Your browser is old and dusty. Try Google Chrome!

Details for slr1139

ORF slr1139
Accession NP_440611.1
Symbol trxA
Category Thioredoxin, glutaredoxin, and glutathione
Definition thioredoxin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -75 -89 -1.67204 0.269
NP_440795.1_7 Forward -275 -268 14.1988 0.0267
NP_440897.1_6 Reverse -267 -286 1.6703 0.17
NP_440897.1_9 Forward -42 -24 18.6029 0.151
NP_441453.1_1 Reverse -260 -278 15.1613 0.0938
NP_441453.1_4 Forward -276 -268 6.80426 0.121
NP_442151.1_6 Reverse -267 -281 8.25939 0.178
NP_441342.1_2 Forward -345 -331 10.226 0.209
NP_441098.1_3 Forward -184 -165 -6.78896 0.285
NP_442655.1_10 Forward -233 -214 -10.817 0.221
NP_442173.1_1 Reverse -259 -267 6.3126 0.191
NP_442173.1_1 Reverse -268 -276 5.72262 0.203
NP_442752.1_4 Forward -276 -269 4.26735 0.293
NP_443027.1_4 Forward -278 -268 10.1081 0.144
NP_439997.1_4 Reverse -349 -368 14.3558 0.121
NP_441812.1_3 Forward -277 -263 10.1277 0.228
NP_442975.1_10 Reverse -263 -277 8.75042 0.0875
NP_440784.1_7 Reverse -268 -275 13.2155 0.0365
NP_440784.1_7 Forward -275 -268 12.1338 0.0604
NP_440784.1_7 Reverse -333 -340 7.21728 0.15
NP_441476.1_5 Reverse -262 -281 -7.96535 0.295
NP_441476.1_5 Forward -281 -262 -8.26035 0.3
NP_442242.1_4 Forward -275 -268 12.0355 0.0521
NP_442242.1_4 Reverse -268 -275 11.5438 0.089
NP_439918.1_2 Reverse -34 -53 -3.83545 0.262
NP_441925.1_4 Reverse -265 -284 -11.6043 0.252
NP_441402.1_9 Forward -266 -247 19.0748 0.178
NP_441083.1_5 Reverse -267 -277 9.41981 0.0267
NP_441083.1_5 Forward -276 -266 -0.904945 0.283
NP_442827.1_8 Reverse -259 -278 -1.47628 0.247
NP_440209.1_1 Forward -276 -268 8.37755 0.0576
NP_440209.1_1 Reverse -267 -275 5.32929 0.139
NP_442570.1_3 Reverse -230 -249 -6.68705 0.259
NP_442462.1_2 Forward -235 -216 2.85105 0.275
NP_440906.1_5 Reverse -268 -275 13.3138 0.0268
NP_440906.1_5 Forward -275 -268 6.13563 0.241
NP_440012.1_2 Forward -226 -207 12.0942 0.197
NP_440747.1_10 Forward -279 -267 -2.71429 0.0639
NP_441847.1_4 Forward -84 -65 12.3892 0.257
NP_441130.1_10 Reverse -265 -279 8.75105 0.133
NP_441854.1_10 Reverse -265 -284 1.67108 0.282
NP_440842.1_10 Reverse -126 -140 10.816 0.251
NP_440842.1_10 Forward -139 -125 2.65453 0.274
NP_441014.1_8 Forward -272 -253 -2.45882 0.232
NP_442848.1_9 Forward -282 -263 0.294447 0.275
NP_443018.1_3 Forward -275 -268 5.15232 0.226
NP_443018.1_3 Reverse -268 -275 5.05399 0.238
NP_441634.1_8 Forward -278 -264 6.78443 0.114
NP_440376.1_1 Forward -138 -129 2.26134 0.228
NP_440376.1_1 Forward -276 -267 -0.000272808 0.285
NP_440376.1_1 Reverse -267 -276 -0.000272808 0.285
NP_442687.1_7 Reverse -266 -276 12.0747 0.0862
NP_442687.1_7 Reverse -321 -331 6.46988 0.165
NP_442589.1_3 Reverse -245 -264 17.243 0.214
NP_442485.1_3 Forward -278 -259 -3.04881 0.272
