_1 Reverse -103 -112 -0.000272808 0.245
NP_439937.1_9 Reverse -178 -195 -6.94332 0.157
NP_439937.1_9 Forward -189 -172 -6.94332 0.157
NP_442294.1_3 Forward -152 -138 13.7653 0.252
NP_440626.1_1 Reverse -8 -27 13.6666 0.203
NP_440626.1_1 Forward -187 -168 10.0284 0.25
NP_440372.1_2 Forward -187 -180 16.3621 0.0124
NP_440372.1_2 Reverse -180 -187 16.3621 0.0124
NP_440819.1_5 Reverse -343 -351 7.8859 0.266
NP_440819.1_5 Reverse -136 -144 7.68924 0.266
NP_440139.1_1 Reverse -173 -192 1.37531 0.263
NP_441572.1_7 Forward -194 -175 -5.60541 0.265
NP_442384.1_10 Forward -188 -175 16.7355 0.00732
NP_442384.1_10 Reverse -179 -192 6.50913 0.0995
NP_441877.1_9 Reverse -312 -329 2.59545 0.285
NP_441018.1_7 Forward -134 -115 8.65258 0.241
NP_441018.1_7 Reverse -275 -294 6.39097 0.289
NP_442262.1_10 Forward -187 -180 14.1988 0.0123
NP_442262.1_10 Reverse -180 -187 14.1988 0.0123
NP_441689.1_5 Reverse -177 -187 5.78111 0.197
NP_440344.1_10 Forward -195 -178 19.8034 0.00187
NP_440344.1_10 Reverse -172 -189 -1.92778 0.0588
NP_440531.1_6 Forward -196 -177 -0.000545616 0.2
NP_442910.1_1 Reverse -172 -191 2.26107 0.118
NP_442910.1_1 Forward -195 -176 -8.55534 0.299
NP_440562.1_1 Reverse -183 -202 11.11 0.276
NP_441965.1_3 Reverse -169 -188 0.294447 0.238
NP_441965.1_10 Reverse -176 -192 4.0901 0.249
NP_440297.1_9 Forward -187 -177 -0.118297 0.282
NP_440297.1_9 Reverse -180 -190 -0.118297 0.282
NP_440350.1_5 Reverse -247 -266 4.62101 0.158
NP_441592.1_4 Forward -188 -169 -3.14714 0.275
NP_440894.1_4 Forward -28 -9 2.94938 0.219
NP_440999.1_9 Forward -192 -178 11.0127 0.0482
NP_440888.1_2 Forward -188 -174 9.93039 0.11
NP_440888.1_2 Reverse -179 -193 6.78381 0.22
NP_442277.1_7 Forward -179 -163 -1.90304 0.286
NP_442033.1_10 Forward -281 -262 -9.047 0.211
NP_441543.1_2 Reverse -180 -189 18.486 0.00236
NP_441543.1_2 Forward -187 -178 16.9127 0.00359
NP_442845.1_2 Reverse -173 -187 12.7826 0.104
NP_441178.1_5 Forward -385 -366 14.9458 0.152
NP_441469.1_8 Forward -189 -180 16.126 0.00797
NP_441469.1_8 Reverse -178 -187 6.48957 0.227
NP_443064.1_6 Forward -188 -178 12.5669 0.0796
NP_442578.1_7 Forward -187 -180 14.5921 0.026
NP_442578.1_7 Reverse -180 -187 14.5921 0.026
NP_441462.1_2 Forward -188 -178 11.5831 0.00406
NP_441462.1_2 Reverse -179 -189 11.5831 0.00406
NP_443062.1_1 Reverse -179 -197 14.7864 0.0439
NP_443062.1_1 Forward -188 -170 10.2035 0.121
NP_443062.1_6 Forward -196 -177 2.94938 0.247
NP_443062.1_6 Reverse -271 -290 1.86774 0.266
NP_443062.1_6 Reverse -171 -190 1.57275 0.272
NP_442204.1_5 Forward -198 -179 5.40766 0.156
NP_440516.1_2 Forward -194 -176 12.5072 0.0667
NP_440516.1_8 Forward -188 -179 16.9127 0.00442
