Your browser is old and dusty. Try Google Chrome!

Details for slr1135

ORF slr1135
Accession NP_440606.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -176 -157 -0.983855 0.27
NP_440795.1_7 Forward -100 -93 14.6904 0.0123
NP_440795.1_7 Reverse -93 -100 14.6904 0.0123
NP_441418.1_6 Reverse -331 -350 -28.6149 0.206
NP_441453.1_4 Reverse -92 -100 16.6374 0.00633
NP_441453.1_4 Forward -101 -93 16.539 0.00633
NP_441453.1_4 Reverse -251 -259 7.29591 0.0589
NP_441453.1_4 Reverse -331 -339 7.19758 0.0757
NP_441453.1_4 Forward -340 -332 6.70593 0.121
NP_441453.1_4 Forward -260 -252 6.70593 0.121
NP_440226.1_1 Reverse -92 -111 18.7807 0.0137
NP_440226.1_1 Forward -101 -82 17.8957 0.0175
NP_440226.1_1 Forward -260 -241 16.8141 0.0209
NP_440226.1_1 Forward -340 -321 7.57094 0.103
NP_441630.1_3 Forward -348 -329 3.14605 0.206
NP_442623.1_3 Reverse -157 -176 -19.1751 0.281
NP_440348.1_6 Forward -119 -100 7.57094 0.194
NP_442173.1_1 Forward -100 -92 17.3257 0.00633
NP_442173.1_1 Reverse -93 -101 15.4574 0.00633
NP_442173.1_1 Forward -259 -251 7.59091 0.163
NP_442173.1_1 Reverse -332 -340 5.82095 0.2
NP_442173.1_1 Reverse -252 -260 5.82095 0.2
NP_442173.1_1 Forward -339 -331 5.72262 0.203
NP_442752.1_4 Forward -340 -333 13.8055 0.0199
NP_442752.1_4 Forward -260 -253 13.8055 0.0199
NP_442752.1_4 Forward -101 -94 13.8055 0.0199
NP_442752.1_4 Reverse -373 -380 12.1338 0.0546
NP_443027.1_4 Reverse -90 -100 16.7946 0.0437
NP_443027.1_4 Forward -103 -93 13.2547 0.0521
NP_443027.1_4 Forward -262 -252 9.32148 0.166
NP_441812.1_3 Forward -102 -88 7.17775 0.286
NP_442975.1_10 Reverse -88 -102 10.9137 0.0516
NP_442975.1_10 Reverse -327 -341 10.0287 0.0598
NP_442975.1_10 Reverse -247 -261 9.04542 0.0794
NP_440784.1_7 Forward -100 -93 15.9687 0.0123
NP_440784.1_7 Reverse -93 -100 15.9687 0.0123
NP_440784.1_7 Reverse -332 -339 6.23397 0.241
NP_440784.1_7 Reverse -252 -259 6.23397 0.241
NP_440784.1_7 Forward -339 -332 6.13563 0.241
NP_440784.1_7 Forward -259 -252 6.13563 0.241
NP_441054.1_4 Reverse -82 -100 1.59244 0.172
NP_441054.1_4 Forward -111 -93 -1.84914 0.21
NP_442062.1_8 Forward -101 -91 10.0098 0.0527
NP_442062.1_8 Reverse -92 -102 7.84651 0.0871
NP_442062.1_8 Reverse -331 -341 7.64985 0.0911
NP_442062.1_8 Reverse -251 -261 5.19158 0.181
NP_440761.1_4 Reverse -87 -106 -3.83545 0.132
NP_440304.1_4 Forward -103 -93 10.8948 0.051
NP_440304.1_4 Reverse -329 -339 9.22315 0.06
NP_440304.1_4 Reverse -90 -100 9.22315 0.06
NP_442242.1_4 Forward -100 -93 14.3954 0.0124
NP_442242.1_4 Reverse -93 -100 14.3954 0.0124
NP_442242.1_4 Forward -339 -332 12.4288 0.0393
NP_442242.1_4 Forward -259 -252 12.4288 0.0393
NP_440044.1_8 Reverse -332 -351 13.7658 0.0333
NP_440044.1_8 Reverse -252 -271 6.09597 0.0943
NP_442097.1_2 Reverse -133 -152 1.57275 0.259
NP_440011.1_3 Reverse -260 -278 15.3588 0.157
NP_441208.1_9 Forward -343 -329 11.7993 0.145
NP_440370.1_10 Reverse -83 -102 7.86593 0.247
NP_442110.1_7 Forward -101 -87 0.982901 0.241
NP_441083.1_5 Reverse -331 -341 11.0914 0.0166
NP_441083.1_5 Reverse -92 -102 2.04498 0.195
NP_441083.1_5 Reverse -251 -261 1.84832 0.198
NP_441083.1_5 Forward -340 -330 1.65166 0.2
NP_441083.1_5 Forward -101 -91 1.455 0.205
NP_441434.1_1 Forward -34 -20 7.45999 0.278
NP_441434.1_1 Forward -53 -39 7.3645 0.284
NP_441738.1_2 Reverse -333 -340 15.28 0.0102
NP_441738.1_2 Reverse -253 -260 15.28 0.0102
NP_441738.1_2 Reverse -94 -101 15.28 0.0102
NP_441738.1_2 Forward -99 -92 11.5435 0.084
NP_441738.1_2 Forward -175 -168 6.52862 0.261
NP_441738.1_2 Reverse -351 -358 6.23363 0.264
NP_441558.1_5 Reverse -90 -109 18.6823 0.012
NP_441558.1_5 Forward -103 -84 16.2241 0.0318
NP_441558.1_5 Forward -262 -243 3.83436 0.296
NP_440209.1_1 Forward -101 -93 18.1123 0.00295
NP_440209.1_1 Forward -340 -332 14.8674 0.012
NP_440209.1_1 Forward -260 -252 14.8674 0.012
NP_440209.1_1 Reverse -331 -339 8.57422 0.0425
NP_440209.1_1 Reverse -92 -100 8.57422 0.0425
NP_442889.1_8 Reverse -328 -342 9.14375 0.103
NP_441713.1_1 Reverse -86 -105 1.76941 0.0651
NP_441713.1_1 Forward -266 -247 -15.6352 0.268
NP_440178.1_7 Forward -341 -322 -12.5869 0.121
NP_440178.1_7 Forward -102 -83 -21.9284 0.246
NP_440659.1_9 Forward -349 -330 11.9958 0.204
NP_442570.1_3 Reverse -166 -185 -6.49039 0.258
NP_441327.1_4 Forward -267 -253 16.1259 0.282
NP_442111.1_4 Reverse -91 -105 15.8309 0.0194
NP_442111.1_4 Forward -341 -327 2.2612 0.283
NP_440906.1_5 Forward -100 -93 15.8704 0.0124
NP_440906.1_5 Reverse -93 -100 15.8704 0.0124
NP_440906.1_5 Forward -339 -332 12.0355 0.0724
NP_440906.1_5 Forward -259 -252 12.0355 0.0724
NP_440906.1_5 Reverse -332 -339 12.0355 0.0724
NP_440906.1_5 Reverse -252 -259 12.0355 0.0724
NP_441924.1_9 Reverse -161 -180 13.9616 0.266
NP_440747.1_10 Forward -343 -331 5.15219 0.0179
NP_440747.1_10 Forward -104 -92 -2.51763 0.0509
NP_440747.1_10 Reverse -328 -340 -11.6624 0.131
NP_440747.1_10 Reverse -89 -101 -11.6624 0.131
NP_440747.1_10 Reverse -248 -260 -12.0557 0.199
NP_440747.1_10 Forward -263 -251 -12.1541 0.227
NP_441130.1_10 Forward -262 -248 6.09611 0.202
NP_441130.1_10 Forward -342 -328 4.62115 0.275
NP_441486.1_1 Reverse -328 -342 -3.44199 0.178
NP_441486.1_1 Forward -343 -329 -3.63866 0.18
NP_441486.1_10 Forward -36 -19 14.4995 0.227
NP_442145.1_4 Forward -58 -39 5.29938 0.259
NP_442634.1_4 Forward -103 -89 15.9292 0.0115
NP_442634.1_4 Reverse -90 -104 -3.73699 0.164
NP_441265.1_1 Reverse -87 -106 -17.3068 0.287
NP_442848.1_1 Forward -266 -252 -3.93365 0.275
NP_443018.1_3 Forward -100 -93 14.8871 0.0123
NP_443018.1_3 Reverse -93 -100 14.8871 0.0123
NP_443018.1_3 Forward -339 -332 5.34899 0.212
NP_443018.1_3 Forward -259 -252 5.34899 0.212