NP_442485.1_3 Reverse -262 -281 -3.3438 0.273
NP_441029.1_4 Forward -263 -244 1.37609 0.274
NP_440533.1_9 Reverse -267 -286 3.53937 0.248
NP_442658.1_1 Reverse -265 -275 6.76441 0.214
NP_442782.1_2 Forward -150 -136 0.0979218 0.296
NP_441414.1_9 Forward -276 -257 -3.73712 0.141
NP_441414.1_9 Reverse -267 -286 -8.06369 0.229
NP_442937.1_5 Forward -281 -262 16.4207 0.0429
NP_442937.1_5 Reverse -360 -379 6.09597 0.288
NP_441958.1_5 Forward -277 -267 -6.60814 0.283
NP_441127.1_1 Forward -383 -369 11.2093 0.232
NP_442057.1_5 Forward -173 -155 13.9347 0.229
NP_442836.1_10 Reverse -32 -42 14.4347 0.212
NP_439905.1_1 Forward -275 -262 6.21414 0.295
NP_442911.1_2 Reverse -257 -276 -10.1286 0.27
NP_442064.1_4 Forward -72 -53 11.7 0.174
NP_443055.1_6 Reverse -250 -268 1.78836 0.224
NP_441099.1_5 Reverse -257 -276 -11.1119 0.271
NP_441099.1_5 Forward -286 -267 -11.9969 0.294
NP_442002.1_9 Forward -131 -124 12.2322 0.185
NP_442567.1_3 Forward -360 -344 12.6449 0.255
NP_441646.1_1 Forward -84 -65 9.63589 0.125
NP_442438.1_10 Reverse -259 -273 0.491246 0.225
NP_440147.1_4 Forward -278 -265 4.44418 0.16
NP_440147.1_4 Forward -261 -248 3.06754 0.196
NP_441550.1_8 Forward -278 -268 10.0093 0.0785
NP_441916.1_10 Reverse -61 -80 10.8159 0.141
NP_441916.1_10 Reverse -308 -327 0.786102 0.275
NP_442004.1_6 Reverse -68 -82 2.06454 0.274
NP_441725.1_4 Forward -281 -267 3.8339 0.278
NP_439966.1_7 Reverse -265 -275 8.3377 0.14
NP_439966.1_7 Forward -278 -268 5.78111 0.209
NP_439966.1_9 Reverse -265 -274 10.0295 0.154
NP_442941.1_3 Reverse -268 -278 9.7148 0.0286
NP_440289.1_2 Reverse -264 -277 0.117615 0.175
NP_440983.1_5 Forward -279 -260 -8.94866 0.298
NP_441678.1_9 Forward -150 -131 1.27776 0.223
NP_442575.1_8 Reverse -46 -65 -2.55715 0.242
NP_441644.1_6 Reverse -108 -118 7.25606 0.132
NP_441644.1_6 Reverse -267 -277 4.89613 0.22
NP_441644.1_6 Forward -276 -266 3.12618 0.297
NP_443049.1_6 Forward -277 -267 13.0072 0.214
NP_440867.1_10 Forward -146 -127 1.27776 0.298
NP_442247.1_8 Forward -278 -264 10.3243 0.247
NP_442933.1_2 Reverse -162 -180 9.16921 0.257
NP_442933.1_10 Reverse -267 -276 5.3096 0.203
NP_442554.1_8 Reverse -268 -278 6.66654 0.111
NP_441762.1_7 Forward -277 -265 4.75886 0.0453
NP_442292.1_1 Reverse -268 -277 9.04618 0.0226
NP_442476.1_6 Reverse -268 -282 1.27789 0.223
NP_442381.1_8 Reverse -247 -266 -14.4552 0.28
NP_442381.1_8 Reverse -264 -283 -14.7502 0.284
NP_441715.1_4 Reverse -268 -278 8.1415 0.107
NP_441198.1_8 Reverse -67 -77 10.9275 0.232
NP_441468.1_1 Reverse -268 -275 6.3323 0.202
NP_441468.1_1 Forward -275 -268 6.13563 0.209
NP_441673.1_1 Forward -276 -267 1.37636 0.114
NP_441673.1_1 Reverse -267 -276 1.1797 0.163
NP_441731.1_3 Forward -267 -248 -0.295539 0.283
NP_442253.1_5 Reverse -65 -82 -2.22277 0.282