NP_440516.1_8 Reverse -179 -188 16.9127 0.00442
NP_442846.1_4 Reverse -311 -330 19.6656 0.0718
NP_442428.1_5 Forward -187 -180 15.8704 0.0124
NP_442428.1_5 Reverse -180 -187 15.8704 0.0124
NP_440618.1_1 Reverse -340 -359 38.9385 0.000000421
NP_440618.1_2 Reverse -251 -267 30.1478 0.000265
NP_440618.1_3 Reverse -281 -300 28.9088 0.000162
NP_440673.1_3 Forward -186 -179 12.4288 0.0426
NP_440673.1_3 Reverse -181 -188 12.4288 0.0426
NP_441052.1_2 Forward -188 -178 19.9412 0.00106
NP_441052.1_2 Reverse -179 -189 10.5014 0.0285
NP_442219.1_9 Forward -187 -178 17.7976 0.00718
NP_442219.1_9 Reverse -180 -189 8.35786 0.0681
NP_442219.1_9 Reverse -26 -35 2.65466 0.241
NP_440436.1_4 Reverse -180 -189 18.1905 0.00233
NP_440436.1_4 Forward -187 -178 17.2072 0.00233
NP_440436.1_4 Forward -287 -278 6.78414 0.147
NP_441884.1_9 Forward -191 -172 -24.0916 0.284
NP_440314.1_9 Forward -112 -93 6.68596 0.056
NP_441719.1_4 Forward -187 -180 16.3621 0.0124
NP_441719.1_4 Reverse -180 -187 16.3621 0.0124
NP_441733.1_10 Reverse -176 -189 7.09911 0.156
NP_442366.1_3 Reverse -178 -196 0.314141 0.173
NP_442366.1_3 Forward -189 -171 -0.7675 0.199
NP_442366.1_5 Reverse -176 -186 15.4175 0.0374
NP_442366.1_5 Forward -191 -181 12.7626 0.108
NP_440129.1_10 Forward -362 -348 2.65453 0.247
NP_442873.1_3 Forward -289 -270 4.03023 0.274
NP_442694.1_4 Forward -356 -347 13.5694 0.225
NP_442206.1_1 Forward -288 -269 -11.6036 0.22
NP_443054.1_2 Reverse -177 -191 11.2093 0.0761
NP_440864.1_9 Reverse -262 -281 2.16274 0.139
NP_441851.1_10 Forward -189 -179 16.008 0.00552
NP_441851.1_10 Reverse -178 -188 15.8113 0.00552
NP_441851.1_10 Reverse -278 -288 6.17489 0.182
NP_441668.1_4 Reverse -169 -188 5.80098 0.164
NP_441668.1_4 Reverse -269 -288 0.491109 0.237
NP_441668.1_5 Forward -91 -72 7.47261 0.268
NP_442515.1_1 Reverse -50 -64 0.786239 0.18
NP_442515.1_1 Reverse -178 -192 -2.65535 0.277
NP_442515.1_1 Forward -189 -175 -4.4253 0.298
NP_440593.1_3 Forward -305 -286 -4.13045 0.245
NP_441982.1_6 Reverse -135 -144 12.1989 0.288
NP_441046.1_2 Reverse -359 -378 1.57275 0.256
NP_441349.1_10 Reverse -169 -188 11.7008 0.0223
NP_441349.1_10 Forward -198 -179 -1.7705 0.108
NP_442843.1_1 Reverse -271 -290 -1.7705 0.202
NP_440474.1_8 Reverse -180 -194 6.19383 0.23
NP_441124.1_5 Reverse -163 -173 10.5254 0.286
NP_442450.1_5 Reverse -177 -187 7.55152 0.13
NP_442450.1_5 Forward -190 -180 7.55152 0.13
NP_440588.1_2 Reverse -170 -189 14.5524 0.0157
NP_440588.1_2 Forward -197 -178 5.11266 0.0712
NP_441031.1_1 Forward -325 -306 5.56945 0.282
NP_439950.1_1 Forward -228 -219 12.2911 0.287
NP_441570.1_1 Forward -188 -170 -14.8288 0.227
NP_441570.1_1 Reverse -240 -258 -16.2055 0.24