NP_443018.1_3 Reverse -332 -339 5.34899 0.212
NP_443018.1_3 Reverse -252 -259 5.34899 0.212
NP_441316.1_7 Forward -103 -88 -3.06836 0.273
NP_441634.1_8 Forward -103 -89 -2.75368 0.295
NP_441634.1_8 Forward -342 -328 -4.52363 0.295
NP_440376.1_1 Forward -340 -331 9.73449 0.0365
NP_440376.1_1 Reverse -331 -340 9.73449 0.0365
NP_440376.1_1 Reverse -92 -101 9.73449 0.0365
NP_440376.1_1 Forward -101 -92 9.63616 0.0385
NP_440376.1_1 Reverse -373 -382 0.0980582 0.285
NP_440376.1_1 Reverse -251 -260 -0.000272808 0.285
NP_440376.1_1 Forward -260 -251 -0.0986038 0.285
NP_441588.1_4 Reverse -333 -343 18.1713 0.0143
NP_441588.1_4 Reverse -253 -263 8.63316 0.14
NP_441588.1_4 Forward -99 -89 7.35486 0.178
NP_442687.1_1 Reverse -267 -280 17.7182 0.243
NP_442687.1_7 Forward -102 -92 8.04317 0.116
NP_442687.1_7 Forward -341 -331 7.35486 0.134
NP_442687.1_7 Forward -261 -251 6.37155 0.171
NP_440042.1_2 Reverse -82 -101 -5.40875 0.296
NP_440741.1_9 Forward -42 -23 22.9106 0.044
NP_441763.1_10 Reverse -81 -100 13.5683 0.121
NP_442658.1_1 Reverse -90 -100 15.0242 0.0188
NP_442658.1_1 Forward -103 -93 14.2375 0.0237
NP_442658.1_1 Reverse -329 -339 12.5659 0.0526
NP_442658.1_1 Reverse -249 -259 10.0093 0.136
NP_440141.1_10 Forward -390 -371 5.89851 0.173
NP_442782.1_2 Forward -260 -246 10.0294 0.186
NP_442205.1_9 Reverse -86 -102 5.76173 0.128
NP_442205.1_9 Forward -107 -91 -0.728113 0.264
NP_442205.1_9 Reverse -245 -261 -3.77637 0.295
NP_441414.1_9 Reverse -92 -111 -4.32711 0.152
NP_441256.1_8 Reverse -300 -319 5.01433 0.272
NP_442937.1_5 Forward -265 -246 10.8159 0.152
NP_442937.1_5 Forward -345 -326 10.3242 0.165
NP_441958.1_5 Forward -102 -92 19.9412 0.00158
NP_441958.1_5 Reverse -330 -340 11.4848 0.00522
NP_441958.1_5 Reverse -91 -101 11.4848 0.00522
NP_441958.1_5 Forward -341 -331 2.7333 0.0378
NP_441958.1_5 Reverse -250 -260 1.74999 0.0765
NP_441958.1_5 Forward -261 -251 1.455 0.0956
NP_441958.1_5 Reverse -372 -382 -1.78992 0.252
NP_440203.1_5 Reverse -176 -186 10.5993 0.218
NP_439905.1_1 Reverse -93 -106 7.98409 0.239
NP_442911.1_2 Forward -111 -92 -5.31042 0.155
NP_441580.1_6 Reverse -81 -100 10.8159 0.0559
NP_441580.1_6 Forward -112 -93 -9.24366 0.29
NP_441099.1_5 Reverse -82 -101 -8.16202 0.189
NP_441099.1_5 Forward -111 -92 -10.817 0.262
NP_442002.1_1 Reverse -364 -382 -9.22396 0.274
NP_442002.1_9 Forward -183 -176 11.3472 0.185
NP_442002.1_9 Reverse -246 -253 9.77388 0.258
NP_440809.1_9 Reverse -242 -260 2.37909 0.118
NP_441712.1_1 Reverse -159 -178 9.13438 0.295
NP_441294.1_7 Reverse -327 -341 16.3538 0.0156
NP_441294.1_7 Reverse -247 -261 11.5544 0.137
NP_442438.1_10 Reverse -87 -101 1.86788 0.188
NP_441000.1_6 Forward -261 -247 -5.80194 0.296
NP_440147.1_4 Forward -103 -90 17.0305 0.00838
NP_440147.1_4 Forward -342 -329 10.7374 0.0355
NP_440147.1_4 Reverse -90 -103 8.67241 0.0475
NP_440147.1_4 Reverse -249 -262 7.88576 0.0598
NP_441550.1_8 Forward -103 -93 15.8108 0.0132
NP_441550.1_8 Reverse -90 -100 12.6642 0.0325
NP_441550.1_8 Reverse -329 -339 8.3377 0.124
NP_441550.1_8 Forward -262 -252 7.45273 0.159
NP_441550.1_8 Forward -342 -332 5.28945 0.255
NP_441916.1_7 Reverse -92 -102 19.6462 0.00144
NP_441916.1_7 Forward -101 -91 16.893 0.00407
NP_441916.1_7 Forward -340 -330 9.12481 0.0396
NP_441916.1_7 Forward -260 -250 7.05986 0.0779
NP_441916.1_7 Reverse -251 -261 1.455 0.285
NP_441041.1_4 Reverse -92 -111 -8.85033 0.208
NP_441041.1_4 Forward -101 -82 -11.0136 0.239
NP_441041.1_7 Reverse -89 -101 17.4269 0.00864
NP_441041.1_7 Reverse -328 -340 14.4144 0.0348
NP_442642.1_9 Reverse -324 -341 7.512 0.192
NP_442004.1_6 Forward -101 -87 3.8345 0.231
NP_442004.1_6 Reverse -92 -106 2.35953 0.266
NP_441725.1_4 Forward -106 -92 3.34225 0.279
NP_441725.1_5 Reverse -93 -103 1.94665 0.115
NP_441725.1_5 Forward -100 -90 -0.118297 0.232
NP_441725.1_5 Forward -324 -314 -0.216628 0.241
NP_441725.1_5 Reverse -252 -262 -0.708283 0.267
NP_441725.1_5 Forward -339 -329 -0.904945 0.274
NP_439966.1_7 Forward -103 -93 14.3359 0.0203
NP_439966.1_7 Reverse -90 -100 5.58445 0.216
NP_439966.1_7 Forward -262 -252 4.99446 0.248
NP_439966.1_7 Reverse -329 -339 4.89613 0.254
NP_439966.1_9 Reverse -166 -175 3.83464 0.253
NP_439966.1_9 Reverse -90 -99 0.983037 0.253
NP_439966.1_9 Forward -262 -253 0.884706 0.253
NP_442941.1_3 Reverse -93 -103 19.2529 0.00262
NP_442941.1_3 Forward -100 -90 8.4365 0.0356
NP_442941.1_3 Forward -259 -249 6.8632 0.0954
NP_442941.1_3 Reverse -332 -342 1.35667 0.15
NP_442941.1_3 Reverse -252 -262 1.25834 0.15
NP_442941.1_3 Forward -339 -329 1.16001 0.15
NP_440289.1_2 Reverse -328 -341 1.9859 0.108
NP_440289.1_2 Reverse -89 -102 -4.01229 0.276
NP_441514.1_1 Forward -28 -18 15.3 0.274
NP_441514.1_4 Forward -221 -202 13.1825 0.269
NP_442281.1_1 Reverse -87 -101 13.5686 0.0256
NP_442281.1_1 Forward -345 -331 8.84875 0.075
NP_442281.1_1 Forward -265 -251 2.35894 0.269
NP_441334.1_7 Reverse -90 -109 -11.8003 0.126
NP_441079.1_7 Forward -35 -16 -7.08111 0.286
NP_440437.1_1 Reverse -325 -344 -5.99873 0.3
NP_441457.1_7 Reverse -90 -109 1.76941 0.276
NP_440498.1_1 Reverse -83 -101 2.96908 0.169
NP_440498.1_1 Forward -110 -92 -1.16082 0.222
NP_441644.1_6 Reverse -92 -102 16.6958 0.00284
NP_441644.1_6 Forward -340 -330 14.7292 0.0105
NP_441644.1_6 Forward -101 -91 9.616 0.0728
NP_441644.1_6 Reverse -331 -341 8.53436 0.0982
NP_441644.1_6 Reverse -251 -261 6.17443 0.165
NP_441644.1_6 Forward -260 -250 5.28945 0.199
NP_441644.1_6 Forward -382 -372 4.99446 0.216
NP_442247.1_8 Forward -103 -89 13.1759 0.247
NP_440253.1_2 Reverse -251 -269 -2.73412 0.274
NP_440929.1_8 Reverse -92 -101 9.93116 0.0249