NP_442253.1_5 Forward -81 -64 -6.54933 0.298
NP_441876.1_9 Reverse -370 -380 13.5492 0.267
NP_442490.1_9 Reverse -255 -274 1.67108 0.165
NP_442868.1_6 Forward -278 -268 9.7148 0.0411
NP_442719.1_2 Reverse -122 -140 -9.02799 0.259
NP_442808.1_1 Reverse -266 -276 9.22267 0.0481
NP_442808.1_1 Reverse -321 -331 6.37109 0.116
NP_442808.1_1 Forward -43 -33 1.35624 0.287
NP_441315.1_2 Forward -277 -259 17.0172 0.213
NP_440145.1_3 Reverse -58 -77 3.04771 0.11
NP_442820.1_4 Forward -202 -185 12.1336 0.265
NP_442542.1_2 Reverse -256 -269 6.01747 0.239
NP_442542.1_2 Reverse -265 -278 5.82081 0.247
NP_442050.1_1 Reverse -243 -262 16.0274 0.172
NP_442050.1_1 Forward -231 -212 10.4225 0.243
NP_442050.1_1 Reverse -230 -249 6.88262 0.281
NP_441114.1_3 Forward -60 -51 17.1093 0.113
NP_442789.1_4 Forward -278 -259 -3.14714 0.246
NP_441878.1_6 Reverse -52 -62 -7.39479 0.222
NP_441878.1_6 Reverse -249 -259 -7.49312 0.231
NP_441036.1_8 Reverse -266 -276 6.56821 0.225
NP_441557.1_5 Forward -276 -267 1.08137 0.0794
NP_441557.1_5 Reverse -267 -276 0.589713 0.134
NP_442356.1_2 Reverse -163 -182 16.8083 0.11
NP_442066.2_9 Reverse -263 -276 8.57408 0.185
NP_442066.2_9 Forward -280 -267 6.90245 0.259
NP_442419.1_2 Forward -281 -262 5.40766 0.17
NP_440101.1_3 Reverse -262 -281 10.3242 0.123
NP_442183.1_1 Forward -276 -262 10.521 0.0829
NP_440440.1_5 Reverse -251 -270 11.1109 0.198
NP_441574.1_7 Forward -232 -213 18.9773 0.206
NP_442347.1_2 Reverse -268 -277 14.7494 0.056
NP_442645.1_2 Reverse -60 -79 -5.01543 0.0636
NP_442645.1_2 Reverse -139 -158 -22.8133 0.296
NP_440151.1_2 Forward -78 -60 13.9813 0.277
NP_442317.1_6 Forward -264 -245 4.03102 0.251
NP_441633.1_3 Forward -278 -265 8.57408 0.0377
NP_440136.1_2 Reverse -268 -275 6.43063 0.154
NP_440136.1_2 Forward -275 -268 6.23397 0.171
NP_442998.1_5 Forward -232 -222 7.45319 0.292
NP_442998.1_10 Reverse -269 -276 5.93897 0.206
NP_442998.1_10 Reverse -131 -138 4.07068 0.276
NP_440899.1_8 Forward -359 -340 -9.83364 0.269
NP_440299.1_1 Forward -280 -267 2.57534 0.284
NP_441799.1_1 Reverse -104 -118 4.03056 0.269
NP_441007.1_10 Reverse -262 -275 1.9859 0.202
NP_440087.1_1 Forward -276 -257 -6.29373 0.252
NP_440915.1_6 Forward -280 -266 -0.787057 0.209
NP_442158.1_4 Forward -106 -96 12.6647 0.244
NP_441296.1_9 Forward -66 -53 11.9167 0.23
NP_441464.1_10 Reverse -29 -43 16.3225 0.164
NP_441464.1_10 Forward -201 -187 10.4227 0.259
NP_441939.1_3 Forward -330 -311 8.06259 0.184
NP_441494.1_6 Reverse -245 -258 10.4424 0.227
NP_442386.1_9 Reverse -266 -275 8.2591 0.205
NP_441750.1_1 Forward -389 -370 -9.93197 0.3
NP_441340.1_5 Forward -275 -268 5.93897 0.198
NP_441340.1_5 Reverse -268 -275 5.84064 0.208
NP_442484.1_2 Forward -287 -268 2.3594 0.226
NP_440168.1_9 Reverse -256 -275 6.39097 0.227