NP_441078.1_4 Forward -188 -179 19.6659 0.0007
NP_441078.1_4 Reverse -179 -188 19.6659 0.0007
NP_441078.1_4 Reverse -104 -113 -1.37691 0.254
NP_442729.1_4 Forward -279 -260 16.7149 0.174
NP_442443.1_1 Reverse -287 -306 -5.50708 0.282
NP_442443.1_4 Forward -332 -322 13.7459 0.229
NP_440526.1_3 Reverse -180 -191 2.02482 0.267
NP_440526.1_3 Forward -187 -176 1.04151 0.267
NP_441432.1_8 Reverse -178 -187 16.8143 0.00595
NP_441432.1_8 Forward -189 -180 8.25953 0.0755
NP_441432.1_8 Reverse -103 -112 5.80125 0.137
NP_441432.1_9 Forward -153 -140 8.59837 0.287
NP_442320.1_8 Reverse -173 -187 4.71948 0.0472
NP_442320.1_8 Forward -194 -180 -1.08205 0.0817
NP_442344.1_7 Reverse -180 -199 -7.96535 0.198
NP_441732.1_2 Forward -192 -176 -16.5594 0.174
NP_440760.1_1 Forward -188 -169 -4.42544 0.0432
NP_440760.1_1 Reverse -179 -198 -12.1936 0.0915
NP_441945.1_10 Reverse -1 -20 8.25926 0.273
NP_442298.1_4 Reverse -314 -328 19.2055 0.271
NP_442353.1_4 Forward -194 -175 4.03023 0.206
NP_442489.1_2 Forward -199 -180 4.42435 0.22
NP_442489.1_7 Forward -188 -179 20.1576 0.000695
NP_442489.1_7 Reverse -179 -188 20.1576 0.000695
NP_441830.1_2 Reverse -280 -299 -5.31042 0.281
NP_441706.1_10 Reverse -176 -195 17.3057 0.0838
NP_440559.1_1 Forward -187 -178 17.4043 0.00658
NP_440559.1_1 Reverse -180 -189 8.75118 0.0586
NP_441659.2_8 Forward -188 -178 18.1713 0.00133
NP_441659.2_8 Reverse -179 -189 11.9764 0.0147
NP_441022.1_1 Forward -327 -318 12.6973 0.232
NP_442913.1_10 Forward -197 -178 -3.14714 0.201
NP_442849.1_1 Reverse -135 -149 7.66941 0.284
NP_440779.1_5 Forward -77 -60 -14.8091 0.274
NP_442346.1_5 Reverse -178 -188 16.6963 0.00248
NP_442346.1_5 Forward -189 -179 9.02648 0.118
NP_442346.1_5 Reverse -278 -288 4.3066 0.291
NP_442346.1_5 Reverse -6 -16 4.20827 0.296
NP_440545.1_3 Forward -117 -100 -1.92778 0.177
NP_440545.1_3 Reverse -342 -359 -4.18939 0.22
NP_440545.1_3 Reverse -175 -192 -4.97604 0.237
NP_441786.1_10 Reverse -170 -189 9.73422 0.211
NP_441585.1_5 Forward -26 -7 0.981987 0.291
NP_441833.1_4 Forward -187 -180 15.9687 0.0124
NP_441833.1_4 Reverse -180 -187 15.9687 0.0124
NP_442162.1_9 Forward -187 -180 16.2637 0.0124
NP_442162.1_9 Reverse -180 -187 16.2637 0.0124
NP_442140.1_3 Reverse -180 -190 16.2046 0.0255
NP_442140.1_3 Forward -187 -177 12.2714 0.0632
NP_440875.1_9 Reverse -181 -191 8.46937 0.233
NP_441813.1_5 Forward -190 -180 9.91146 0.021
NP_441813.1_5 Reverse -177 -187 8.63316 0.0367
NP_440590.1_4 Reverse -180 -193 12.114 0.016
NP_440590.1_4 Forward -187 -174 0.707601 0.144
NP_440567.1_1 Forward -187 -173 14.6509 0.0187
NP_440567.1_1 Reverse -180 -194 7.47274 0.0707
NP_442497.1_10 Forward -187 -178 10.4228 0.0087
