Your browser is old and dusty. Try Google Chrome!

Details for slr1134

ORF slr1134
Accession NP_440605.1
Symbol
Category mutator MutT homolog
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -43 -29 14.4542 0.0392
NP_441061.1_2 Reverse -36 -50 12.586 0.0452
NP_441061.1_2 Reverse -148 -162 6.19444 0.123
NP_441061.1_2 Forward -37 -23 -2.06536 0.281
NP_440795.1_7 Forward -43 -36 14.6904 0.0123
NP_440795.1_7 Reverse -36 -43 14.6904 0.0123
NP_440795.1_7 Forward -310 -303 10.2655 0.154
NP_441418.1_6 Forward -317 -298 -28.0249 0.203
NP_441418.1_6 Reverse -35 -54 -29.6965 0.234
NP_442291.1_5 Reverse -34 -50 22.0847 0.0165
NP_442291.1_5 Forward -45 -29 -1.61309 0.201
NP_441453.1_4 Reverse -35 -43 16.539 0.00633
NP_441453.1_4 Forward -44 -36 16.539 0.00633
NP_442151.1_6 Forward -44 -30 17.2075 0.0113
NP_442151.1_6 Reverse -35 -49 7.76774 0.19
NP_442151.1_6 Forward -311 -297 5.21113 0.288
NP_442151.1_6 Reverse -86 -100 5.01447 0.298
NP_441818.1_1 Reverse -36 -47 18.8393 0.00301
NP_441818.1_1 Forward -43 -32 10.1862 0.232
NP_440226.1_1 Reverse -35 -54 9.83255 0.0687
NP_440931.1_9 Forward -52 -33 9.24257 0.257
NP_440150.1_2 Forward -42 -23 4.52188 0.281
NP_442744.1_9 Forward -50 -36 17.5862 0.266
NP_442655.1_10 Forward -317 -298 -12.1936 0.261
NP_442173.1_1 Forward -43 -35 15.4574 0.00633
NP_442173.1_1 Reverse -36 -44 15.4574 0.00633
NP_442173.1_6 Forward -308 -294 14.0609 0.118
NP_442752.1_4 Forward -44 -37 13.8055 0.0199
NP_442752.1_4 Reverse -35 -42 13.8055 0.0199
NP_443027.1_4 Forward -46 -36 14.0414 0.0452
NP_443027.1_4 Forward -370 -360 8.33817 0.207
NP_440613.1_1 Forward -277 -258 14.6508 0.202
NP_441812.1_3 Reverse -34 -48 11.5043 0.21
NP_441812.1_3 Reverse -358 -372 9.14437 0.245
NP_442975.1_10 Forward -48 -34 13.1753 0.0459
NP_442975.1_10 Reverse -31 -45 11.2087 0.0508
NP_440784.1_7 Forward -43 -36 15.9687 0.0123
NP_440784.1_7 Reverse -36 -43 15.9687 0.0123
NP_440784.1_7 Forward -155 -148 4.16902 0.277
NP_442909.1_7 Forward -43 -29 11.307 0.131
NP_442909.1_7 Reverse -36 -50 8.84875 0.161
NP_441054.1_1 Reverse -28 -42 15.5359 0.211
NP_439979.1_9 Reverse -148 -166 7.09898 0.288
NP_439979.1_9 Forward -316 -298 7.00065 0.288
NP_442062.1_8 Forward -44 -34 17.3846 0.00193
NP_442062.1_8 Reverse -35 -45 17.3846 0.00193
NP_442062.1_8 Reverse -147 -157 3.81494 0.252
NP_442062.1_8 Forward -65 -55 2.83163 0.293
NP_441859.1_3 Reverse -34 -53 5.2102 0.206
NP_441859.1_5 Forward -298 -279 2.0644 0.296
NP_440304.1_4 Forward -46 -36 10.8948 0.051
NP_440304.1_4 Forward -313 -303 7.94484 0.094
NP_440304.1_4 Forward -191 -181 5.09324 0.229
NP_440304.1_4 Reverse -145 -155 3.42162 0.299
NP_440304.1_4 Reverse -33 -43 1.84832 0.299
NP_442242.1_4 Forward -43 -36 14.3954 0.0124
NP_442242.1_4 Reverse -36 -43 14.3954 0.0124
NP_440044.1_8 Forward -43 -24 12.2908 0.0427
NP_440044.1_8 Reverse -36 -55 11.4058 0.0497
NP_440044.1_8 Reverse -303 -322 4.81767 0.11
NP_441781.1_7 Forward -44 -25 4.32602 0.186
NP_439918.1_2 Reverse -17 -36 -2.45882 0.244
NP_441620.1_3 Forward -51 -32 10.9142 0.297
NP_441352.1_2 Forward -318 -299 2.94938 0.222
NP_441619.1_8 Reverse -29 -43 13.1753 0.115
NP_441208.1_1 Forward -97 -78 5.01433 0.176
NP_441594.1_6 Reverse -26 -45 7.86593 0.169
NP_441594.1_6 Forward -53 -34 3.53937 0.227
NP_442110.1_7 Forward -44 -30 9.63603 0.0715
NP_442110.1_7 Reverse -147 -161 9.2427 0.0755
NP_442110.1_7 Reverse -23 -37 2.35953 0.222
NP_442110.1_7 Reverse -302 -316 0.491246 0.259
NP_442110.1_7 Reverse -35 -49 0.196253 0.266
NP_442726.1_1 Reverse -8 -27 13.1758 0.161
NP_440856.1_1 Reverse -25 -44 -4.6221 0.252
NP_440856.1_4 Forward -123 -104 -5.70374 0.297
NP_441083.1_5 Forward -44 -34 20.3345 0.00053
NP_441083.1_5 Reverse -35 -45 20.3345 0.00053
NP_440645.1_5 Reverse -243 -262 24.4839 0.00134
NP_441738.1_2 Forward -42 -35 15.28 0.0102
NP_441738.1_2 Reverse -37 -44 15.28 0.0102
NP_441738.1_4 Reverse -25 -44 5.80098 0.206
NP_441558.1_5 Forward -313 -294 10.6192 0.0955
NP_441558.1_5 Forward -46 -27 4.81767 0.269
NP_441558.1_5 Reverse -357 -376 4.03102 0.293
NP_441942.1_7 Forward -74 -55 16.4207 0.277
NP_440209.1_1 Reverse -35 -43 18.1123 0.00295
NP_440209.1_1 Forward -44 -36 18.1123 0.00295
NP_442889.1_1 Reverse -147 -166 -15.3402 0.289
NP_442889.1_8 Forward -47 -33 13.1753 0.0588
NP_442889.1_8 Reverse -32 -46 10.9137 0.077
NP_440056.1_1 Forward -37 -18 7.66927 0.297
NP_441770.1_1 Reverse -301 -320 12.585 0.277
NP_441770.1_4 Forward -220 -201 -11.9969 0.29
NP_441770.1_4 Reverse -195 -214 -12.0953 0.291
NP_441770.1_5 Reverse -27 -46 2.16274 0.238
NP_441770.1_5 Reverse -139 -158 -1.08219 0.261
NP_441770.1_5 Forward -52 -33 -1.67217 0.277
NP_441783.1_2 Reverse -304 -313 17.2076 0.108
NP_440178.1_7 Reverse -34 -53 -14.8485 0.156
NP_442706.1_5 Reverse -169 -188 13.4399 0.26
NP_442570.1_3 Reverse -20 -39 -4.91709 0.237
NP_442445.1_2 Reverse -280 -299 7.96426 0.288
NP_441716.1_1 Reverse -35 -49 10.7177 0.0936
NP_442111.1_4 Forward -45 -31 3.14618 0.253
NP_441163.1_1 Forward -45 -28 8.00291 0.233
NP_440906.1_5 Forward -43 -36 15.8704 0.0124