NP_440929.1_8 Forward -101 -92 9.83282 0.0254
NP_440929.1_8 Reverse -331 -340 9.73449 0.0257
NP_440929.1_8 Forward -340 -331 9.4395 0.0326
NP_442933.1_6 Forward -59 -40 12.2703 0.288
NP_442933.1_10 Forward -101 -92 17.601 0.00325
NP_442933.1_10 Reverse -92 -101 17.601 0.00325
NP_442933.1_10 Forward -340 -331 13.9627 0.0192
NP_442933.1_10 Forward -260 -251 13.9627 0.0192
NP_442933.1_10 Reverse -331 -340 8.1612 0.0885
NP_442933.1_10 Reverse -251 -260 8.1612 0.0885
NP_441751.2_8 Reverse -93 -107 5.21113 0.0448
NP_441751.2_8 Forward -339 -325 2.2612 0.0859
NP_441751.2_8 Forward -100 -86 0.294584 0.121
NP_441751.2_8 Reverse -252 -266 -5.21195 0.199
NP_442554.1_8 Reverse -93 -103 17.2863 0.00543
NP_442554.1_8 Forward -339 -329 9.61647 0.0576
NP_442554.1_8 Forward -100 -90 9.51814 0.0581
NP_442554.1_8 Reverse -252 -262 8.33817 0.0754
NP_442554.1_8 Reverse -332 -342 5.5849 0.145
NP_442075.1_10 Forward -358 -339 16.3224 0.282
NP_441762.1_7 Forward -102 -90 -4.77924 0.182
NP_441762.1_7 Reverse -91 -103 -4.9759 0.185
NP_441762.1_7 Reverse -250 -262 -5.17256 0.191
NP_441762.1_7 Forward -341 -329 -7.23751 0.286
NP_442142.1_4 Reverse -328 -341 11.9167 0.0504
NP_442142.1_4 Reverse -89 -102 5.32859 0.194
NP_442142.1_4 Forward -104 -91 2.67367 0.281
NP_442292.1_1 Reverse -93 -102 17.5026 0.00435
NP_442292.1_1 Reverse -332 -341 8.75118 0.0306
NP_442292.1_1 Reverse -252 -261 8.75118 0.0306
NP_442292.1_1 Forward -100 -91 8.55452 0.035
NP_442292.1_1 Forward -339 -330 7.66954 0.0634
NP_441525.1_1 Reverse -327 -340 12.2123 0.28
NP_442476.1_6 Reverse -93 -107 9.93102 0.0786
NP_442476.1_6 Forward -100 -86 6.09611 0.13
NP_442381.1_8 Reverse -89 -108 -14.0619 0.28
NP_442381.1_8 Reverse -328 -347 -15.1435 0.298
NP_443009.1_5 Forward -102 -91 14.7094 0.02
NP_443009.1_5 Reverse -91 -102 11.7595 0.0602
NP_443009.1_5 Reverse -330 -341 7.23633 0.135
NP_443009.1_5 Forward -341 -330 4.67974 0.234
NP_443009.1_5 Reverse -74 -85 3.79477 0.278
NP_443009.1_5 Forward -261 -250 3.5981 0.286
NP_441715.1_4 Reverse -93 -103 16.7946 0.0106
NP_441715.1_4 Forward -100 -90 5.97822 0.165
NP_441715.1_4 Forward -259 -249 5.68323 0.189
NP_440183.1_1 Forward -100 -81 22.3206 0.0754
NP_441198.1_5 Reverse -333 -346 12.7034 0.216
NP_441198.1_8 Reverse -90 -100 14.9316 0.0594
NP_441198.1_8 Reverse -329 -339 10.8298 0.239
NP_440379.1_5 Forward -116 -97 -4.52377 0.215
NP_441468.1_1 Forward -100 -93 15.8704 0.0124
NP_441468.1_1 Reverse -93 -100 15.8704 0.0124
NP_441468.1_1 Reverse -332 -339 6.13563 0.209
NP_441468.1_1 Reverse -252 -259 6.13563 0.209
NP_441468.1_1 Forward -339 -332 6.0373 0.223
NP_441468.1_1 Forward -259 -252 6.0373 0.223
NP_441673.1_1 Reverse -331 -340 11.1111 0.0121
NP_441673.1_1 Reverse -92 -101 11.1111 0.0121
NP_441673.1_1 Forward -340 -331 11.0128 0.018
NP_441673.1_1 Forward -101 -92 11.0128 0.018
NP_441673.1_1 Reverse -251 -260 1.37636 0.114
NP_441673.1_1 Forward -260 -251 1.1797 0.163
NP_441637.1_9 Reverse -18 -36 -4.20908 0.296
NP_441764.1_8 Forward -58 -48 10.8322 0.297
NP_442868.1_6 Forward -103 -93 10.4031 0.038
NP_442868.1_6 Forward -262 -252 7.64985 0.0726
NP_442868.1_6 Forward -342 -332 -0.0199663 0.255
NP_442868.1_6 Reverse -90 -100 -0.216628 0.273
NP_442227.1_4 Reverse -352 -371 11.2084 0.285
NP_442427.1_8 Reverse -83 -102 8.25926 0.203
NP_442808.1_1 Reverse -330 -340 7.45273 0.0783
NP_441101.1_1 Reverse -329 -347 9.55725 0.286
NP_442692.1_4 Forward -45 -26 14.6508 0.225
NP_440145.1_3 Reverse -321 -340 5.30933 0.0682
NP_440145.1_3 Forward -270 -251 2.65439 0.115
NP_442050.1_5 Reverse -90 -100 16.3025 0.0091
NP_442050.1_5 Forward -103 -93 15.9091 0.0091
NP_442050.1_5 Forward -179 -169 8.04271 0.243
NP_442050.1_5 Reverse -329 -339 7.84605 0.243
NP_441518.1_3 Forward -350 -331 -13.0786 0.264
NP_441878.1_6 Reverse -330 -340 0.766681 0.134
NP_441878.1_6 Reverse -91 -101 0.766681 0.134
NP_441878.1_6 Forward -102 -92 0.668351 0.139
NP_441878.1_6 Forward -341 -331 0.57002 0.14
NP_441036.1_8 Reverse -91 -101 15.418 0.00944
NP_441036.1_8 Reverse -330 -340 14.1397 0.0298
NP_441036.1_8 Reverse -250 -260 13.8447 0.0353
NP_441036.1_8 Forward -102 -92 11.7798 0.106
NP_441557.1_5 Forward -101 -92 18.6826 0.0015
NP_441557.1_5 Reverse -92 -101 10.5211 0.00695
NP_441557.1_5 Reverse -331 -340 10.2261 0.0144
NP_441557.1_5 Forward -340 -331 10.1278 0.0188
NP_441557.1_5 Forward -260 -251 8.84951 0.0343
NP_441557.1_5 Reverse -251 -260 0.786375 0.106
NP_441445.1_1 Forward -349 -330 0.491109 0.275
NP_442066.2_9 Forward -105 -92 10.344 0.154
NP_442066.2_9 Reverse -88 -101 9.95071 0.158
NP_441308.1_8 Reverse -329 -339 8.73149 0.248
NP_442183.1_1 Forward -101 -87 10.9143 0.078
NP_442183.1_1 Reverse -251 -265 4.71948 0.25
NP_441116.1_9 Reverse -314 -328 12.6843 0.25
NP_441819.1_4 Forward -31 -12 17.7974 0.103
NP_442444.1_6 Forward -109 -91 12.437 0.272
NP_442347.1_2 Forward -387 -378 8.06287 0.116
NP_442347.1_2 Reverse -76 -85 4.52295 0.282
NP_442347.1_2 Reverse -332 -341 3.93297 0.284
NP_442347.1_2 Reverse -252 -261 3.93297 0.284
NP_442347.1_2 Reverse -93 -102 3.34298 0.284
NP_442645.1_2 Forward -109 -90 -13.4719 0.154
NP_442645.1_2 Reverse -323 -342 -20.7484 0.288
NP_442965.1_3 Reverse -323 -342 -1.08219 0.245
NP_441037.1_4 Forward -262 -252 8.48718 0.237
NP_441037.1_4 Reverse -90 -100 7.51261 0.237
NP_441037.1_4 Forward -103 -93 7.22024 0.237
NP_441037.1_4 Forward -342 -332 6.92787 0.237
NP_441037.1_4 Reverse -329 -339 6.92787 0.237
NP_441633.1_3 Forward -342 -329 1.00259 0.11
NP_441633.1_3 Forward -103 -90 -3.91395 0.177
NP_442764.1_6 Reverse -333 -351 9.55725 0.163
NP_440136.1_2 Forward -100 -93 15.9687 0.0123
NP_440136.1_2 Reverse -93 -100 15.9687 0.0123