NP_440168.1_9 Reverse -248 -267 -4.03212 0.296
NP_440327.1_6 Reverse -41 -60 7.17762 0.228
NP_440327.1_6 Forward -322 -303 4.916 0.266
NP_440161.1_3 Forward -64 -45 9.0459 0.259
NP_440586.1_8 Forward -275 -268 11.1501 0.0845
NP_442251.1_6 Forward -275 -268 13.7071 0.0268
NP_440027.1_3 Reverse -69 -87 2.37835 0.29
NP_443051.1_1 Forward -277 -268 0.688044 0.134
NP_439937.1_8 Forward -278 -259 -2.65548 0.261
NP_439937.1_8 Forward -235 -216 -5.01543 0.286
NP_439937.1_9 Reverse -219 -236 4.56135 0.0798
NP_439937.1_9 Forward -260 -243 -10.2866 0.227
NP_440408.1_7 Reverse -52 -71 13.3725 0.19
NP_440372.1_2 Forward -275 -268 6.62729 0.151
NP_440372.1_2 Reverse -268 -275 6.52896 0.188
NP_441138.1_5 Forward -182 -169 10.1839 0.238
NP_440316.1_10 Forward -283 -273 8.4365 0.239
NP_439977.1_5 Reverse -261 -280 0.58944 0.207
NP_439977.1_7 Reverse -136 -155 10.815 0.268
NP_442368.1_3 Forward -223 -205 10.8356 0.3
NP_440267.1_2 Forward -264 -250 5.99717 0.248
NP_442384.1_10 Reverse -267 -280 11.1307 0.0383
NP_442384.1_10 Reverse -250 -263 0.412608 0.291
NP_442035.1_7 Reverse -39 -58 15.4978 0.287
NP_442114.1_8 Reverse -166 -180 9.93039 0.234
NP_441877.1_7 Forward -281 -262 3.44025 0.218
NP_442790.1_4 Reverse -258 -277 -11.6036 0.231
NP_442790.1_4 Forward -285 -266 -15.0452 0.284
NP_442790.1_4 Forward -276 -257 -15.5368 0.294
NP_440344.1_10 Reverse -260 -277 -9.10594 0.139
NP_440531.1_6 Forward -290 -271 -1.18052 0.229
NP_440531.1_8 Reverse -262 -281 3.24438 0.269
NP_441965.1_3 Forward -286 -267 -0.787193 0.271
NP_441965.1_10 Reverse -264 -280 2.51681 0.287
NP_440350.1_5 Forward -175 -156 -0.000545616 0.169
NP_442187.1_3 Forward -277 -267 14.6313 0.165
NP_441592.1_4 Reverse -267 -286 7.27595 0.124
NP_440894.1_2 Reverse -210 -229 -3.54046 0.296
NP_440999.1_9 Reverse -263 -277 13.0776 0.0332
NP_440999.1_9 Reverse -246 -260 -0.000409212 0.195
NP_440888.1_2 Reverse -267 -281 14.3553 0.0187
NP_440888.1_2 Reverse -374 -388 5.50552 0.276
NP_439969.1_3 Reverse -245 -264 4.42435 0.214
NP_442033.1_10 Reverse -265 -284 -4.72043 0.179
NP_442033.1_10 Forward -261 -242 -13.9635 0.294
NP_441543.1_2 Reverse -268 -277 7.07956 0.131
NP_441543.1_2 Forward -275 -266 5.89959 0.169
NP_441469.1_8 Reverse -266 -275 5.99792 0.241
NP_442578.1_7 Forward -275 -268 12.5271 0.0544
NP_440710.1_1 Forward -70 -52 -8.73231 0.278
NP_441462.1_2 Forward -267 -257 4.89658 0.0783
NP_441462.1_2 Forward -276 -266 -0.41329 0.225
NP_442204.1_5 Reverse -240 -259 5.70265 0.154
NP_442204.1_5 Reverse -257 -276 5.01433 0.16
NP_441351.1_8 Reverse -265 -284 1.67108 0.267
NP_440516.1_8 Forward -276 -267 9.24284 0.0264
NP_440516.1_8 Forward -267 -258 -0.295266 0.232
NP_440516.1_8 Forward -138 -129 -0.295266 0.232
NP_442428.1_5 Reverse -268 -275 13.1171 0.038
NP_442428.1_5 Forward -275 -268 6.23397 0.201