NP_440906.1_5 Reverse -36 -43 15.8704 0.0124
NP_440747.1_10 Reverse -32 -44 14.9853 0.00221
NP_440747.1_10 Forward -47 -35 7.51213 0.00286
NP_441130.1_10 Forward -46 -32 7.86607 0.146
NP_442973.1_5 Reverse -26 -45 12.3892 0.206
NP_441486.1_1 Forward -47 -33 23.5007 0.00162
NP_441486.1_1 Reverse -32 -46 21.3374 0.00239
NP_441486.1_1 Forward -159 -145 -3.54032 0.179
NP_442634.1_4 Reverse -105 -119 -5.80194 0.279
NP_442634.1_4 Forward -72 -58 -6.09693 0.299
NP_440403.1_10 Forward -53 -34 6.98095 0.212
NP_441014.1_2 Forward -183 -164 15.9291 0.245
NP_441014.1_9 Forward -326 -307 6.78429 0.217
NP_441014.1_10 Reverse -34 -53 2.75194 0.216
NP_442848.1_1 Forward -50 -36 6.6861 0.0791
NP_442848.1_1 Reverse -29 -43 6.3911 0.0791
NP_442848.1_1 Forward -162 -148 1.08123 0.25
NP_442848.1_1 Forward -317 -303 -3.24533 0.263
NP_442848.1_4 Reverse -152 -166 9.63603 0.282
NP_442848.1_5 Forward -39 -21 4.6407 0.276
NP_441012.1_4 Reverse -304 -317 10.4424 0.262
NP_441012.1_4 Reverse -274 -287 8.37742 0.272
NP_443018.1_3 Forward -43 -36 14.8871 0.0123
NP_443018.1_3 Reverse -36 -43 14.8871 0.0123
NP_443018.1_3 Forward -310 -303 4.36568 0.254
NP_443018.1_3 Reverse -303 -310 4.07068 0.299
NP_441634.1_8 Forward -46 -32 2.2612 0.169
NP_441634.1_8 Reverse -33 -47 -4.62196 0.295
NP_441634.1_8 Reverse -362 -376 -4.7203 0.295
NP_440376.1_1 Forward -44 -35 19.4693 0.000692
NP_440376.1_1 Reverse -35 -44 19.4693 0.000692
NP_440376.1_1 Reverse -245 -254 1.37636 0.252
NP_441588.1_4 Forward -42 -32 18.1713 0.0143
NP_441588.1_4 Reverse -37 -47 8.63316 0.14
NP_442687.1_7 Reverse -106 -116 13.648 0.0447
NP_442687.1_7 Reverse -301 -311 9.22315 0.0994
NP_442687.1_7 Forward -45 -35 8.92815 0.0994
NP_442687.1_7 Reverse -34 -44 8.92815 0.0994
NP_442191.1_4 Forward -316 -302 11.0901 0.271
NP_442485.1_3 Reverse -297 -316 2.0644 0.215
NP_441846.1_10 Forward -320 -301 -21.24 0.256
NP_441846.1_10 Forward -322 -303 -23.6983 0.295
NP_441422.1_7 Reverse -300 -317 -3.30441 0.233
NP_442296.1_9 Forward -43 -24 0.884433 0.197
NP_440360.1_5 Reverse -290 -309 2.55606 0.297
NP_440360.1_10 Reverse -211 -225 2.65453 0.261
NP_442658.1_1 Reverse -33 -43 6.76441 0.214
NP_442658.1_1 Forward -46 -36 6.76441 0.214
NP_442658.1_1 Forward -313 -303 5.78111 0.25
NP_442658.1_1 Reverse -145 -155 5.28945 0.274
NP_440141.1_3 Reverse -84 -103 0.982764 0.274
NP_442782.1_2 Reverse -107 -121 0.0979218 0.296
NP_442782.1_7 Forward -52 -33 10.9142 0.109
NP_442205.1_9 Forward -50 -34 -2.98973 0.277
NP_440656.1_8 Forward -55 -36 3.04771 0.112
NP_441414.1_9 Reverse -35 -54 -8.94866 0.249
NP_442937.1_5 Reverse -30 -49 15.9291 0.0502
NP_442937.1_5 Reverse -24 -43 15.1424 0.0621
NP_442937.1_5 Forward -49 -30 10.4225 0.161
NP_441958.1_5 Forward -45 -35 12.2714 0.00183
NP_441958.1_5 Reverse -34 -44 12.2714 0.00183
NP_441127.1_1 Forward -311 -297 11.5043 0.22
NP_441127.1_1 Forward -314 -300 7.66941 0.3
NP_442836.1_5 Reverse -29 -48 4.52268 0.206
NP_442836.1_5 Forward -50 -31 3.93269 0.222
NP_439990.1_5 Reverse -30 -43 10.049 0.128
NP_442911.1_2 Forward -54 -35 -4.13045 0.126
NP_440153.1_5 Reverse -36 -50 5.40779 0.191
NP_440153.1_8 Reverse -302 -315 7.09911 0.168
NP_440153.1_8 Reverse -296 -309 -2.63565 0.246
NP_440153.1_8 Reverse -61 -74 -3.32397 0.295
NP_443055.1_3 Forward -53 -34 10.4542 0.289
NP_443055.1_6 Forward -156 -138 2.57501 0.206
NP_443055.1_6 Forward -178 -160 -1.35821 0.277
NP_440993.1_4 Forward -37 -20 9.87194 0.213
NP_440602.1_8 Reverse -35 -49 15.6342 0.116
NP_443044.1_1 Reverse -352 -371 10.8159 0.212
NP_441099.1_5 Reverse -25 -44 -1.96717 0.115
NP_441294.1_7 Reverse -31 -45 17.8896 0.00674
NP_441294.1_7 Forward -48 -34 14.914 0.033
NP_441646.1_1 Reverse -28 -47 13.5691 0.0879
NP_441646.1_1 Reverse -22 -41 4.42435 0.193
NP_442438.1_10 Reverse -30 -44 7.47274 0.0933
NP_442438.1_10 Forward -49 -35 -0.295402 0.256
NP_441000.1_6 Reverse -34 -48 -4.7203 0.251
NP_440605.1_1 Forward -206 -187 26.3246 0.00183
NP_440605.1_2 Forward -88 -69 27.4338 0.0021
NP_440605.1_3 Forward -145 -127 30.4034 0.0000821
NP_440605.1_4 Forward -126 -107 16.6773 0.114
NP_440605.1_5 Forward -256 -238 23.1269 0.0188
NP_440605.1_6 Forward -186 -167 22.6716 0.0567
NP_440605.1_8 Forward -228 -209 27.3355 0.00343
NP_440605.1_9 Forward -34 -18 19.1655 0.234
NP_440605.1_10 Forward -298 -280 23.7169 0.0231
NP_440147.1_4 Reverse -33 -46 11.3273 0.0326
NP_440147.1_4 Forward -118 -105 3.46087 0.187
NP_440147.1_4 Forward -46 -33 2.18257 0.209
NP_440147.1_4 Reverse -300 -313 0.215946 0.261
NP_441550.1_8 Reverse -33 -43 14.6309 0.0132
NP_441550.1_8 Forward -46 -36 12.3692 0.0336
NP_441916.1_7 Forward -44 -34 10.3048 0.0261
NP_441916.1_7 Reverse -35 -45 10.3048 0.0261
NP_441916.1_10 Forward -52 -33 12.0942 0.126
NP_441916.1_10 Reverse -258 -277 2.16274 0.251
NP_441041.1_1 Forward -320 -301 11.4058 0.198
NP_441041.1_4 Forward -323 -304 -1.47551 0.1
NP_441041.1_4 Forward -311 -292 -4.52377 0.138
NP_441041.1_4 Reverse -23 -42 -4.81876 0.143
NP_441041.1_4 Forward -317 -298 -9.63698 0.219
NP_441041.1_4 Forward -44 -25 -12.1936 0.26