NP_440136.1_2 Reverse -332 -339 6.23397 0.171
NP_440136.1_2 Reverse -252 -259 6.23397 0.171
NP_440136.1_2 Forward -339 -332 6.13563 0.193
NP_440136.1_2 Forward -259 -252 6.13563 0.193
NP_442998.1_5 Forward -350 -340 10.0098 0.231
NP_442998.1_5 Reverse -205 -215 7.55152 0.289
NP_442998.1_10 Reverse -333 -340 15.5754 0.0102
NP_442998.1_10 Reverse -253 -260 15.5754 0.0102
NP_442998.1_10 Reverse -94 -101 15.5754 0.0102
NP_442998.1_10 Forward -338 -331 5.74231 0.255
NP_442998.1_10 Forward -99 -92 5.74231 0.255
NP_440299.1_1 Forward -105 -92 7.88518 0.103
NP_441799.1_1 Forward -105 -91 13.9619 0.0288
NP_441799.1_1 Reverse -88 -102 13.8636 0.0293
NP_441799.1_1 Reverse -247 -261 5.70218 0.197
NP_441799.1_1 Forward -344 -330 4.71887 0.238
NP_441007.1_10 Reverse -87 -100 15.1623 0.0499
NP_441007.1_10 Forward -265 -252 7.6891 0.133
NP_441007.1_10 Forward -106 -93 3.06754 0.183
NP_440256.1_1 Reverse -89 -108 3.93269 0.0488
NP_440256.1_1 Forward -263 -244 0.687771 0.0814
NP_440256.1_1 Forward -157 -138 -3.73712 0.138
NP_441512.1_4 Reverse -327 -346 8.06259 0.264
NP_440915.1_6 Reverse -88 -102 11.6026 0.0254
NP_440915.1_6 Forward -105 -91 7.17775 0.074
NP_440915.1_6 Reverse -327 -341 1.57289 0.134
NP_441296.1_9 Forward -329 -316 11.4251 0.232
NP_440695.1_5 Forward -260 -241 -2.45882 0.299
NP_441939.1_3 Reverse -93 -112 6.19431 0.248
NP_441494.1_6 Reverse -87 -100 8.57408 0.23
NP_442993.1_1 Forward -101 -85 7.63002 0.0312
NP_442993.1_1 Forward -340 -324 -9.47957 0.186
NP_442386.1_9 Reverse -91 -100 7.37413 0.219
NP_442386.1_9 Forward -383 -374 6.78414 0.219
NP_442386.1_9 Forward -102 -93 6.39082 0.219
NP_441340.1_5 Forward -100 -93 15.6737 0.0124
NP_441340.1_5 Reverse -93 -100 15.6737 0.0124
NP_441340.1_5 Forward -339 -332 6.13563 0.175
NP_441340.1_5 Forward -259 -252 6.13563 0.175
NP_441340.1_5 Reverse -332 -339 5.93897 0.198
NP_441340.1_5 Reverse -252 -259 5.93897 0.198
NP_442327.1_3 Reverse -269 -288 5.1084 0.28
NP_441947.1_10 Reverse -166 -184 0.21581 0.276
NP_440161.1_3 Reverse -329 -348 10.1275 0.232
NP_440586.1_8 Forward -100 -93 13.2151 0.026
NP_440586.1_8 Reverse -93 -100 13.2151 0.026
NP_440586.1_8 Forward -339 -332 11.4451 0.0645
NP_440586.1_8 Forward -259 -252 11.4451 0.0645
NP_442251.1_6 Forward -100 -93 15.2804 0.0124
NP_442251.1_6 Reverse -93 -100 15.2804 0.0124
NP_442251.1_6 Reverse -332 -339 12.0355 0.0627
NP_442251.1_6 Reverse -252 -259 12.0355 0.0627
NP_440684.1_9 Forward -346 -332 10.9143 0.185
NP_441262.1_3 Forward -340 -333 14.7888 0.0223
NP_441262.1_3 Forward -260 -253 14.7888 0.0223
NP_441262.1_3 Forward -101 -94 14.7888 0.0223
NP_441262.1_3 Reverse -92 -99 13.9038 0.0336
NP_443051.1_1 Forward -102 -93 19.5676 0.00335
NP_443051.1_1 Reverse -91 -100 10.2261 0.00842
NP_443051.1_1 Reverse -330 -339 9.83282 0.0203
NP_443051.1_1 Forward -341 -332 0.786375 0.125
NP_443051.1_1 Forward -261 -252 0.786375 0.125
NP_443051.1_1 Reverse -250 -259 0.491382 0.151
NP_440439.1_1 Forward -104 -91 11.229 0.0339
NP_440439.1_1 Reverse -89 -102 0.314277 0.194
NP_439943.1_4 Forward -375 -356 4.42435 0.287
NP_440372.1_2 Forward -100 -93 16.3621 0.0124
NP_440372.1_2 Reverse -93 -100 16.3621 0.0124
NP_440372.1_2 Forward -339 -332 6.72562 0.0929
NP_440372.1_2 Forward -259 -252 6.72562 0.0929
NP_440372.1_2 Reverse -332 -339 6.62729 0.151
NP_440372.1_2 Reverse -252 -259 6.62729 0.151
NP_440991.1_8 Reverse -333 -352 16.289 0.268
NP_442488.1_7 Reverse -90 -109 9.63589 0.273
NP_439977.1_5 Reverse -86 -105 3.83436 0.157
NP_439977.1_5 Forward -107 -88 -0.4922 0.227
NP_440139.1_1 Forward -107 -88 3.63691 0.201
NP_441572.1_7 Reverse -86 -105 1.0811 0.156
NP_442384.1_10 Reverse -92 -105 17.7189 0.00567
NP_442114.1_4 Reverse -92 -103 7.23683 0.291
NP_440699.1_3 Reverse -222 -239 12.6252 0.256
NP_442790.1_4 Forward -349 -330 -15.9302 0.3
NP_442262.1_10 Forward -100 -93 14.1988 0.0123
NP_442262.1_10 Reverse -93 -100 14.1988 0.0123
NP_441689.1_5 Reverse -90 -100 10.6976 0.132
NP_441689.1_5 Forward -103 -93 8.3377 0.132
NP_440344.1_10 Forward -330 -313 -12.2525 0.246
NP_440344.1_10 Forward -347 -330 -13.2358 0.278
NP_440562.1_3 Forward -100 -83 6.82368 0.15
NP_442529.1_9 Reverse -158 -177 19.0757 0.119
NP_440297.1_9 Reverse -93 -103 -0.216628 0.282
NP_441896.1_3 Reverse -83 -102 -3.14714 0.297
YP_680420.1_1 Reverse -90 -109 8.84924 0.244
NP_440999.1_9 Reverse -88 -102 8.65272 0.0738
NP_440888.1_2 Reverse -92 -106 14.1586 0.02
NP_440888.1_2 Forward -101 -87 10.1271 0.104
NP_440888.1_2 Forward -340 -326 7.66879 0.186
NP_440888.1_2 Reverse -251 -265 5.21053 0.288
NP_441543.1_2 Reverse -93 -102 15.9293 0.00518
NP_441543.1_2 Forward -100 -91 12.8811 0.0311
NP_441543.1_2 Reverse -332 -341 7.17789 0.131
NP_441543.1_2 Reverse -252 -261 7.17789 0.131
NP_441543.1_2 Forward -339 -330 6.48957 0.145
NP_442845.1_2 Reverse -86 -100 15.0442 0.0763
NP_442845.1_2 Forward -107 -93 7.57108 0.195
NP_441469.1_8 Forward -102 -93 6.5879 0.227
NP_443064.1_6 Reverse -331 -341 11.5004 0.13
NP_443064.1_6 Reverse -251 -261 8.6886 0.276
NP_442578.1_7 Forward -100 -93 14.5921 0.026
NP_442578.1_7 Reverse -93 -100 14.5921 0.026
NP_442578.1_7 Forward -339 -332 5.93897 0.183
NP_442578.1_7 Forward -259 -252 5.93897 0.183
NP_440710.1_1 Forward -109 -91 -9.22396 0.296
NP_441462.1_2 Forward -101 -91 19.2529 0.00159
NP_441462.1_2 Forward -340 -330 10.7964 0.00567
NP_441462.1_2 Reverse -92 -102 10.5014 0.00824
NP_441462.1_2 Forward -260 -250 9.81313 0.0143
NP_441462.1_2 Reverse -331 -341 1.84832 0.081
NP_443062.1_1 Reverse -92 -110 13.9088 0.0553
NP_443062.1_1 Forward -340 -322 5.03566 0.242
NP_443062.1_1 Forward -101 -83 3.86557 0.282
NP_442204.1_1 Forward -105 -94 1.92696 0.266