NP_441443.1_10 Forward -143 -125 0.116744 0.293
NP_442859.1_2 Forward -155 -136 9.3409 0.199
NP_440673.1_3 Reverse -269 -276 10.1672 0.149
NP_440673.1_3 Forward -60 -53 8.98723 0.203
NP_440673.1_3 Reverse -260 -267 7.02061 0.274
NP_441052.1_2 Reverse -267 -277 18.2696 0.00222
NP_442219.1_9 Reverse -268 -277 14.5527 0.0295
NP_442219.1_9 Forward -76 -67 2.85133 0.218
NP_440436.1_4 Reverse -268 -277 7.37413 0.132
NP_441719.1_4 Forward -275 -268 6.62729 0.151
NP_441719.1_4 Reverse -268 -275 6.52896 0.188
NP_441004.1_1 Reverse -34 -53 -12.8819 0.251
NP_441004.1_1 Reverse -261 -280 -13.4719 0.257
NP_441004.1_1 Reverse -244 -263 -17.3068 0.29
NP_441004.1_4 Reverse -50 -60 15.8113 0.154
NP_441004.1_5 Reverse -49 -63 8.35772 0.274
NP_442813.1_4 Forward -357 -338 -8.35868 0.299
NP_442813.1_5 Forward -82 -63 5.99764 0.213
NP_442312.1_1 Reverse -41 -60 11.0125 0.275
NP_442011.1_1 Forward -277 -258 -0.4922 0.268
NP_442856.1_6 Forward -46 -28 17.1279 0.173
NP_442515.1_1 Forward -277 -263 5.99778 0.103
NP_442843.1_1 Forward -116 -97 0.392778 0.17
NP_439960.1_10 Forward -283 -265 -3.42244 0.273
NP_440474.1_8 Forward -275 -261 11.4053 0.109
NP_440431.1_3 Reverse -345 -364 -5.60541 0.183
NP_440588.1_2 Forward -285 -266 11.7008 0.0311
NP_441078.1_4 Forward -276 -267 0.393051 0.205
NP_441078.1_4 Reverse -267 -276 -0.000272808 0.205
NP_440526.1_3 Forward -129 -118 5.85971 0.229
NP_440526.1_3 Reverse -75 -86 0.943182 0.267
NP_441432.1_8 Forward -277 -268 13.7661 0.0281
NP_441432.1_8 Forward -78 -69 5.40793 0.158
NP_441432.1_8 Forward -384 -375 2.55633 0.298
NP_441333.1_1 Forward -178 -168 13.3058 0.217
NP_442320.1_8 Forward -282 -268 5.99778 0.0309
NP_440760.1_1 Forward -276 -257 -14.0619 0.122
NP_440760.1_1 Reverse -267 -286 -14.6519 0.134
NP_442797.1_7 Reverse -266 -284 3.3624 0.234
NP_442489.1_7 Forward -276 -267 0.688044 0.152
NP_442489.1_7 Reverse -267 -276 0.491382 0.178
NP_440559.1_1 Reverse -268 -277 7.57121 0.106
NP_442763.1_10 Reverse -205 -224 0.0977854 0.299
NP_440426.1_7 Reverse -73 -92 -0.4922 0.297
NP_439956.1_7 Forward -224 -205 5.01433 0.257
NP_440118.1_2 Reverse -289 -308 -1.27885 0.278
NP_442346.1_5 Reverse -249 -259 7.84651 0.156
NP_442346.1_5 Forward -277 -267 4.89658 0.269
NP_440831.1_3 Forward -276 -257 11.7264 0.156
NP_440831.1_3 Reverse -258 -277 6.5813 0.271
NP_440010.1_4 Forward -280 -261 0.293673 0.25
NP_442603.1_7 Reverse -267 -281 8.45543 0.174
NP_441833.1_4 Reverse -268 -275 6.3323 0.134
NP_441833.1_4 Forward -275 -268 6.23397 0.163
NP_441329.1_6 Reverse -164 -183 1.57519 0.233
NP_442162.1_9 Forward -275 -268 6.52896 0.178
NP_442162.1_9 Reverse -268 -275 6.43063 0.208
NP_442073.1_6 Reverse -258 -277 -0.787193 0.269
NP_442140.1_3 Forward -275 -265 9.51814 0.107
NP_441813.1_5 Forward -278 -268 8.4365 0.0432