NP_441041.1_7 Reverse -32 -44 11.8878 0.0689
NP_441547.1_2 Reverse -24 -42 13.6872 0.0948
NP_441547.1_2 Forward -298 -280 2.87075 0.294
NP_442004.1_6 Forward -44 -30 8.84938 0.14
NP_441725.1_5 Reverse -36 -46 11.2881 0.0247
NP_441725.1_5 Reverse -154 -164 2.83163 0.115
NP_441725.1_5 Forward -43 -33 2.04498 0.115
NP_441725.1_5 Reverse -148 -158 0.176696 0.206
NP_441725.1_5 Reverse -181 -191 0.0783647 0.215
NP_439966.1_7 Forward -46 -36 15.8108 0.0124
NP_439966.1_7 Forward -158 -148 8.53436 0.135
NP_439966.1_7 Reverse -33 -43 7.25606 0.15
NP_442941.1_3 Reverse -36 -46 19.9412 0.00262
NP_442941.1_3 Forward -43 -33 11.0914 0.0116
NP_442941.1_3 Reverse -148 -158 0.57002 0.199
NP_440289.1_2 Forward -47 -34 13.294 0.0132
NP_440289.1_2 Reverse -32 -45 4.54251 0.066
NP_440289.1_2 Reverse -136 -149 -4.9956 0.294
NP_440983.1_5 Forward -44 -25 -4.91709 0.261
NP_440260.1_8 Forward -276 -258 -6.1757 0.287
NP_440260.1_8 Reverse -26 -44 -6.96235 0.295
NP_442281.1_1 Forward -49 -35 17.8952 0.00513
NP_442281.1_1 Reverse -30 -44 16.2235 0.0087
NP_442049.1_6 Reverse -20 -39 3.24438 0.276
NP_442049.1_6 Reverse -27 -46 3.14605 0.281
NP_441556.1_10 Reverse -148 -162 13.3366 0.182
NP_441644.1_6 Forward -44 -34 17.3841 0.00127
NP_441644.1_6 Reverse -35 -45 17.3841 0.00127
NP_441644.1_6 Forward -368 -358 8.3377 0.103
NP_441644.1_6 Reverse -302 -312 5.09279 0.21
NP_443049.1_6 Reverse -138 -148 15.0567 0.114
NP_440867.1_10 Forward -171 -152 10.0292 0.25
NP_442215.1_2 Forward -46 -30 7.33503 0.0692
NP_442215.1_2 Reverse -33 -49 5.17175 0.0796
NP_442215.1_2 Reverse -26 -42 -7.11963 0.286
NP_442177.1_5 Reverse -26 -40 11.701 0.22
NP_442247.1_7 Forward -47 -28 5.60432 0.259
NP_440253.1_2 Reverse -35 -53 9.0656 0.0519
NP_440929.1_8 Forward -44 -35 19.2726 0.000701
NP_440929.1_8 Reverse -35 -44 19.2726 0.000701
NP_440929.1_8 Forward -91 -82 0.884706 0.293
NP_440566.1_2 Reverse -127 -146 8.16093 0.206
NP_442933.1_10 Forward -44 -35 17.601 0.00325
NP_442933.1_10 Reverse -35 -44 17.601 0.00325
NP_442933.1_10 Reverse -147 -156 5.99792 0.151
NP_441751.2_8 Reverse -36 -50 15.3392 0.0119
NP_441751.2_8 Forward -43 -29 5.30946 0.0448
NP_441751.2_8 Reverse -148 -162 -5.60527 0.223
NP_442926.1_5 Reverse -142 -161 9.979 0.264
NP_442554.1_8 Reverse -36 -46 15.9097 0.00747
NP_442554.1_8 Forward -43 -33 15.3197 0.00882
NP_442554.1_8 Reverse -303 -313 8.53483 0.074
NP_442554.1_8 Forward -367 -357 4.0116 0.2
NP_441762.1_7 Forward -45 -33 0.432302 0.0747
NP_441762.1_7 Forward -312 -300 -6.84419 0.284
NP_441762.1_7 Reverse -34 -46 -6.84419 0.284
NP_442142.1_4 Forward -47 -34 14.1783 0.0311
NP_442142.1_4 Reverse -32 -45 10.9334 0.0646
NP_442292.1_1 Forward -43 -34 18.486 0.00229
NP_442292.1_1 Reverse -36 -45 18.486 0.00229
NP_442292.1_1 Reverse -303 -312 5.01461 0.168
NP_440511.1_1 Forward -321 -303 6.50899 0.228
NP_440045.1_3 Forward -121 -104 8.00291 0.254
NP_440895.1_6 Reverse -29 -42 9.16406 0.228
NP_442381.1_2 Forward -165 -151 18.6825 0.212
NP_443009.1_5 Reverse -34 -45 8.90795 0.0965
NP_443009.1_5 Forward -45 -34 8.90795 0.0965
NP_443009.1_5 Forward -157 -146 4.28642 0.254
NP_442301.1_2 Reverse -301 -320 5.01354 0.269
NP_442408.2_1 Forward -254 -235 -6.88371 0.287
NP_441715.1_4 Reverse -36 -46 14.828 0.0268
NP_441715.1_4 Forward -43 -33 7.94484 0.107
NP_440881.1_4 Forward -253 -234 1.47442 0.226
NP_440730.1_4 Forward -205 -186 4.42435 0.237
NP_441448.1_1 Forward -229 -210 9.24257 0.198
NP_441198.1_8 Forward -164 -154 10.3415 0.28
NP_440379.1_5 Forward -320 -301 -7.17871 0.24
NP_440464.1_10 Forward -43 -33 13.0082 0.169
NP_441468.1_1 Forward -43 -36 15.8704 0.0124
NP_441468.1_1 Reverse -36 -43 15.8704 0.0124
NP_441468.1_1 Forward -310 -303 4.46401 0.224
NP_442099.1_1 Forward -43 -25 13.1955 0.274
NP_441020.2_6 Forward -277 -260 11.5436 0.117
NP_441020.2_6 Forward -319 -302 10.7569 0.136
NP_441020.2_6 Reverse -145 -162 7.41366 0.232
NP_441020.2_6 Forward -313 -296 5.64371 0.293
NP_441015.1_10 Forward -316 -297 18.4857 0.0218
NP_441015.1_10 Forward -103 -84 -4.91709 0.214
NP_441673.1_1 Forward -44 -35 20.8459 0.000698
NP_441673.1_1 Reverse -35 -44 20.8459 0.000698
NP_441673.1_1 Forward -311 -302 -8.06341 0.254
NP_441339.1_4 Reverse -22 -41 14.3558 0.0899
NP_441826.1_2 Forward -50 -36 12.6843 0.0262
NP_441826.1_2 Reverse -29 -43 6.98109 0.0899
NP_441826.1_2 Forward -44 -30 -0.197071 0.204
NP_441826.1_5 Forward -320 -301 1.57275 0.289
NP_442490.1_9 Reverse -23 -42 -8.752 0.293
NP_442868.1_6 Forward -46 -36 9.91146 0.038
NP_442868.1_6 Reverse -33 -43 9.81313 0.038
NP_442719.1_2 Reverse -203 -221 -7.55303 0.235
NP_442719.1_2 Reverse -173 -191 -9.61797 0.267
NP_441056.1_1 Forward -44 -25 2.45773 0.137
NP_441056.1_1 Reverse -35 -54 -1.37718 0.181
NP_441612.1_2 Reverse -328 -338 13.0027 0.21
NP_441612.1_2 Reverse -35 -45 8.54929 0.21
NP_441612.1_2 Forward -44 -34 8.54929 0.21
NP_442227.1_2 Reverse -301 -320 2.3594 0.233
NP_442227.1_2 Reverse -208 -227 -3.63879 0.294
NP_442361.1_3 Reverse -29 -42 7.59077 0.3
NP_442808.1_1 Reverse -34 -44 8.63269 0.0481