NP_442497.1_10 Reverse -180 -189 10.4228 0.0087
NP_440821.1_4 Forward -190 -180 10.2065 0.0163
NP_440821.1_4 Reverse -177 -187 9.41981 0.0286
NP_441239.1_9 Forward -190 -178 12.3303 0.0477
NP_441239.1_9 Reverse -177 -189 5.93884 0.202
NP_441239.1_9 Reverse -277 -289 2.98891 0.3
NP_440833.1_6 Forward -18 -4 9.34041 0.264
NP_440949.1_7 Reverse -52 -71 9.63507 0.26
NP_442809.1_1 Reverse -8 -27 10.3234 0.295
NP_440546.1_4 Reverse -179 -189 11.8882 0.0679
NP_440546.1_4 Forward -188 -178 10.046 0.109
NP_440462.1_6 Forward -190 -180 9.02648 0.0498
NP_440462.1_6 Forward -133 -123 1.74999 0.294
NP_440462.1_6 Reverse -177 -187 1.35667 0.294
NP_440868.1_4 Forward -192 -180 10.7571 0.0364
NP_440868.1_4 Reverse -175 -187 6.1355 0.0878
NP_442479.1_9 Reverse -8 -27 -10.4236 0.268
NP_442402.1_4 Reverse -85 -104 -9.9327 0.295
NP_442039.1_4 Forward -187 -180 15.1821 0.0124
NP_442039.1_4 Reverse -180 -187 15.1821 0.0124
NP_440825.1_7 Forward -187 -177 12.9096 0.152
NP_440825.1_7 Reverse -180 -190 12.4217 0.155
NP_442837.1_3 Forward -187 -180 15.7721 0.0124
NP_442837.1_3 Reverse -180 -187 15.7721 0.0124
NP_442053.1_1 Forward -188 -179 18.3876 0.0007
NP_442053.1_1 Reverse -179 -188 18.3876 0.0007
NP_440505.1_3 Reverse -177 -187 9.22315 0.122
NP_440505.1_3 Forward -190 -180 6.76487 0.169
NP_441102.1_2 Reverse -234 -253 5.11266 0.298
NP_442456.1_5 Reverse -56 -74 5.23069 0.298
NP_440914.1_1 Forward -188 -178 17.5935 0.000537
NP_440914.1_1 Reverse -179 -189 8.6151 0.186
NP_441011.1_8 Reverse -180 -189 16.9127 0.00602
NP_441011.1_8 Forward -187 -178 8.25953 0.144
NP_442533.1_6 Forward -188 -179 17.2076 0.00137
NP_442533.1_6 Reverse -179 -188 17.2076 0.00137
NP_442322.1_4 Reverse -118 -135 -5.37003 0.266
NP_442229.1_1 Reverse -177 -191 17.7968 0.0734
NP_443016.1_1 Reverse -173 -192 -2.65548 0.225
NP_441482.1_7 Reverse -98 -112 -6.98191 0.193
NP_439944.1_9 Forward -187 -177 10.5014 0.0887
NP_441697.1_5 Reverse -158 -177 -1.09858 0.204
NP_441028.1_6 Forward -144 -134 14.0409 0.158
NP_441028.1_6 Reverse -84 -94 4.89613 0.275
NP_442664.1_3 Reverse -226 -240 12.1926 0.246
NP_440116.1_5 Forward -116 -99 3.38209 0.233
NP_440116.1_5 Forward -191 -174 2.59545 0.262
NP_441527.1_4 Reverse -192 -211 -12.9396 0.296
NP_439965.1_1 Reverse -170 -189 -4.03212 0.182
NP_441170.1_4 Reverse -170 -188 4.44404 0.246
NP_441972.1_5 Forward -187 -168 -8.06369 0.258
NP_441106.1_1 Forward -189 -180 18.191 0.0028
NP_441106.1_1 Reverse -178 -187 9.63616 0.0311
NP_441825.1_4 Forward -357 -347 11.8781 0.252
NP_001035870.1_3 Reverse -168 -187 -2.75381 0.26
NP_442306.1_3 Forward -333 -314 14.2574 0.192
NP_442306.1_10 Forward -292 -273 -21.0434 0.242