NP_441813.1_5 Reverse -265 -275 0.176696 0.215
NP_440590.1_4 Reverse -268 -281 10.1474 0.0303
NP_440567.1_1 Forward -275 -261 7.86607 0.0642
NP_442497.1_10 Reverse -268 -277 0.589713 0.153
NP_440821.1_4 Reverse -265 -275 6.76487 0.0816
NP_440821.1_4 Forward -278 -268 -0.314959 0.251
NP_441239.1_9 Reverse -265 -277 6.1355 0.2
NP_441239.1_9 Reverse -248 -260 4.46387 0.253
NP_441009.1_10 Reverse -268 -287 18.0915 0.135
NP_442568.1_7 Forward -22 -3 19.764 0.243
NP_440665.1_2 Forward -139 -120 -6.98204 0.294
NP_442193.1_8 Forward -86 -67 13.7649 0.211
NP_441230.1_5 Reverse -253 -272 0.0977854 0.275
NP_440675.1_1 Reverse -255 -274 1.76941 0.285
NP_440462.1_6 Reverse -265 -275 7.55152 0.0741
NP_442340.1_3 Reverse -312 -331 -9.047 0.269
NP_440868.1_4 Reverse -263 -275 3.38223 0.136
NP_441811.1_4 Forward -278 -259 4.03102 0.256
NP_441811.1_8 Reverse -261 -275 8.16106 0.238
NP_442837.1_3 Reverse -268 -275 13.5105 0.0268
NP_442837.1_3 Forward -275 -268 6.13563 0.25
NP_442053.1_1 Forward -276 -267 7.96454 0.0863
NP_442053.1_1 Reverse -267 -276 6.48957 0.13
NP_440505.1_3 Forward -278 -268 8.73149 0.135
NP_441959.1_5 Reverse -117 -136 6.58763 0.26
NP_441252.1_6 Reverse -50 -57 14.3954 0.168
NP_442532.1_7 Forward -276 -262 14.2576 0.0644
NP_441153.1_4 Forward -108 -89 6.09597 0.105
NP_440914.1_1 Reverse -69 -79 7.44401 0.237
NP_440914.1_1 Forward -41 -31 6.17532 0.293
NP_441011.1_8 Forward -116 -107 8.06287 0.16
NP_441011.1_8 Forward -275 -266 5.70292 0.237
NP_441011.1_8 Reverse -268 -277 5.50626 0.256
NP_442533.1_6 Forward -276 -267 5.3096 0.145
NP_442533.1_6 Forward -259 -250 3.63797 0.206
NP_441482.1_7 Forward -282 -268 -2.85201 0.1
NP_442202.1_6 Reverse -347 -366 1.67108 0.265
NP_441527.1_4 Reverse -164 -183 -4.91826 0.191
NP_441527.1_4 Reverse -161 -180 -9.1199 0.255
NP_441527.1_4 Reverse -168 -187 -12.7486 0.293
NP_441602.1_3 Forward -281 -262 -1.18052 0.226
NP_441825.1_4 Reverse -31 -41 16.303 0.186
NP_441286.1_1 Forward -277 -265 4.07055 0.0373
NP_440886.1_7 Reverse -266 -276 7.94438 0.0805
NP_440886.1_7 Forward -277 -267 6.0761 0.147
NP_440886.1_7 Forward -268 -258 3.32285 0.287
NP_441001.1_10 Reverse -257 -276 4.03102 0.295
NP_442072.1_9 Forward -200 -182 -23.482 0.297
NP_439967.1_3 Reverse -149 -167 16.0115 0.271
NP_441021.1_1 Forward -258 -239 -4.72043 0.172
NP_441021.1_1 Reverse -268 -287 -9.53865 0.217
NP_441463.1_2 Forward -182 -164 -1.07099 0.293
NP_441463.1_3 Forward -72 -53 -7.37537 0.257
NP_441463.1_3 Reverse -257 -276 -10.3253 0.293
NP_441626.1_2 Forward -275 -268 6.0373 0.212
NP_441626.1_2 Reverse -268 -275 5.93897 0.231
NP_442365.1_5 Forward -266 -247 8.65258 0.215
NP_442794.1_1 Forward -280 -268 7.4138 0.138
NP_441962.1_4 Forward -281 -262 -5.80207 0.174
NP_441962.1_4 Reverse -245 -264 -14.1602 0.284
NP_440387.1_1 Forward -276 -260 -4.1697 0.178