NP_442808.1_1 Forward -45 -35 8.63269 0.0481
NP_442808.1_1 Reverse -301 -311 7.25606 0.0831
NP_440145.1_3 Forward -54 -35 1.27776 0.129
NP_442113.1_10 Reverse -295 -314 -4.32711 0.224
NP_442050.1_5 Forward -46 -36 16.4991 0.00812
NP_442050.1_5 Reverse -33 -43 7.64939 0.243
NP_441114.1_3 Forward -36 -27 7.37455 0.239
NP_440558.1_2 Forward -41 -22 3.83436 0.153
NP_440558.1_2 Forward -53 -34 1.0811 0.185
NP_440558.1_2 Reverse -58 -77 -1.08219 0.208
NP_440558.1_2 Reverse -299 -318 -6.78538 0.28
NP_440558.1_2 Reverse -26 -45 -7.57203 0.296
NP_442789.1_4 Forward -277 -258 -1.37718 0.219
NP_441518.1_3 Forward -54 -35 4.22769 0.05
NP_442792.1_5 Forward -316 -299 8.69197 0.296
NP_441878.1_6 Forward -45 -35 10.4031 0.0176
NP_441878.1_6 Reverse -34 -44 10.4031 0.0176
NP_441878.1_6 Reverse -146 -156 1.55333 0.0937
NP_441878.1_6 Forward -312 -302 -7.0998 0.204
NP_441878.1_6 Forward -71 -61 -7.88644 0.278
NP_441036.1_8 Forward -45 -35 8.33817 0.174
NP_441036.1_8 Reverse -34 -44 8.33817 0.174
NP_442650.1_2 Forward -44 -30 8.45605 0.13
NP_441557.1_5 Forward -44 -35 19.9609 0.000699
NP_441557.1_5 Reverse -35 -44 19.9609 0.000699
NP_441557.1_5 Forward -156 -147 -0.491928 0.193
NP_441445.1_1 Forward -53 -34 15.5357 0.0437
NP_441445.1_1 Reverse -26 -45 -0.000545616 0.283
NP_441590.1_4 Reverse -303 -322 4.12856 0.29
NP_441433.1_8 Forward -64 -45 -3.83545 0.285
NP_441458.1_10 Reverse -26 -45 16.7157 0.0689
NP_441458.1_10 Reverse -299 -318 2.3594 0.269
NP_442183.1_1 Reverse -35 -49 16.6175 0.0139
NP_442183.1_1 Forward -44 -30 7.27608 0.145
NP_442135.1_8 Forward -55 -37 11.6222 0.207
NP_439980.1_1 Reverse -24 -43 14.5672 0.288
NP_441574.1_1 Reverse -23 -42 4.12936 0.139
NP_442347.1_2 Forward -43 -34 12.4878 0.056
NP_442347.1_2 Reverse -36 -45 12.4878 0.056
NP_442645.1_2 Forward -52 -33 -6.88371 0.0969
NP_442645.1_2 Reverse -27 -46 -15.0452 0.189
NP_442645.1_2 Forward -46 -27 -21.535 0.29
NP_441037.1_4 Reverse -33 -43 7.9999 0.237
NP_441037.1_4 Forward -313 -303 5.85583 0.296
NP_441633.1_3 Reverse -33 -46 1.10092 0.109
NP_441633.1_3 Forward -46 -33 -5.97891 0.236
NP_441633.1_3 Forward -158 -145 -6.96221 0.283
NP_440136.1_2 Forward -43 -36 15.9687 0.0123
NP_440136.1_2 Reverse -36 -43 15.9687 0.0123
NP_442590.1_10 Forward -44 -25 3.6377 0.289
NP_442998.1_5 Reverse -289 -299 12.7631 0.159
NP_442998.1_5 Forward -53 -43 9.81313 0.233
NP_442998.1_10 Forward -42 -35 15.5754 0.0102
NP_442998.1_10 Reverse -37 -44 15.5754 0.0102
NP_440299.1_1 Reverse -31 -44 14.08 0.0259
NP_440299.1_1 Reverse -298 -311 6.60689 0.136
NP_440299.1_1 Forward -48 -35 4.44361 0.207
NP_441799.1_1 Forward -48 -34 10.0287 0.0797
NP_441799.1_1 Reverse -31 -45 6.98048 0.155
NP_440640.1_6 Forward -320 -301 2.55606 0.235
NP_441007.1_10 Forward -316 -303 11.4257 0.064
NP_441007.1_10 Reverse -30 -43 2.57589 0.183
NP_441007.1_10 Forward -49 -36 0.510939 0.226
NP_442201.1_10 Reverse -24 -43 -14.2585 0.28
NP_440256.1_1 Reverse -32 -51 2.65439 0.0619
NP_440256.1_1 Forward -47 -28 -3.63879 0.137
NP_440915.1_3 Forward -316 -297 13.0775 0.214
NP_440915.1_6 Reverse -31 -45 4.42448 0.0953
NP_441296.1_9 Forward -254 -241 9.06515 0.286
NP_440748.1_5 Forward -41 -22 4.12936 0.201
NP_440695.1_6 Reverse -292 -306 13.9988 0.233
NP_441939.1_3 Forward -43 -24 7.57094 0.198
NP_442993.1_1 Reverse -35 -51 2.12349 0.0502
NP_442993.1_1 Forward -44 -28 -8.49626 0.168
NP_442993.1_1 Forward -71 -55 -14.2978 0.298
NP_442386.1_9 Reverse -34 -43 13.8639 0.0289
NP_442386.1_9 Forward -45 -36 13.8639 0.0289
NP_442386.1_9 Reverse -301 -310 6.9808 0.219
NP_440570.1_5 Forward -291 -272 -2.0655 0.277
NP_440570.1_5 Reverse -19 -38 -3.24547 0.289
NP_441750.1_1 Forward -107 -88 -1.18052 0.204
NP_441750.1_1 Forward -320 -301 -12.2919 0.3
NP_441340.1_5 Forward -43 -36 15.6737 0.0124
NP_441340.1_5 Reverse -36 -43 15.6737 0.0124
NP_441340.1_5 Reverse -303 -310 3.97235 0.274
NP_441947.1_10 Reverse -243 -261 -0.570838 0.276
NP_442484.1_2 Reverse -24 -43 0.786102 0.244
NP_440327.1_6 Reverse -17 -36 10.7175 0.189
NP_441160.1_6 Reverse -304 -323 4.32602 0.19
NP_440586.1_1 Forward -279 -260 1.67108 0.231
NP_440586.1_1 Forward -321 -302 0.196116 0.237
NP_440586.1_8 Forward -43 -36 13.2151 0.026
NP_440586.1_8 Reverse -36 -43 13.2151 0.026
NP_442251.1_6 Forward -43 -36 15.2804 0.0124
NP_442251.1_6 Reverse -36 -43 15.2804 0.0124
NP_442959.1_5 Reverse -168 -187 12.3892 0.222
NP_440684.1_9 Forward -50 -36 18.7808 0.0363
NP_440684.1_9 Reverse -29 -43 18.2892 0.0378
NP_441262.1_3 Reverse -35 -42 14.7888 0.0223
NP_441262.1_3 Forward -44 -37 14.7888 0.0223
NP_440027.1_3 Forward -162 -144 6.1149 0.23
NP_440027.1_3 Forward -327 -309 5.03327 0.249
NP_440027.1_3 Reverse -302 -320 4.34495 0.262
NP_440027.1_8 Forward -47 -28 5.60352 0.279
NP_440027.1_8 Reverse -32 -51 3.9319 0.294
NP_443051.1_1 Reverse -34 -43 10.4228 0.00754
NP_443051.1_1 Forward -45 -36 10.4228 0.00754
NP_443051.1_1 Forward -312 -303 0.393051 0.169
NP_439984.1_7 Reverse -65 -83 -4.99573 0.292
NP_439937.1_8 Forward -289 -270 0.687771 0.235
NP_439937.1_9 Reverse -301 -318 -11.3682 0.251