NP_442204.1_1 Reverse -369 -380 0.746988 0.281
NP_442204.1_5 Reverse -65 -84 4.42435 0.167
NP_440516.1_8 Forward -340 -331 15.6344 0.00582
NP_440516.1_8 Forward -101 -92 9.4395 0.0183
NP_440516.1_8 Forward -260 -251 8.1612 0.0417
NP_440516.1_8 Reverse -331 -340 7.47288 0.0581
NP_440516.1_8 Reverse -92 -101 7.17789 0.0754
NP_441785.1_1 Reverse -251 -265 12.3505 0.25
NP_441033.1_2 Forward -350 -331 -7.86702 0.293
NP_442428.1_5 Forward -100 -93 15.8704 0.0124
NP_442428.1_5 Reverse -93 -100 15.8704 0.0124
NP_442428.1_5 Reverse -332 -339 6.13563 0.209
NP_442428.1_5 Reverse -252 -259 6.13563 0.209
NP_442428.1_5 Forward -339 -332 6.0373 0.212
NP_442428.1_5 Forward -259 -252 6.0373 0.212
NP_441032.1_8 Forward -102 -83 16.7157 0.159
NP_442859.1_2 Reverse -93 -112 6.19431 0.199
NP_442120.1_10 Forward -101 -82 -9.63698 0.244
NP_441867.1_2 Forward -366 -347 -4.81876 0.189
NP_441867.1_2 Reverse -153 -172 -11.1119 0.214
NP_440673.1_2 Forward -350 -331 11.3651 0.178
NP_440673.1_3 Forward -99 -92 14.0021 0.0426
NP_440673.1_3 Reverse -333 -340 12.4288 0.0426
NP_440673.1_3 Reverse -253 -260 12.4288 0.0426
NP_440673.1_3 Reverse -94 -101 12.4288 0.0426
NP_440865.1_9 Reverse -86 -105 -9.44032 0.29
NP_441052.1_2 Reverse -331 -341 10.2065 0.0295
NP_441052.1_2 Reverse -92 -102 1.94665 0.221
NP_441052.1_2 Reverse -251 -261 1.74999 0.229
NP_441052.1_2 Forward -340 -330 0.766681 0.256
NP_441052.1_2 Forward -101 -91 0.57002 0.256
NP_442219.1_9 Forward -100 -91 8.94785 0.0681
NP_442219.1_9 Reverse -93 -102 8.25953 0.0681
NP_442219.1_9 Reverse -332 -341 8.06287 0.0696
NP_442219.1_9 Reverse -252 -261 8.06287 0.0696
NP_440436.1_4 Reverse -332 -341 13.9623 0.0193
NP_440436.1_4 Reverse -252 -261 13.9623 0.0193
NP_440436.1_4 Reverse -93 -102 9.24241 0.0871
NP_440436.1_4 Forward -100 -91 7.96411 0.119
NP_440436.1_4 Forward -339 -330 5.9975 0.174
NP_440436.1_4 Forward -259 -250 4.7192 0.244
NP_441884.1_9 Reverse -328 -347 -13.7669 0.138
NP_442086.1_3 Reverse -93 -112 8.75091 0.231
NP_440314.1_9 Reverse -93 -112 -9.44032 0.268
NP_440648.1_1 Reverse -316 -335 2.75272 0.283
NP_442907.1_9 Reverse -87 -106 -3.83545 0.272
NP_441719.1_4 Forward -100 -93 16.3621 0.0124
NP_441719.1_4 Reverse -93 -100 16.3621 0.0124
NP_441719.1_4 Forward -339 -332 6.72562 0.093
NP_441719.1_4 Forward -259 -252 6.72562 0.093
NP_441719.1_4 Reverse -332 -339 6.62729 0.151
NP_441719.1_4 Reverse -252 -259 6.62729 0.151
NP_441733.1_10 Reverse -89 -102 6.80412 0.171
NP_441004.1_1 Forward -374 -355 -12.0953 0.244
NP_441231.1_3 Forward -322 -303 11.7 0.271
NP_442366.1_3 Reverse -330 -348 -5.48739 0.288
NP_442366.1_5 Forward -343 -333 14.8275 0.0375
NP_440296.1_10 Forward -359 -340 -8.45701 0.253
NP_441115.1_4 Forward -102 -84 10.0481 0.19
NP_442206.1_4 Forward -259 -240 6.68596 0.259
NP_442206.1_10 Forward -101 -86 3.91314 0.181
NP_443054.1_2 Forward -103 -89 0.392915 0.267
NP_441851.1_10 Forward -102 -92 9.7148 0.114
NP_441851.1_10 Reverse -167 -177 7.35486 0.142
NP_441851.1_10 Forward -261 -251 7.25653 0.144
NP_441851.1_10 Forward -341 -331 6.07655 0.187
NP_442939.1_3 Reverse -17 -31 15.4813 0.279
NP_441349.1_10 Forward -350 -331 -1.08219 0.0988
NP_441409.1_6 Reverse -245 -264 -9.047 0.178
NP_440432.1_9 Reverse -252 -267 13.0579 0.0213
NP_440432.1_9 Reverse -332 -347 7.15806 0.0437
NP_440432.1_9 Reverse -93 -108 2.73316 0.108
NP_440432.1_9 Forward -100 -85 -5.42831 0.248
NP_442843.1_1 Forward -355 -336 -10.1286 0.276
NP_440474.1_8 Forward -100 -86 9.34041 0.162
NP_440474.1_8 Reverse -93 -107 6.39049 0.227
NP_441570.1_1 Reverse -331 -349 -2.43913 0.0656
NP_441570.1_1 Forward -340 -322 -16.8938 0.257
NP_441078.1_4 Reverse -331 -340 9.93116 0.0203
NP_441078.1_4 Reverse -92 -101 9.93116 0.0203
NP_441078.1_4 Forward -340 -331 9.83282 0.0226
NP_441078.1_4 Forward -101 -92 9.83282 0.0226
NP_441078.1_4 Reverse -251 -260 0.196389 0.205
NP_441078.1_4 Forward -260 -251 -0.000272808 0.205
NP_442443.1_1 Forward -364 -345 9.83255 0.108
NP_442443.1_4 Reverse -203 -213 14.4342 0.227
NP_440526.1_3 Reverse -252 -263 17.1677 0.052
NP_440526.1_3 Forward -339 -328 10.0879 0.0669
NP_440526.1_3 Reverse -332 -343 7.43299 0.148
NP_440526.1_3 Forward -100 -89 2.31981 0.267
NP_441432.1_8 Forward -102 -93 16.8143 0.00595
NP_441432.1_8 Forward -341 -332 7.17789 0.102
NP_441432.1_8 Forward -261 -252 7.17789 0.102
NP_441432.1_8 Reverse -330 -339 7.07956 0.105
NP_441432.1_8 Reverse -91 -100 7.07956 0.105
NP_441432.1_8 Forward -121 -112 3.04799 0.268
NP_441333.1_1 Reverse -15 -25 12.7339 0.229
NP_442320.1_8 Forward -266 -252 12.586 0.0175
NP_442320.1_8 Reverse -86 -100 7.9644 0.0185
NP_442320.1_8 Forward -107 -93 -0.885388 0.0817
NP_442320.1_8 Forward -346 -332 -6.19526 0.269
NP_441732.1_2 Reverse -247 -263 -16.5594 0.174
NP_442447.1_1 Reverse -132 -151 3.73603 0.292
NP_440760.1_1 Reverse -92 -111 -9.14533 0.0825
NP_440199.1_10 Forward -263 -253 7.35486 0.231
NP_440199.1_10 Forward -343 -333 7.25653 0.231
NP_440199.1_10 Reverse -376 -386 6.56821 0.296
NP_440913.1_1 Forward -103 -85 4.54237 0.265
NP_440713.1_4 Reverse -241 -260 1.0811 0.294
NP_442489.1_7 Reverse -331 -340 10.6195 0.00984
NP_442489.1_7 Reverse -92 -101 10.4228 0.0151
NP_442489.1_7 Forward -340 -331 10.3245 0.0193
NP_442489.1_7 Forward -101 -92 10.3245 0.0193
NP_442489.1_7 Reverse -251 -260 0.884706 0.145
NP_442489.1_7 Forward -260 -251 0.491382 0.178
NP_440559.1_1 Reverse -332 -341 14.1594 0.0317
NP_440559.1_1 Reverse -252 -261 14.1594 0.0317
NP_440559.1_1 Forward -100 -91 8.75118 0.0586
NP_440559.1_1 Reverse -93 -102 8.65285 0.0586
NP_441659.2_8 Reverse -92 -102 18.6629 0.00133
NP_441659.2_8 Forward -340 -330 17.5813 0.0024