NP_441488.1_8 Forward -281 -267 13.5686 0.146
NP_441836.1_2 Reverse -261 -280 9.24257 0.101
NP_441174.1_4 Forward -225 -215 10.9931 0.288
NP_442698.1_10 Reverse -260 -279 1.37609 0.297
NP_441510.2_7 Forward -273 -259 17.5018 0.215
NP_440422.1_10 Forward -186 -167 6.33814 0.245
NP_441237.1_9 Forward -61 -51 11.2881 0.189
NP_442867.1_4 Reverse -314 -333 9.93088 0.267
NP_441801.1_4 Reverse -133 -143 2.7333 0.262
NP_440801.1_10 Forward -280 -261 4.22769 0.291
NP_441332.1_6 Forward -42 -32 10.7754 0.287
NP_441885.1_5 Reverse -267 -277 1.25834 0.11
NP_441885.1_5 Forward -77 -67 -1.29827 0.259
NP_440478.1_10 Reverse -265 -279 6.58777 0.288
NP_442341.1_7 Forward -277 -263 6.98109 0.113
NP_442395.2_4 Reverse -266 -285 12.88 0.0727
NP_440423.1_6 Reverse -259 -278 -16.6185 0.232
NP_443000.1_7 Forward -278 -268 17.0896 0.00865
NP_440507.2_3 Forward -386 -367 9.7334 0.216
NP_440507.2_3 Forward -285 -266 8.4551 0.253
NP_440275.1_3 Forward -278 -268 5.38824 0.153
NP_440679.1_10 Reverse -260 -279 -12.2919 0.192
NP_440679.1_10 Forward -274 -255 -16.6185 0.269
NP_440175.1_4 Reverse -265 -284 -12.2919 0.227
NP_440880.1_5 Reverse -28 -46 15.3588 0.183
NP_441105.1_3 Forward -287 -268 -7.17871 0.248
NP_440216.1_9 Reverse -54 -63 7.96454 0.286
NP_440172.1_1 Forward -276 -266 6.8632 0.0991
NP_440172.1_1 Forward -259 -249 3.02829 0.251
NP_442371.1_1 Reverse -383 -393 12.1726 0.258
NP_440167.1_3 Reverse -240 -259 9.3409 0.258
NP_442015.1_10 Forward -280 -267 -0.0790467 0.25
NP_441226.1_7 Reverse -75 -82 8.29857 0.205
NP_441111.1_7 Reverse -268 -276 8.86921 0.0589
NP_441766.1_2 Reverse -267 -276 8.45619 0.0593
NP_441766.1_2 Reverse -258 -267 1.67135 0.278
NP_440416.1_1 Reverse -267 -286 -14.2585 0.284
NP_440416.1_9 Forward -84 -65 -20.0601 0.281
NP_442154.1_1 Reverse -256 -274 -19.1554 0.291
NP_440896.1_8 Reverse -192 -211 11.4058 0.274
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATGAATATTTCCACCTGGAAATGGGGCTAACTACCAATTTATTTGCCAGTTGCTTTTATGTGCTCACGGGCTTTCACGGGCTCCATGTTACTTTTGGATTGCTATTAATCCTTTCTGTGCTCTGGCGATCACGGCAACCGGGCCATTACTCCCGCACATCCCATTTCGGGGTAGAAGCGGCGGAATTGTACTGGCATTTCGTCGATGTGGTCTGGATTGTTTTGTTTATTTTGGTTTACTTACTGTGATGGAAAGACCTTGGGCGTTAGGGCAAACCTACCTTGTGATGGGTTAATTTCGTGGGATGATAGAGAGTCGGGTTGGCATTCCCTAGTCCTTCCATTGCCCAACTGAATAGCCCAAACCCCTAAGTAATCAAAAGAGTTCTTGACCATTACC

CDS

ATGAGTTTACTGGAAATCACCGACGCTGAATTTGAGCAGGAAACCCAAGGGCAAACTAAGCCTGTGTTGGTTTATTTTTGGGCTTCCTGGTGTGGCCCTTGTCGGTTGATGGCCCCTGCTATCCAGGCGATCGCCAAGGATTATGGTGATAAGCTCAAAGTGCTCAAGTTGGAAGTGGATCCCAACCCTGCCGCCGTAGCCCAATGCAAAGTGGAAGGGGTACCAGCGCTGCGTTTGTTCAAAAATAATGAGCTAGTGATGACCCACGAAGGGGCGATCGCCAAACCCAAATTACTGGAGTTACTGAAAGAGGAATTGGATTTTATTTAA

Protein

MSLLEITDAEFEQETQGQTKPVLVYFWASWCGPCRLMAPAIQAIAKDYGDKLKVLKLEVDPNPAAVAQCKVEGVPALRLFKNNELVMTHEGAIAKPKLLELLKEELDFI