NP_441286.1_1 Reverse -178 -190 6.03717 0.0258
NP_441286.1_1 Forward -189 -177 3.38223 0.0467
NP_440670.1_8 Forward -188 -179 18.3876 0.000699
NP_440670.1_8 Reverse -179 -188 18.3876 0.000699
NP_440103.1_3 Forward -196 -186 16.5462 0.286
NP_440886.1_7 Forward -189 -179 17.7774 0.0011
NP_440886.1_7 Reverse -178 -188 7.94438 0.0805
NP_440886.1_7 Forward -280 -270 5.87944 0.158
NP_442614.1_2 Reverse -179 -193 6.19444 0.291
NP_439995.1_5 Forward -198 -179 4.81767 0.283
NP_440404.1_9 Reverse -136 -155 9.11906 0.239
NP_440907.2_8 Reverse -180 -190 14.2375 0.0312
NP_440907.2_8 Forward -187 -177 7.64939 0.117
NP_441021.1_8 Reverse -174 -192 2.87075 0.238
NP_440841.1_4 Forward -190 -171 -7.08038 0.22
NP_441463.1_2 Reverse -309 -327 9.50109 0.138
NP_441463.1_3 Reverse -169 -188 -0.885524 0.134
NP_441626.1_2 Forward -187 -180 15.7721 0.0124
NP_441626.1_2 Reverse -180 -187 15.7721 0.0124
NP_442794.1_1 Reverse -175 -187 9.38042 0.0795
NP_442794.1_1 Reverse -100 -112 3.87389 0.283
NP_442615.1_1 Forward -197 -179 12.7038 0.0129
NP_442615.1_1 Reverse -170 -188 8.7706 0.0275
NP_441962.1_4 Reverse -174 -193 -11.1119 0.238
NP_440387.1_1 Forward -188 -172 7.04003 0.0282
NP_441431.1_2 Forward -191 -177 14.7486 0.0588
NP_441431.1_2 Forward -291 -277 6.78381 0.261
NP_441993.1_1 Reverse -272 -291 5.06532 0.208
NP_440814.1_4 Forward -197 -178 -10.227 0.222
NP_440114.1_10 Reverse -179 -193 12.9793 0.0681
NP_440114.1_10 Reverse -279 -293 8.16106 0.213
NP_440492.1_9 Forward -329 -315 12.0028 0.294
NP_442324.1_1 Forward -148 -129 15.7324 0.236
NP_442833.1_1 Forward -154 -140 20.0649 0.0451
NP_440293.1_3 Reverse -271 -290 2.85105 0.192
NP_440766.1_5 Forward -332 -320 7.94227 0.288
NP_441237.1_9 Forward -187 -177 14.828 0.0242
NP_441237.1_9 Forward -130 -120 11.1898 0.196
NP_442743.1_5 Reverse -174 -193 3.73603 0.247
NP_439910.1_2 Forward -196 -179 -12.5475 0.0894
NP_440457.1_1 Reverse -175 -187 0.825626 0.25
NP_441332.1_6 Forward -280 -270 10.9691 0.278
NP_442509.1_9 Reverse -179 -189 16.2041 0.00739
NP_442509.1_9 Forward -188 -178 8.14104 0.192
NP_441253.1_8 Forward -94 -80 10.8611 0.281
NP_440524.1_2 Reverse -181 -200 -1.27885 0.27
NP_440554.1_4 Reverse -180 -190 7.35486 0.103
NP_441885.1_5 Forward -188 -178 20.9245 0.000538
NP_441885.1_5 Reverse -179 -189 11.4848 0.00668
NP_441885.1_5 Reverse -104 -114 0.766681 0.123
NP_440478.1_10 Forward -190 -176 8.75105 0.257
NP_442341.1_7 Reverse -178 -192 16.0275 0.0189
NP_442341.1_7 Forward -189 -175 7.66941 0.0994
NP_442341.1_9 Forward -190 -176 8.65209 0.166
NP_441756.1_5 Forward -346 -327 -2.0655 0.267
NP_442395.2_4 Forward -189 -170 14.0599 0.0559
NP_443000.1_7 Reverse -177 -187 10.3048 0.0345