NP_441659.2_8 Forward -101 -91 11.2881 0.0189
NP_441659.2_8 Reverse -331 -341 8.63316 0.0405
NP_441659.2_8 Forward -260 -250 7.94484 0.052
NP_441659.2_8 Reverse -251 -261 6.37155 0.0774
NP_441659.2_8 Forward -382 -372 3.61828 0.154
NP_441092.1_3 Reverse -94 -113 0.786102 0.245
NP_442913.1_10 Reverse -322 -341 16.1257 0.0151
NP_440779.1_5 Reverse -251 -268 -5.46769 0.149
NP_440779.1_5 Reverse -331 -348 -6.05768 0.159
NP_442346.1_5 Forward -102 -92 15.8113 0.0045
NP_442346.1_5 Forward -341 -331 15.3197 0.00738
NP_442346.1_5 Forward -261 -251 14.828 0.00967
NP_442346.1_5 Reverse -91 -101 14.1397 0.0164
NP_442346.1_5 Reverse -330 -340 6.56821 0.198
NP_442346.1_5 Reverse -250 -260 4.40493 0.29
NP_440545.1_3 Forward -344 -327 -7.13932 0.298
NP_441856.1_3 Forward -104 -85 -2.95047 0.272
NP_440025.1_3 Reverse -344 -358 11.3853 0.29
NP_440449.1_6 Reverse -84 -102 9.32573 0.181
NP_441833.1_4 Forward -100 -93 15.9687 0.0124
NP_441833.1_4 Reverse -93 -100 15.9687 0.0124
NP_441833.1_4 Reverse -332 -339 14.1004 0.0258
NP_441833.1_4 Reverse -252 -259 14.1004 0.0258
NP_441833.1_4 Forward -339 -332 6.13563 0.198
NP_441833.1_4 Forward -259 -252 6.13563 0.198
NP_441329.1_1 Forward -295 -276 8.16414 0.229
NP_441329.1_6 Forward -47 -28 2.43462 0.227
NP_442436.1_4 Reverse -21 -35 13.1759 0.218
NP_442162.1_9 Forward -100 -93 16.2637 0.0124
NP_442162.1_9 Reverse -93 -100 16.2637 0.0124
NP_442162.1_9 Reverse -332 -339 6.62729 0.142
NP_442162.1_9 Reverse -252 -259 6.62729 0.142
NP_442162.1_9 Forward -339 -332 6.52896 0.178
NP_442162.1_9 Forward -259 -252 6.52896 0.178
NP_442199.1_5 Reverse -243 -262 13.0775 0.0466
NP_442199.1_5 Forward -109 -90 6.88262 0.0766
NP_442199.1_5 Reverse -84 -103 -5.40875 0.245
NP_442140.1_3 Forward -100 -90 7.64985 0.133
NP_442140.1_3 Forward -339 -329 6.46988 0.168
NP_442140.1_3 Reverse -93 -103 4.69992 0.238
NP_442140.1_3 Reverse -252 -262 4.10993 0.261
NP_441696.1_6 Forward -339 -320 1.86774 0.285
NP_440875.1_9 Forward -99 -89 13.2389 0.0789
NP_440875.1_9 Reverse -253 -263 8.66404 0.233
NP_440875.1_9 Reverse -94 -104 7.69067 0.255
NP_440875.1_9 Forward -338 -328 7.10665 0.283
NP_441813.1_3 Reverse -314 -333 13.3647 0.291
NP_441813.1_5 Forward -103 -93 18.1713 0.00743
NP_441813.1_5 Reverse -90 -100 7.94484 0.0517
NP_441813.1_5 Reverse -249 -259 7.84651 0.0573
NP_441813.1_5 Reverse -329 -339 -0.806614 0.285
NP_440594.1_8 Reverse -93 -106 11.6217 0.152
NP_440594.1_8 Forward -339 -326 7.98351 0.254
NP_440590.1_4 Reverse -252 -265 1.29759 0.127
NP_440590.1_4 Reverse -93 -106 1.29759 0.127
NP_440590.1_4 Reverse -332 -345 -0.570702 0.192
NP_440590.1_4 Forward -339 -326 -4.20895 0.258
NP_440567.1_1 Forward -100 -86 18.7808 0.0136
NP_440567.1_1 Reverse -93 -107 11.3077 0.0292
NP_440567.1_1 Reverse -252 -266 -0.197071 0.27
NP_442497.1_10 Reverse -93 -102 17.601 0.00813
NP_442497.1_10 Forward -100 -91 15.7327 0.0087
NP_442497.1_10 Forward -339 -330 7.76787 0.0731
NP_442497.1_10 Forward -259 -250 5.89959 0.109
NP_442497.1_10 Reverse -332 -341 0.688044 0.141
NP_442497.1_10 Reverse -252 -261 0.688044 0.141
NP_440821.1_4 Forward -262 -252 8.1415 0.055
NP_440821.1_4 Forward -103 -93 2.24165 0.131
NP_440821.1_4 Reverse -90 -100 2.04498 0.131
NP_440821.1_4 Reverse -329 -339 1.06167 0.142
NP_440821.1_4 Forward -342 -332 -0.41329 0.257
NP_441239.1_9 Reverse -90 -102 13.3137 0.037
NP_441239.1_9 Forward -103 -91 8.88877 0.12
NP_441239.1_9 Reverse -329 -341 5.64384 0.213
NP_441727.1_3 Reverse -85 -104 3.53937 0.286
NP_442643.1_1 Forward -107 -88 -11.3086 0.231
NP_440876.1_5 Reverse -253 -272 15.9291 0.191
NP_442138.1_10 Reverse -331 -350 3.44104 0.114
NP_440546.1_4 Forward -101 -91 15.1848 0.0459
NP_440546.1_4 Reverse -92 -102 14.3121 0.0459
NP_440546.1_4 Forward -260 -250 13.1486 0.0572
NP_440546.1_4 Forward -340 -330 11.5004 0.0806
NP_440546.1_4 Reverse -373 -383 8.78555 0.171
NP_440462.1_6 Reverse -90 -100 18.7612 0.00454
NP_440462.1_6 Forward -103 -93 18.7612 0.00454
NP_440462.1_6 Reverse -329 -339 9.91146 0.0429
NP_440462.1_6 Reverse -249 -259 8.53483 0.0611
NP_440868.1_4 Forward -105 -93 8.00379 0.0602
NP_440868.1_4 Reverse -88 -100 1.51394 0.181
NP_440868.1_4 Reverse -247 -259 0.137309 0.228
NP_442479.1_9 Reverse -17 -36 -12.8819 0.287
NP_440812.1_10 Forward -363 -350 12.0157 0.259
NP_441084.1_6 Reverse -249 -263 13.7072 0.125
NP_441084.1_6 Reverse -329 -343 12.4467 0.16
NP_440653.1_10 Reverse -157 -176 14.8474 0.104
NP_442039.1_3 Forward -254 -235 16.6174 0.211
NP_442039.1_4 Forward -100 -93 15.1821 0.0124
NP_442039.1_4 Reverse -93 -100 15.1821 0.0124
NP_442829.1_2 Reverse -133 -149 11.0401 0.287
NP_441926.1_3 Reverse -92 -108 3.79511 0.208
NP_440825.1_7 Forward -255 -245 10.7626 0.294
NP_442837.1_3 Forward -100 -93 15.7721 0.0124
NP_442837.1_3 Reverse -93 -100 15.7721 0.0124
NP_442837.1_3 Reverse -332 -339 6.13563 0.25
NP_442837.1_3 Reverse -252 -259 6.13563 0.25
NP_442837.1_3 Forward -339 -332 5.93897 0.265
NP_442837.1_3 Forward -259 -252 5.93897 0.265
NP_442053.1_1 Reverse -331 -340 9.34117 0.0666
NP_442053.1_1 Forward -101 -92 9.24284 0.068
NP_442053.1_1 Reverse -92 -101 8.94785 0.07
NP_442053.1_1 Forward -340 -331 8.55452 0.0784
NP_440505.1_3 Forward -103 -93 17.188 0.00332
NP_440505.1_3 Forward -262 -252 15.3197 0.0131
NP_440505.1_3 Forward -342 -332 7.94484 0.147
NP_440505.1_3 Reverse -329 -339 5.68323 0.217
NP_440505.1_3 Reverse -90 -100 5.68323 0.217
NP_442532.1_7 Forward -101 -87 5.60446 0.171
NP_440914.1_1 Reverse -331 -341 16.032 0.00231
NP_440914.1_1 Reverse -92 -102 15.0561 0.00832
NP_440914.1_1 Reverse -251 -261 14.7634 0.00997
NP_440914.1_1 Forward -101 -91 7.24882 0.242
NP_440914.1_1 Forward -340 -330 6.56569 0.273