NP_440836.1_1 Reverse -246 -265 7.96426 0.222
NP_440372.1_2 Forward -43 -36 16.3621 0.0124
NP_440372.1_2 Reverse -36 -43 16.3621 0.0124
NP_441789.1_7 Reverse -88 -107 -4.1312 0.28
NP_440316.1_10 Forward -312 -302 14.828 0.179
NP_441803.1_2 Forward -49 -30 9.93088 0.0928
NP_441803.1_2 Reverse -303 -322 8.16093 0.12
NP_439977.1_5 Reverse -296 -315 1.0811 0.196
NP_439977.1_7 Forward -304 -285 10.9134 0.266
NP_440139.1_1 Forward -50 -31 6.68515 0.139
NP_440267.1_2 Forward -49 -35 9.43874 0.156
NP_442384.1_10 Forward -44 -31 10.049 0.047
NP_442384.1_10 Reverse -35 -48 1.10092 0.268
NP_441877.1_7 Forward -49 -30 1.86696 0.241
NP_441018.1_7 Reverse -25 -44 15.5357 0.102
NP_442262.1_10 Forward -43 -36 14.1988 0.0123
NP_442262.1_10 Reverse -36 -43 14.1988 0.0123
NP_441689.1_5 Forward -46 -36 15.3192 0.0403
NP_441689.1_5 Reverse -33 -43 5.78111 0.197
NP_440163.1_10 Forward -47 -37 11.3864 0.169
NP_440344.1_10 Reverse -28 -45 11.2486 0.0063
NP_440344.1_10 Forward -51 -34 1.8088 0.0294
NP_440282.1_3 Forward -43 -24 -5.01543 0.298
NP_440282.1_10 Forward -378 -359 -7.86702 0.254
NP_440282.1_10 Forward -42 -23 -8.752 0.263
NP_440189.1_2 Reverse -27 -46 -0.590531 0.289
NP_441965.1_3 Reverse -25 -44 0.884433 0.227
NP_440297.1_9 Reverse -36 -46 9.32148 0.0917
NP_440297.1_9 Forward -43 -33 -0.118297 0.282
NP_440297.1_9 Forward -367 -357 -0.41329 0.283
NP_441592.1_4 Forward -44 -25 6.68596 0.124
NP_441592.1_4 Reverse -161 -180 -1.37718 0.254
NP_441894.1_1 Forward -111 -92 -3.54046 0.174
NP_440999.1_9 Reverse -31 -45 4.22782 0.116
NP_440999.1_9 Reverse -298 -312 0.687908 0.177
NP_440888.1_2 Reverse -35 -49 15.4369 0.0107
NP_440888.1_2 Reverse -302 -316 12.6836 0.0405
NP_440888.1_2 Forward -44 -30 11.2087 0.0729
NP_440888.1_2 Reverse -245 -259 8.16044 0.171
NP_440888.1_2 Forward -253 -239 5.70218 0.267
NP_440888.1_2 Reverse -147 -161 5.01387 0.298
NP_440491.1_1 Forward -47 -28 16.8577 0.0567
NP_440052.1_5 Reverse -24 -43 -2.36049 0.212
NP_442033.1_10 Reverse -300 -319 -14.3569 0.298
NP_442871.1_4 Reverse -304 -323 -9.73604 0.283
NP_441543.1_2 Forward -43 -34 16.9127 0.00359
NP_441543.1_2 Reverse -36 -45 16.9127 0.00359
NP_441543.1_2 Reverse -303 -312 4.12963 0.279
NP_442845.1_2 Reverse -29 -43 16.0275 0.0663
NP_442845.1_2 Forward -50 -36 12.6843 0.104
NP_441178.1_4 Reverse -258 -277 19.2723 0.0722
NP_441178.1_6 Reverse -208 -227 10.6184 0.226
NP_441918.1_7 Forward -312 -293 -0.885524 0.297
NP_441469.1_8 Forward -45 -36 6.48957 0.227
NP_441469.1_8 Reverse -34 -43 6.48957 0.227
NP_443064.1_6 Forward -44 -34 12.5669 0.0796
NP_443064.1_6 Reverse -35 -45 12.5669 0.0796
NP_442578.1_7 Forward -43 -36 14.5921 0.026
NP_442578.1_7 Reverse -36 -43 14.5921 0.026
NP_441462.1_2 Forward -44 -34 11.5831 0.00406
NP_441462.1_2 Reverse -35 -45 11.5831 0.00406
NP_441462.1_2 Forward -156 -146 0.373358 0.154
NP_441462.1_2 Reverse -302 -312 -0.904945 0.265
NP_441621.1_7 Reverse -300 -314 1.27789 0.145
NP_441929.1_3 Reverse -291 -310 2.55606 0.266
NP_443062.1_1 Reverse -35 -53 18.1991 0.0227
NP_441601.1_4 Reverse -85 -104 4.03102 0.203
NP_441601.1_4 Reverse -88 -107 -5.60541 0.294
NP_442204.1_1 Forward -315 -304 1.7303 0.266
NP_442204.1_1 Forward -291 -280 1.04198 0.281
NP_442204.1_5 Reverse -25 -44 2.55606 0.212
NP_440516.1_8 Forward -44 -35 16.9127 0.00442
NP_440516.1_8 Reverse -35 -44 16.9127 0.00442
NP_440516.1_8 Forward -311 -302 -0.196935 0.185
NP_441785.1_1 Reverse -35 -49 14.9684 0.148
NP_442428.1_5 Forward -43 -36 15.8704 0.0124
NP_442428.1_5 Reverse -36 -43 15.8704 0.0124
NP_442428.1_5 Forward -310 -303 4.759 0.223
NP_441443.1_1 Forward -386 -367 -4.91709 0.297
NP_441443.1_10 Forward -175 -157 1.00172 0.292
NP_442120.1_10 Forward -305 -286 -12.1936 0.27
NP_442120.1_10 Reverse -290 -309 -14.6519 0.289
NP_442120.1_10 Forward -281 -262 -15.6352 0.294
NP_440673.1_3 Forward -42 -35 12.4288 0.0426
NP_440673.1_3 Reverse -37 -44 12.4288 0.0426
NP_441714.1_3 Reverse -28 -46 14.473 0.184
NP_441052.1_2 Forward -44 -34 19.9412 0.00106
NP_441052.1_2 Reverse -35 -45 19.9412 0.00106
NP_441052.1_2 Forward -368 -358 2.24165 0.213
NP_442219.1_8 Forward -54 -35 12.3223 0.158
NP_442219.1_8 Forward -48 -29 12.0324 0.168
NP_442219.1_9 Forward -43 -34 17.7976 0.00718
NP_442219.1_9 Reverse -36 -45 17.7976 0.00718
NP_440436.1_4 Forward -43 -34 17.2072 0.00233
NP_440436.1_4 Reverse -36 -45 17.2072 0.00233
NP_440436.1_4 Reverse -148 -157 11.3073 0.0574
NP_441884.1_8 Reverse -88 -107 -12.5869 0.271
NP_442705.1_1 Forward -37 -18 9.14423 0.287
NP_442864.1_2 Forward -43 -24 11.7992 0.251
NP_440314.1_9 Reverse -36 -55 -0.295539 0.106
NP_442907.1_4 Forward -315 -296 16.7157 0.104
NP_441719.1_4 Forward -43 -36 16.3621 0.0124
NP_441719.1_4 Reverse -36 -43 16.3621 0.0124
NP_441004.1_1 Forward -168 -149 -10.227 0.219
NP_441004.1_1 Forward -320 -301 -10.3253 0.219
NP_441004.1_1 Reverse -23 -42 -13.5702 0.259
NP_441004.1_1 Forward -317 -298 -16.8151 0.287
NP_441004.1_3 Forward -308 -289 7.37428 0.204
NP_441004.1_4 Forward -165 -155 9.32148 0.259