NP_443000.1_7 Forward -190 -180 1.94665 0.226
NP_443000.1_7 Reverse -102 -112 0.963343 0.278
NP_441842.1_10 Reverse -172 -186 11.0127 0.145
NP_441842.1_10 Forward -195 -181 7.07942 0.267
NP_440275.1_3 Forward -190 -180 8.33817 0.0602
NP_440275.1_3 Reverse -177 -187 8.04317 0.0602
NP_440091.1_1 Forward -192 -180 3.18557 0.166
NP_440091.1_1 Reverse -175 -187 1.41561 0.197
NP_441902.1_3 Reverse -135 -145 12.9817 0.23
NP_440679.1_5 Forward -108 -89 5.40766 0.292
NP_441122.1_1 Reverse -175 -190 4.69978 0.28
NP_441122.1_1 Reverse -3 -18 4.69978 0.28
NP_441105.1_3 Reverse -168 -187 -0.197208 0.132
NP_441105.1_3 Forward -199 -180 -8.65367 0.275
NP_440216.1_1 Reverse -179 -193 -1.37704 0.0312
NP_440216.1_1 Forward -188 -174 -1.47537 0.0328
NP_440172.1_1 Forward -188 -178 15.0247 0.00945
NP_440172.1_1 Reverse -179 -189 8.73149 0.0586
NP_442015.1_10 Forward -192 -179 1.78924 0.204
NP_442015.1_10 Reverse -175 -188 1.49425 0.204
NP_441226.1_7 Forward -187 -180 14.4934 0.0123
NP_441226.1_7 Reverse -180 -187 14.4934 0.0123
NP_441111.1_7 Forward -187 -179 18.7023 0.00294
NP_441111.1_7 Reverse -180 -188 18.7023 0.00294
NP_441766.1_2 Forward -188 -179 17.5026 0.00297
NP_441766.1_2 Reverse -179 -188 17.5026 0.00297
NP_441766.1_2 Forward -113 -104 2.65466 0.254
NP_440416.1_9 Forward -295 -276 -7.27704 0.0988
NP_440416.1_9 Reverse -172 -191 -18.9784 0.267
NP_441974.1_4 Forward -288 -269 14.0599 0.273
NP_442154.1_1 Reverse -271 -289 -16.4021 0.239
NP_440261.1_5 Reverse -180 -193 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTTATTAATGACAACACCTAAGCACTGGTCATTAAAGTCTCCCGGGCTTTTGTCCCGCCGTGTAGCTAGTGGCAAAAATCTTTACAAAGCCTAGCCTGTTTCTCTCGGACCAGCCATTCCCCACATCACCAGGAATCGGAACCCTAGAAACAATATCCCCTACCCTAGCTAGGGATGATTAAGTTAACTGTGTTCTGTGCTACTTTTTATCGGCGATCGCCAAACTAAAGTTTAAAACCTGACATCAATTAGCTTTTTTTCCCTATCCAGGGATTGAGCATAGCTTTGCGATATCCTGAGTATGCACATGGGAAAAGGTCACAGGTCTCGCACCATTGGTGTGATTACTAATTGATCTAACTATTCAGGAACGCAACTCAATCAACAATTGCCCAGCCA

CDS

ATGCAACAAGCGGCCATCCCAGCCAATGAACAGCAGCGCTTAGCCCATCTACAGAATCTTAAAATTCTTGATACGCCAAGCGATGAAAAGTTCAACCGCATTACTAGGCTATTATGTCGGGTGCTGGATATGCCCGTAGCTGCCATTTCTTTGGTTGATGAAAATCGTCAATGGTTTAAATCCATTCGGGGCTTAGACTTAACCGAAACTCCCCGCTGTGTCTCCTTCTGCGCCCATACAATTCTGGAGGACCGCACCCTAGTTATTTCCGATACCCTATCTGACCTCCGTTTTGCCGACAATCCCCTTGTCCTCGAGGCCCCCCACGTCCGATTTTATGCTGGTCACCCCCTGAAAATACTCGATAATATCCATGTGGGCACTCTCTGTGTTTATGACACTAAGCCCAGGGAAATATCCGACGACGATGTTCAGTTTTTAGAAGACCTTGCAATCACCGTGGCTAATGAGCTAAAGGCTCACATGTTCAAGAGATTTTTTACGGTTTAG

Protein

MQQAAIPANEQQRLAHLQNLKILDTPSDEKFNRITRLLCRVLDMPVAAISLVDENRQWFKSIRGLDLTETPRCVSFCAHTILEDRTLVISDTLSDLRFADNPLVLEAPHVRFYAGHPLKILDNIHVGTLCVYDTKPREISDDDVQFLEDLAITVANELKAHMFKRFFTV