NP_441011.1_8 Forward -100 -91 17.896 0.00602
NP_441011.1_8 Reverse -93 -102 16.6177 0.00602
NP_441011.1_8 Forward -259 -250 8.1612 0.147
NP_441011.1_8 Forward -339 -330 6.8829 0.18
NP_442101.1_10 Forward -128 -109 -7.08038 0.209
NP_442533.1_6 Forward -101 -92 15.1427 0.00675
NP_442533.1_6 Reverse -331 -340 7.66954 0.0897
NP_442533.1_6 Reverse -92 -101 7.47288 0.0898
NP_442533.1_6 Forward -340 -331 7.37455 0.0898
NP_442533.1_6 Forward -260 -251 5.3096 0.145
NP_442533.1_6 Forward -382 -373 4.12963 0.191
NP_440263.1_2 Forward -103 -84 13.2733 0.293
NP_442322.1_2 Forward -27 -8 14.8466 0.229
NP_442229.1_1 Reverse -329 -343 7.96378 0.189
NP_441482.1_7 Forward -107 -93 4.71948 0.0454
NP_439944.1_9 Forward -100 -90 16.1063 0.0127
NP_439944.1_9 Forward -339 -329 15.8113 0.0144
NP_439944.1_9 Reverse -252 -262 9.41981 0.1
NP_439944.1_9 Reverse -93 -103 9.12481 0.1
NP_439944.1_9 Forward -259 -249 5.48657 0.247
NP_440816.1_2 Forward -30 -11 6.82221 0.27
NP_440116.1_8 Forward -100 -81 7.7676 0.0424
NP_440116.1_8 Forward -339 -320 -2.16383 0.126
NP_440116.1_8 Reverse -93 -112 -5.60541 0.194
NP_441527.1_4 Reverse -222 -241 -12.2711 0.285
NP_440115.1_6 Forward -263 -253 9.81313 0.115
NP_440115.1_6 Reverse -89 -99 6.56821 0.178
NP_440115.1_6 Forward -104 -94 4.79825 0.282
NP_441347.1_5 Forward -107 -93 12.2903 0.245
NP_441347.1_5 Reverse -86 -100 8.65209 0.284
NP_441602.1_3 Forward -106 -87 -2.85214 0.239
NP_441106.1_1 Forward -102 -93 18.486 0.0028
NP_441106.1_1 Reverse -91 -100 17.601 0.00462
NP_441106.1_1 Reverse -330 -339 15.1427 0.0138
NP_441106.1_1 Reverse -250 -259 14.2577 0.0252
NP_441420.1_1 Forward -341 -322 -0.885524 0.262
NP_439903.1_6 Reverse -328 -347 3.53858 0.209
NP_442306.1_10 Forward -106 -87 -20.1584 0.202
NP_441286.1_1 Forward -341 -329 12.1337 0.0104
NP_441286.1_1 Forward -102 -90 -3.99259 0.148
NP_441286.1_1 Forward -261 -249 -5.86088 0.229
NP_441286.1_1 Reverse -330 -342 -6.2542 0.254
NP_441286.1_1 Reverse -250 -262 -6.64753 0.271
NP_440670.1_8 Reverse -331 -340 16.5193 0.00214
NP_440670.1_8 Forward -340 -331 9.4395 0.0559
NP_440670.1_8 Forward -101 -92 8.94785 0.0606
NP_440670.1_8 Reverse -92 -101 8.84951 0.0606
NP_440670.1_8 Reverse -251 -260 6.98123 0.0882
NP_440670.1_8 Forward -325 -316 6.09625 0.127
NP_440886.1_7 Forward -341 -331 4.01116 0.255
NP_442614.1_2 Reverse -373 -387 11.2093 0.206
NP_439995.1_5 Forward -270 -251 7.17762 0.267
NP_442072.1_9 Forward -341 -323 -13.1572 0.102
NP_442072.1_9 Forward -102 -84 -21.2203 0.206
NP_442072.1_9 Reverse -91 -109 -21.6137 0.211
NP_440028.1_6 Forward -367 -349 10.6389 0.277
NP_440907.2_8 Forward -100 -90 16.3025 0.0161
NP_440907.2_8 Reverse -93 -103 9.616 0.103
NP_440907.2_8 Forward -339 -329 9.51767 0.103
NP_441021.1_1 Forward -100 -81 -8.16202 0.194
NP_441021.1_8 Reverse -368 -386 1.29745 0.276
NP_441463.1_3 Reverse -82 -101 -1.96717 0.147
NP_441463.1_3 Forward -111 -92 -4.52377 0.207
NP_441463.1_3 Reverse -241 -260 -8.65367 0.272
NP_441626.1_2 Forward -100 -93 15.7721 0.0124
NP_441626.1_2 Reverse -93 -100 15.7721 0.0124
NP_441626.1_2 Forward -339 -332 6.0373 0.212
NP_441626.1_2 Reverse -332 -339 6.0373 0.212
NP_441626.1_2 Forward -259 -252 6.0373 0.212
NP_441626.1_2 Reverse -252 -259 6.0373 0.212
NP_442615.1_1 Reverse -83 -101 9.75391 0.0242
NP_442615.1_1 Forward -110 -92 -1.16082 0.125
NP_442615.1_1 Forward -349 -331 -2.14413 0.139
NP_442615.1_1 Reverse -242 -260 -2.63579 0.146
NP_442615.1_1 Reverse -322 -340 -5.88071 0.227
NP_440387.1_1 Reverse -92 -108 -1.12144 0.142
NP_440387.1_1 Forward -340 -324 -1.51476 0.143
NP_440387.1_1 Forward -101 -85 -2.5964 0.148
NP_441431.1_2 Reverse -89 -103 6.39049 0.272
NP_441836.1_2 Forward -107 -88 2.75272 0.165
NP_441836.1_2 Reverse -245 -264 -2.26216 0.229
NP_441836.1_2 Reverse -86 -105 -5.9004 0.288
NP_440114.1_10 Forward -101 -87 17.4042 0.0104
NP_440114.1_10 Reverse -92 -106 15.9292 0.0214
NP_440114.1_10 Forward -260 -246 7.86607 0.223
NP_440114.1_10 Forward -340 -326 6.58777 0.263
NP_440114.1_10 Reverse -331 -345 6.3911 0.273
NP_440114.1_10 Reverse -251 -265 5.99778 0.289
NP_442437.1_8 Reverse -81 -100 4.32602 0.261
NP_442698.1_10 Forward -41 -22 -0.983855 0.297
NP_441237.1_9 Reverse -252 -262 10.5998 0.224
NP_441237.1_9 Reverse -332 -342 10.5014 0.228
NP_439910.1_2 Reverse -84 -101 -12.5475 0.0894
NP_439910.1_2 Reverse -243 -260 -22.3806 0.232
NP_442867.1_8 Reverse -333 -352 4.12936 0.291
NP_440457.1_1 Forward -105 -93 8.9871 0.0988
NP_442680.1_5 Forward -41 -22 3.78447 0.227
NP_440801.1_8 Reverse -330 -349 3.44104 0.226
NP_442509.1_9 Reverse -331 -341 8.04271 0.192
NP_441253.1_8 Forward -345 -331 11.8274 0.229
NP_440554.1_4 Reverse -93 -103 17.9746 0.0131
NP_440554.1_4 Forward -100 -90 17.4829 0.0175
NP_440554.1_4 Forward -259 -249 10.2065 0.0579
NP_440554.1_4 Forward -339 -329 5.5849 0.139
NP_441845.1_6 Reverse -80 -98 3.16574 0.236
NP_441885.1_5 Reverse -331 -341 11.1898 0.00775
NP_441885.1_5 Forward -101 -91 10.1081 0.0145
NP_441885.1_5 Forward -340 -330 1.84832 0.0957
NP_441885.1_5 Reverse -92 -102 1.65166 0.106
NP_441885.1_5 Reverse -251 -261 1.455 0.11
NP_441885.1_5 Forward -260 -250 0.57002 0.137
NP_441173.1_9 Reverse -31 -39 10.9338 0.242
NP_440423.1_10 Forward -347 -328 12.2908 0.203
NP_443000.1_7 Forward -103 -93 20.3345 0.00223
NP_443000.1_7 Reverse -90 -100 10.1081 0.0376
NP_443000.1_7 Reverse -249 -259 9.91146 0.0408
NP_443000.1_7 Reverse -329 -339 1.06167 0.274
NP_443000.1_7 Forward -262 -252 0.57002 0.294
NP_443000.1_7 Forward -342 -332 0.471689 0.298
NP_441842.1_10 Forward -347 -333 10.9143 0.148
NP_441842.1_10 Reverse -85 -99 10.816 0.151
NP_440275.1_3 Forward -103 -93 16.1063 0.0155