NP_442366.1_3 Forward -45 -27 15.6538 0.0199
NP_442366.1_3 Reverse -34 -52 4.05072 0.101
NP_442366.1_5 Reverse -32 -42 14.8275 0.0375
NP_442873.1_5 Reverse -304 -323 8.4551 0.259
NP_442206.1_4 Reverse -36 -55 5.99764 0.288
NP_443054.1_2 Forward -46 -32 11.0127 0.0761
NP_441851.1_10 Forward -45 -35 15.8113 0.00552
NP_441851.1_10 Reverse -34 -44 15.8113 0.00552
NP_442898.1_5 Forward -178 -164 21.7307 0.197
NP_442856.1_7 Forward -73 -54 -1.86883 0.231
NP_442856.1_7 Reverse -26 -45 -4.6221 0.264
NP_441668.1_4 Forward -54 -35 0.786102 0.231
NP_442515.1_1 Reverse -34 -48 9.43936 0.0629
NP_442515.1_1 Forward -157 -143 3.34284 0.12
NP_442515.1_1 Forward -45 -31 -4.91696 0.298
NP_441396.1_5 Reverse -98 -107 9.4395 0.205
NP_440593.1_3 Reverse -24 -43 -1.96717 0.219
NP_440593.1_3 Forward -43 -24 -5.21209 0.259
NP_440593.1_3 Forward -316 -297 -5.9004 0.268
NP_441046.1_2 Forward -316 -297 3.14605 0.24
NP_441349.1_10 Forward -54 -35 9.14423 0.0248
NP_441349.1_10 Reverse -25 -44 7.37428 0.0314
NP_442024.1_4 Forward -53 -34 11.2092 0.199
NP_441409.1_6 Reverse -29 -48 -10.4236 0.205
NP_442843.1_1 Reverse -285 -304 -8.94866 0.264
NP_440474.1_8 Reverse -36 -50 7.57046 0.204
NP_442450.1_5 Forward -46 -36 9.32148 0.115
NP_442450.1_5 Reverse -33 -43 7.55152 0.13
NP_440588.1_2 Reverse -26 -45 7.37428 0.0502
NP_442006.1_2 Forward -317 -300 -12.6459 0.197
NP_443047.1_7 Reverse -36 -55 5.80098 0.228
NP_441570.1_1 Reverse -35 -53 -0.964162 0.0525
NP_441078.1_4 Forward -44 -35 19.6659 0.0007
NP_441078.1_4 Reverse -35 -44 19.6659 0.0007
NP_441078.1_4 Forward -311 -302 -1.77023 0.266
NP_442729.1_5 Forward -222 -212 7.55152 0.29
NP_442443.1_1 Forward -106 -87 -1.37718 0.233
NP_442443.1_1 Forward -319 -300 -4.13045 0.268
NP_440526.1_3 Forward -43 -32 10.2846 0.0646
NP_440526.1_3 Reverse -36 -47 10.1862 0.0646
NP_441432.1_8 Reverse -34 -43 16.8143 0.00595
NP_441432.1_8 Forward -45 -36 16.8143 0.00595
NP_441432.1_8 Reverse -28 -37 12.2911 0.0444
NP_441432.1_8 Forward -157 -148 8.35786 0.0755
NP_441432.1_8 Forward -312 -303 4.81794 0.196
NP_442320.1_8 Forward -50 -36 11.701 0.0178
NP_442320.1_8 Reverse -29 -43 6.29277 0.029
NP_442344.1_7 Reverse -36 -55 -6.78538 0.172
NP_441732.1_2 Reverse -31 -47 -6.92296 0.0558
NP_441732.1_2 Forward -48 -32 -16.5594 0.174
NP_441732.1_2 Reverse -262 -278 -17.641 0.281
NP_440760.1_1 Forward -44 -25 -6.29373 0.0569
NP_440760.1_1 Forward -38 -19 -18.2901 0.212
NP_440760.1_1 Reverse -35 -54 -21.3384 0.234
NP_440760.1_9 Reverse -176 -195 16.1257 0.143
NP_440199.1_10 Forward -47 -37 16.7946 0.0381
NP_440199.1_10 Reverse -356 -366 13.353 0.108
NP_440199.1_10 Reverse -32 -42 7.25653 0.231
NP_440713.1_4 Forward -321 -302 0.884433 0.3
NP_442489.1_2 Reverse -24 -43 0.58944 0.297
NP_442489.1_7 Forward -44 -35 20.1576 0.000695
NP_442489.1_7 Reverse -35 -44 20.1576 0.000695
NP_442489.1_7 Forward -311 -302 -1.27858 0.185
NP_442489.1_7 Reverse -147 -156 -1.6719 0.235
NP_442079.1_4 Reverse -87 -106 19.174 0.259
NP_442079.1_7 Reverse -36 -55 0.884433 0.27
NP_440559.1_1 Forward -43 -34 17.4043 0.00658
NP_440559.1_1 Reverse -36 -45 17.4043 0.00658
NP_440559.1_1 Forward -155 -146 4.71961 0.217
NP_441659.2_8 Forward -44 -34 18.1713 0.00133
NP_441659.2_8 Reverse -35 -45 18.1713 0.00133
NP_441659.2_8 Reverse -302 -312 6.37155 0.0774
NP_442913.1_9 Reverse -29 -48 6.29264 0.296
NP_442913.1_10 Forward -53 -34 -2.16383 0.182
NP_442913.1_10 Reverse -26 -45 -2.16383 0.182
NP_442346.1_5 Forward -45 -35 16.6963 0.00248
NP_442346.1_5 Reverse -34 -44 16.6963 0.00248
NP_442346.1_5 Reverse -358 -368 9.81313 0.117
NP_442346.1_5 Forward -369 -359 8.82982 0.124
NP_440545.1_3 Reverse -298 -315 -6.35267 0.276
NP_441126.1_8 Forward -314 -301 17.1289 0.159
NP_440459.1_2 Forward -326 -309 8.49531 0.259
NP_440010.1_3 Forward -323 -304 -3.3438 0.25
NP_440010.1_4 Forward -54 -35 1.96529 0.227
NP_440449.1_6 Forward -319 -301 7.2832 0.227
NP_440170.1_3 Forward -109 -90 9.83255 0.163
NP_441833.1_4 Forward -43 -36 15.9687 0.0124
NP_441833.1_4 Reverse -36 -43 15.9687 0.0124
NP_441895.1_2 Forward -107 -88 -7.27704 0.0431
NP_442162.1_9 Forward -43 -36 16.2637 0.0124
NP_442162.1_9 Reverse -36 -43 16.2637 0.0124
NP_443015.1_3 Forward -204 -185 17.6084 0.235
NP_442796.1_10 Forward -317 -298 14.5524 0.145
NP_442796.1_10 Forward -170 -151 8.94757 0.267
NP_440671.1_4 Forward -50 -36 16.6175 0.0276
NP_440671.1_4 Reverse -29 -43 10.3243 0.161
NP_440671.1_4 Forward -293 -279 7.07942 0.227
NP_442943.1_1 Forward -187 -172 4.92399 0.219
NP_440772.1_8 Forward -50 -31 9.53756 0.253
NP_442045.1_5 Reverse -299 -318 -0.885524 0.276
NP_442073.1_6 Reverse -26 -45 -3.3438 0.291
NP_442199.1_5 Forward -40 -21 -2.16383 0.185
NP_442140.1_3 Forward -43 -33 12.2714 0.0632
NP_442140.1_3 Forward -310 -300 7.55152 0.135
NP_442140.1_3 Reverse -36 -46 4.40493 0.243
NP_441813.1_5 Forward -46 -36 15.9097 0.01
NP_441813.1_5 Reverse -33 -43 8.63316 0.0367
NP_442472.1_10 Reverse -323 -342 17.5998 0.232
NP_440590.1_4 Forward -43 -30 19.1938 0.00669
NP_440590.1_4 Reverse -36 -49 -4.50394 0.262
NP_440567.1_1 Forward -43 -29 12.8809 0.0215
NP_440567.1_1 Reverse -36 -50 3.53951 0.141
NP_442497.1_10 Forward -43 -34 10.4228 0.0087
NP_442497.1_10 Reverse -36 -45 10.4228 0.0087
NP_442497.1_10 Forward -155 -146 -1.18024 0.256
NP_440821.1_4 Forward -46 -36 18.2696 0.00448
NP_440821.1_4 Reverse -33 -43 9.41981 0.0286
NP_441239.1_9 Forward -46 -34 4.36554 0.253
NP_441239.1_9 Forward -164 -152 3.87389 0.272
NP_441239.1_9 Forward -370 -358 3.67722 0.279
NP_441239.1_9 Reverse -33 -45 3.38223 0.285
NP_441239.1_9 Reverse -300 -312 3.08724 0.296
NP_440156.1_4 Forward -300 -290 12.9592 0.176
NP_441727.1_3 Reverse -28 -47 6.4893 0.244
NP_441892.1_1 Forward -320 -303 -0.747806 0.191
NP_441892.1_1 Forward -53 -36 -2.12444 0.218
NP_441892.1_1 Reverse -26 -43 -2.22277 0.219
NP_442082.1_2 Forward -56 -37 8.25844 0.234
NP_442193.1_8 Forward -47 -28 18.0915 0.211
NP_442270.1_9 Reverse -24 -43 11.4058 0.0824
NP_442270.1_9 Reverse -18 -37 -5.9004 0.207
NP_442270.1_9 Forward -167 -148 -8.94866 0.226
NP_442643.1_3 Reverse -87 -106 -6.88371 0.263
NP_441017.1_6 Forward -48 -34 14.1586 0.157
NP_441874.1_1 Reverse -25 -39 15.4376 0.165
NP_441567.1_10 Reverse -26 -45 16.3215 0.293
NP_442138.1_10 Reverse -35 -54 10.4225 0.0361
NP_440412.1_2 Forward -345 -326 5.11266 0.295
NP_440546.1_4 Forward -44 -34 10.046 0.109
NP_440546.1_4 Reverse -35 -45 10.046 0.109
NP_440546.1_6 Forward -321 -302 8.06259 0.265
NP_439974.1_4 Reverse -65 -84 10.3242 0.24
NP_440462.1_6 Forward -46 -36 7.74818 0.0699
NP_440462.1_6 Reverse -33 -43 1.35667 0.294
NP_442340.1_3 Reverse -253 -272 -5.9004 0.223
NP_440868.1_4 Forward -48 -36 5.93884 0.0879
NP_440868.1_4 Reverse -31 -43 -0.846001 0.282
NP_441497.1_3 Reverse -283 -302 -10.3253 0.294
NP_441249.1_3 Forward -313 -294 -0.0988766 0.293
NP_440036.1_2 Forward -361 -342 12.7825 0.269
NP_441848.1_4 Reverse -283 -299 11.3703 0.224
NP_441848.1_4 Forward -58 -42 7.35968 0.29
NP_441084.1_6 Forward -370 -356 11.865 0.185
NP_440696.1_3 Forward -321 -303 -1.75081 0.265
NP_442923.1_2 Forward -60 -41 19.3707 0.203
NP_442039.1_4 Forward -43 -36 15.1821 0.0124
NP_442039.1_4 Reverse -36 -43 15.1821 0.0124
NP_442039.1_4 Reverse -148 -155 12.2322 0.049
NP_442039.1_7 Forward -168 -158 14.4347 0.211
NP_442039.1_7 Forward -309 -299 7.05986 0.283
NP_441811.1_8 Reverse -29 -43 7.57108 0.241
NP_441926.1_3 Reverse -35 -51 8.02334 0.17
NP_440825.1_7 Forward -43 -33 12.9096 0.152
NP_442837.1_3 Forward -43 -36 15.7721 0.0124
NP_442837.1_3 Reverse -36 -43 15.7721 0.0124
NP_440160.1_2 Reverse -55 -74 -4.22878 0.26
NP_442053.1_1 Forward -44 -35 18.3876 0.0007
NP_442053.1_1 Reverse -35 -44 18.3876 0.0007
NP_440505.1_3 Forward -46 -36 16.303 0.00696
NP_440505.1_3 Reverse -33 -43 9.22315 0.122
NP_440505.1_3 Forward -256 -246 6.27322 0.187
NP_440505.1_3 Forward -158 -148 5.19158 0.241
NP_440013.1_2 Reverse -28 -42 18.9775 0.0943
NP_441408.2_7 Forward -40 -21 1.17943 0.215
NP_441408.2_7 Forward -46 -27 -3.14714 0.272
NP_440914.1_1 Forward -44 -34 17.5935 0.000537
NP_440914.1_1 Reverse -35 -45 17.5935 0.000537
NP_440914.1_1 Forward -37 -27 9.68861 0.178
NP_441011.1_8 Forward -43 -34 8.25953 0.144
NP_441011.1_8 Reverse -36 -45 8.25953 0.144
NP_442533.1_1 Forward -227 -208 -15.7335 0.257
NP_442533.1_1 Forward -290 -271 -15.8318 0.257
NP_442533.1_6 Forward -44 -35 17.2076 0.00137
NP_442533.1_6 Reverse -35 -44 17.2076 0.00137
NP_442533.1_6 Reverse -62 -71 10.2261 0.0558
NP_442533.1_6 Reverse -359 -368 4.62128 0.179
NP_442533.1_6 Forward -368 -359 4.22796 0.186
NP_442533.1_6 Forward -311 -302 4.22796 0.186
NP_442533.1_6 Forward -156 -147 3.93297 0.197
NP_442232.1_3 Forward -319 -300 -6.49039 0.185
NP_442322.1_4 Reverse -300 -317 -6.255 0.275
NP_441482.1_7 Reverse -29 -43 -8.35854 0.193
NP_441482.1_7 Forward -317 -303 -10.4235 0.209
NP_441482.1_7 Forward -50 -36 -10.8168 0.216
NP_439944.1_9 Reverse -36 -46 19.0562 0.00329
NP_439944.1_9 Forward -43 -33 10.5014 0.0887
NP_439944.1_9 Reverse -24 -34 7.74818 0.131
NP_441028.1_6 Forward -111 -101 6.37109 0.23
NP_441028.1_6 Reverse -46 -56 4.89613 0.275
NP_441028.1_6 Reverse -216 -226 4.10949 0.278
NP_442202.1_10 Reverse -250 -264 4.52282 0.258
NP_440116.1_8 Reverse -36 -55 -8.26035 0.25
NP_440116.1_8 Reverse -148 -167 -9.14533 0.268
NP_440007.1_9 Reverse -31 -45 1.08123 0.29
NP_440007.1_9 Forward -48 -34 0.88457 0.29
NP_441602.1_3 Reverse -148 -167 10.9142 0.111
NP_441972.1_5 Forward -43 -24 2.0644 0.123
NP_441106.1_1 Forward -45 -36 9.63616 0.0311
NP_441106.1_1 Reverse -34 -43 9.63616 0.0311
NP_441106.1_1 Forward -312 -303 5.89959 0.121
NP_440429.1_2 Reverse -148 -167 14.4541 0.176
NP_440429.1_9 Forward -212 -193 1.47442 0.279
NP_439903.1_6 Forward -47 -28 11.0117 0.0958
NP_001035870.1_3 Reverse -17 -36 8.35759 0.163
NP_440797.1_2 Forward -55 -36 14.1282 0.215
NP_441286.1_1 Reverse -34 -46 21.3768 0.00196
NP_441286.1_1 Forward -45 -33 12.9203 0.00815
NP_441286.1_1 Forward -157 -145 -4.18925 0.152
NP_442674.1_3 Reverse -27 -46 8.4551 0.194
NP_440670.1_8 Forward -44 -35 18.3876 0.000699
NP_440670.1_8 Reverse -35 -44 18.3876 0.000699