NP_440275.1_3 Reverse -329 -339 15.8113 0.0178
NP_440275.1_3 Reverse -90 -100 10.1081 0.0449
NP_440275.1_3 Forward -262 -252 8.04317 0.0602
NP_440275.1_3 Reverse -249 -259 4.69992 0.178
NP_442932.1_9 Forward -362 -343 6.29264 0.249
NP_440091.1_1 Reverse -327 -339 10.8554 0.0429
NP_440091.1_1 Forward -264 -252 8.49544 0.065
NP_440091.1_1 Reverse -88 -100 5.54551 0.114
NP_440091.1_1 Reverse -247 -259 -0.649339 0.282
NP_440091.1_1 Forward -344 -332 -0.944332 0.3
NP_443010.1_10 Reverse -328 -345 2.96406 0.267
NP_443010.1_10 Reverse -248 -265 2.09436 0.283
NP_441105.1_3 Forward -112 -93 6.98095 0.0565
NP_441105.1_3 Reverse -240 -259 -4.52377 0.201
NP_441105.1_3 Reverse -81 -100 -4.81876 0.207
NP_440216.1_1 Reverse -92 -106 6.3911 0.0156
NP_440216.1_1 Forward -340 -326 -2.45868 0.0513
NP_440216.1_1 Forward -260 -246 -3.54032 0.0833
NP_440216.1_1 Reverse -331 -345 -11.2101 0.169
NP_440216.1_1 Forward -101 -87 -11.7018 0.212
NP_440172.1_1 Forward -101 -91 19.8429 0.00421
NP_440172.1_1 Forward -260 -250 10.0098 0.0572
NP_440172.1_1 Reverse -92 -102 7.84651 0.0718
NP_440172.1_1 Forward -340 -330 7.74818 0.0738
NP_440172.1_1 Reverse -331 -341 5.48657 0.143
NP_441226.1_7 Forward -100 -93 14.4934 0.0123
NP_441226.1_7 Reverse -93 -100 14.4934 0.0123
NP_441226.1_7 Forward -381 -374 8.29857 0.205
NP_441111.1_7 Reverse -93 -101 18.7023 0.00294
NP_441111.1_7 Reverse -332 -340 8.96754 0.0463
NP_441111.1_7 Reverse -252 -260 8.96754 0.0463
NP_441111.1_7 Forward -339 -331 8.86921 0.0589
NP_441111.1_7 Forward -100 -92 8.86921 0.0589
NP_442379.1_10 Reverse -85 -102 -3.5994 0.264
NP_440244.1_8 Reverse -6 -25 3.04771 0.27
NP_441766.1_2 Forward -101 -92 17.896 0.00297
NP_441766.1_2 Reverse -92 -101 9.4395 0.0285
NP_441766.1_2 Forward -260 -251 8.06287 0.0691
NP_441766.1_2 Reverse -331 -340 7.86621 0.0703
NP_441766.1_2 Forward -340 -331 7.66954 0.0723
NP_442179.1_3 Reverse -93 -112 11.5042 0.163
NP_440416.1_1 Forward -101 -82 4.62101 0.0658
NP_440416.1_1 Forward -340 -321 3.53937 0.0728
NP_440416.1_1 Forward -260 -241 -14.4552 0.288
NP_443052.1_8 Forward -350 -331 -10.522 0.21
NP_443052.1_8 Forward -270 -251 -11.8003 0.237
NP_443052.1_8 Reverse -82 -101 -13.3736 0.283
NP_440261.1_5 Forward -100 -87 -10.9938 0.23
NP_440261.1_5 Reverse -93 -106 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCGACAAGGTCTTTGATACCCATCCCCTATGTTCAATGGTCGGGGAACTGGTCCAAATTGGCGATCGTCTCTCATCCGATTTCCCTAAGTACACCAACTGCTCAATATCTGAAGCTTTAAAATCAGGTTTTTATAAAGTGGCGATCGTTTGCTCAATCTACTTTTGTAAATCCTGTTCATAAAGAGTTTTAGCCATTATAACTACCTTCTATATCAGGGCAATTCAATCCCAGTTGCTTTAGCATAGCGTTTAGTGTTCCAGTTTTTAGTTCATCACTAGGATTTCGCACAATGGTCAGGCGATCGCTTCTACACTGGGATTACGCACAGTCGCATATTTAACATCAAAGATAATTTAAATGGGCTAAAATAGCAAAATTATCAAACATTAGGTAAGCT

CDS

ATGATTGAAGATAATCAGTCCCACAATGAAAATATTAAAGAATATCTTAATTACTATAAAAAATTAGATTCTCCTGGTTTCGCCATTCTTTTAAAAGGTGAATGGGGATGTGGAAAAACCCATTTTATCAAGAATTATTTTCAATTGGAAGACAAAGAAAATAATGAAAGTTTTAATTTTAAAAAGAAATATTTTTCATTAAAAAACAATCAGCATAAGGAAAATTCAAAAGCAATATATATTAGTTTGTATGGAATTAAGGATATAGAATCTATTGATATTCTCATTATACAAAAACTTATACCCATCTTGGCAGATAGGAAAATTCAATTAACTGGCTCTGTTATAAATATTCTTTTAAAATCTTCATTGAAAATTGATTTAAAAGACTTAAAAAATACTAAAATTTTAAATGAGTTTACAAATCTAGATAATAAAATTCTAATCCTTGATGATTTAGAAAGGTGTAAAATTGACATCAATGATCTACTTGGTTATATTAATTTTTTTGTTGAGCATCAAGCACTCAAAGTTATTCTTATTGCTGATGAAGATAAAATTGAGGGAAACATAATTCAGTCTTATGAAACAAAGACATTTGACAAAATCAAAGAAAAGGTTATAGGTAAGAGATTTACTGTCAACACATCCTTTAATAAAGCTTTTGAACAATTTTTAAACTTAGTTTGTAAAGATGAACAAGAGAAAACATATTTATCTAAAAAACGAGACTTTATTAAAGAGCTATTTGAAACTAGTGACTCTAATAATTTAAGGACATTGAAATCAATAATTTATGATTTTGATCGTATTTATTCTTATTTACCTGAAAAAGCCTTAAATAATATTGATTTTCTTGATGATCTATTAAAGTCTCTGACCATTCTATCTATAGAAACTAAACTAGGTAATCTCCCAGAAGACCAGATAAAAATATTAAGCGATATATATGGTGAATATTCTTCAAATATTGCTTCAAATTACACAAAAATAAGTGAAAAAGTAAAAGAAAACTATAAATATGAACATTTTTTTACGTTTTGTCATCGATTACAATACAAATATGTTTTCAGTTTTGAATATTTTTTGCCTAATTATTTATGGTGGGGAGAATTTTTTGAACATGGCATAATTGACAAGCAAGCTTTGTATCATACATTCATCAACAGTAAGTATTATGTTAGTCAAGACTCTGAATTATGGCTTAAGCTTTATCACTATGATCGAATTGAATCCGATGAAATATTTGATGAATTAATAAATATTGCTATTGAGAAAATCAAAAATAGGGATCAATTTGAACATATTGGAATTTTTCTACATGTCATTTCTCTCTTAATATTTTTCTCTAAAGAAGAGTTAATTTCAGAAGATATAAGTATGCTAATTCAAATGGCAAAGGATTATATTCAACATTTTTCAATCACGAATGAAACTCGATTTTGGCAGGAAGTTCTAGAAATATCCAATTTTTCTTCAGAAACATATTTTGTACAATATAAAGAACTTGCGTTTACTAGTGACAATGACTCATATTTCGAAGAAATCAAGTTAACTATTGCAAGAAAAATGCGTTCTATTTATAATAATAACTATCTAAAGAAAATTAATCAAATTTTAGATACTAATCCTTTGAATCATTACCCACACATGAATCTTGCCGAATTAATCTATCGAAAAAATGACGAAATTGAATATTTTCTCCCTAAAGAAGAGTTTCTAAATAAAATTGACGTCAAAAAATCAACTGATTATTTTTTAAAGATAAGCTCTTTTCAACAAGGTCATATTCTTTATTCAATTTTTAATTATTTTCAGTTGCTATATCACCATAATGAACACAAATCATGTATTGGCTATGAGGCTTGTTTTATCTGTGAATTTTTAATTGTAGTTGAGTATAGAAGCATTGAGGCAATTCAAGAGAACAACAGGTTAAATAATCATAAAATCCAAAAAAATTTAAATAAATATTTAACTGTTAAAACAACTCAGGCTTTAGGCGCATTTATTGTATATATTATTGATTATTATATTTCTCTTATTAGGCAATACAAGAAATATATTGCTTATTCTCCTGCTATTGTTAATAAAATAAATAAACTCATAGGAATAATGTTTTTTAATCAAAAACCTGATAGCTTTTAA

Protein

MIEDNQSHNENIKEYLNYYKKLDSPGFAILLKGEWGCGKTHFIKNYFQLEDKENNESFNFKKKYFSLKNNQHKENSKAIYISLYGIKDIESIDILIIQKLIPILADRKIQLTGSVINILLKSSLKIDLKDLKNTKILNEFTNLDNKILILDDLERCKIDINDLLGYINFFVEHQALKVILIADEDKIEGNIIQSYETKTFDKIKEKVIGKRFTVNTSFNKAFEQFLNLVCKDEQEKTYLSKKRDFIKELFETSDSNNLRTLKSIIYDFDRIYSYLPEKALNNIDFLDDLLKSLTILSIETKLGNLPEDQIKILSDIYGEYSSNIASNYTKISEKVKENYKYEHFFTFCHRLQYKYVFSFEYFLPNYLWWGEFFEHGIIDKQALYHTFINSKYYVSQDSELWLKLYHYDRIESDEIFDELINIAIEKIKNRDQFEHIGIFLHVISLLIFFSKEELISEDISMLIQMAKDYIQHFSITNETRFWQEVLEISNFSSETYFVQYKELAFTSDNDSYFEEIKLTIARKMRSIYNNNYLKKINQILDTNPLNHYPHMNLAELIYRKNDEIEYFLPKEEFLNKIDVKKSTDYFLKISSFQQGHILYSIFNYFQLLYHHNEHKSCIGYEACFICEFLIVVEYRSIEAIQENNRLNNHKIQKNLNKYLTVKTTQALGAFIVYIIDYYISLIRQYKKYIAYSPAIVNKINKLIGIMFFNQKPDSF