NP_440886.1_7 Reverse -301 -311 16.4991 0.0104
NP_440886.1_7 Forward -45 -35 7.94438 0.0805
NP_440886.1_7 Reverse -34 -44 7.94438 0.0805
NP_440886.1_7 Reverse -88 -98 6.56775 0.118
NP_440886.1_7 Reverse -271 -281 4.89613 0.213
NP_442072.1_9 Forward -45 -27 -22.1053 0.22
NP_440028.1_6 Forward -292 -274 19.292 0.121
NP_440028.1_6 Forward -319 -301 12.5072 0.24
NP_441808.1_8 Forward -317 -298 6.68596 0.284
NP_440907.2_8 Forward -43 -33 7.64939 0.117
NP_441905.1_9 Forward -314 -295 8.84924 0.288
NP_442264.1_2 Reverse -143 -160 7.11867 0.247
NP_442264.1_2 Forward -48 -31 5.54538 0.275
NP_442264.1_2 Forward -54 -37 4.6604 0.295
NP_441021.1_1 Forward -43 -24 14.1591 0.0264
NP_441021.1_8 Reverse -30 -48 5.13236 0.215
NP_440841.1_4 Forward -46 -27 1.0811 0.119
NP_441463.1_3 Forward -54 -35 0.294447 0.132
NP_441463.1_3 Forward -42 -23 -5.80207 0.232
NP_441463.1_3 Reverse -349 -368 -6.1954 0.241
NP_441626.1_2 Forward -43 -36 15.7721 0.0124
NP_441626.1_2 Reverse -36 -43 15.7721 0.0124
NP_442221.1_4 Forward -105 -86 16.2241 0.146
NP_442794.1_1 Reverse -31 -43 12.4287 0.0721
NP_442794.1_1 Reverse -25 -37 4.46387 0.261
NP_442615.1_1 Reverse -26 -44 14.9655 0.00922
NP_442615.1_1 Forward -53 -35 -2.24246 0.141
NP_441962.1_4 Reverse -30 -49 -0.688862 0.117
NP_441962.1_4 Reverse -62 -81 -12.8819 0.265
NP_441962.1_4 Forward -43 -24 -14.2585 0.285
NP_440387.1_1 Forward -44 -28 6.25339 0.0282
NP_440387.1_1 Reverse -35 -51 -1.41643 0.142
NP_440855.1_5 Forward -46 -27 5.2102 0.285
NP_441488.1_8 Reverse -30 -44 11.2087 0.146
NP_441993.1_1 Reverse -29 -48 10.4255 0.126
NP_441174.1_2 Forward -314 -300 14.6509 0.156
NP_441174.1_2 Forward -101 -87 14.0609 0.176
NP_442805.1_5 Reverse -170 -189 -6.88445 0.297
NP_440114.1_10 Reverse -35 -49 10.1277 0.153
NP_441817.1_3 Forward -322 -303 16.9124 0.0481
NP_441510.2_2 Reverse -247 -266 6.88182 0.258
NP_441510.2_7 Forward -50 -36 11.7003 0.28
NP_440293.1_3 Reverse -21 -40 -6.88371 0.294
NP_441237.1_9 Forward -43 -33 14.828 0.0242
NP_441979.1_5 Reverse -296 -315 -11.5053 0.228
NP_440643.1_6 Forward -43 -24 3.83436 0.232
NP_441133.1_3 Forward -320 -301 15.7324 0.272
NP_439910.1_2 Forward -52 -35 -21.4956 0.183
NP_440457.1_1 Forward -315 -303 2.49725 0.21
NP_440457.1_1 Forward -48 -36 0.0389777 0.25
NP_441436.1_8 Forward -316 -297 10.0292 0.262
NP_440473.1_9 Forward -55 -36 -7.4737 0.236
NP_442509.1_9 Forward -44 -34 8.14104 0.192
NP_442509.1_9 Reverse -35 -45 8.14104 0.192
NP_441489.1_4 Reverse -106 -120 12.9793 0.253
NP_441253.1_8 Reverse -51 -65 13.7601 0.143
NP_442514.1_5 Reverse -210 -229 -7.27777 0.276
NP_440554.1_4 Reverse -36 -46 7.05986 0.106
NP_440554.1_4 Reverse -303 -313 2.92996 0.248
NP_441885.1_5 Forward -44 -34 20.9245 0.000538
NP_441885.1_5 Reverse -35 -45 20.9245 0.000538
NP_442341.1_7 Forward -45 -31 18.0925 0.0111
NP_442341.1_7 Reverse -34 -48 8.35772 0.0881
NP_442341.1_9 Reverse -33 -47 8.65209 0.166
NP_442341.1_9 Forward -46 -32 7.27547 0.202
NP_442341.1_9 Forward -74 -60 4.52221 0.299
NP_440191.1_4 Reverse -47 -57 12.9542 0.282
NP_440423.1_6 Forward -52 -33 -5.99873 0.138
NP_443000.1_7 Forward -46 -36 17.0896 0.00865
NP_443000.1_7 Reverse -33 -43 10.3048 0.0345
NP_440507.2_3 Forward -53 -34 11.995 0.166
NP_440727.1_2 Reverse -145 -164 -3.73712 0.295
NP_441842.1_10 Reverse -28 -42 8.75105 0.211
NP_440275.1_3 Forward -46 -36 8.1415 0.0602
NP_440275.1_3 Reverse -33 -43 8.04317 0.0602
NP_440091.1_1 Forward -48 -36 16.4603 0.0153
NP_440091.1_1 Reverse -31 -43 1.31728 0.198
NP_440091.1_1 Forward -160 -148 -0.846001 0.293
NP_443060.1_5 Reverse -27 -46 14.0599 0.109
NP_442451.1_2 Reverse -145 -164 -7.86702 0.24
NP_442451.1_2 Forward -164 -145 -10.9153 0.28
NP_441122.1_1 Reverse -24 -39 14.3362 0.126
NP_439962.1_4 Reverse -85 -104 1.47442 0.197
NP_439962.1_4 Forward -110 -91 -1.96717 0.224
NP_441105.1_3 Reverse -24 -43 6.58763 0.0592
NP_441105.1_3 Forward -322 -303 4.81767 0.076
NP_441105.1_3 Forward -49 -30 3.34271 0.0921
NP_441105.1_3 Forward -55 -36 -0.787193 0.142
NP_441105.1_3 Reverse -136 -155 -1.47551 0.15
NP_441105.1_3 Reverse -50 -69 -9.34199 0.288
NP_442373.1_2 Forward -323 -304 -9.14533 0.258
NP_440216.1_1 Reverse -35 -49 -1.8687 0.0412
NP_440216.1_1 Forward -44 -30 -9.63684 0.145
NP_440216.1_9 Reverse -285 -294 9.83282 0.286
NP_440172.1_1 Forward -44 -34 15.0247 0.00945
NP_440172.1_1 Reverse -35 -45 15.0247 0.00945
NP_440172.1_1 Forward -156 -146 5.87989 0.127
NP_440172.1_1 Forward -189 -179 2.53664 0.277
NP_442371.1_1 Forward -55 -45 12.6642 0.245
NP_442015.1_10 Reverse -31 -44 11.3273 0.0372
NP_442015.1_10 Forward -48 -35 0.60927 0.221
NP_442015.1_10 Reverse -308 -321 -0.37404 0.264
NP_441226.1_7 Forward -43 -36 14.4934 0.0123
NP_441226.1_7 Reverse -36 -43 14.4934 0.0123
NP_441111.1_7 Forward -43 -35 18.7023 0.00294
NP_441111.1_7 Reverse -36 -44 18.7023 0.00294
NP_441111.1_7 Reverse -303 -311 -0.668896 0.274
NP_441111.1_7 Reverse -148 -156 -0.668896 0.274
NP_442379.1_10 Forward -51 -34 -3.40274 0.259
NP_442379.1_10 Reverse -138 -155 -4.28772 0.291
NP_441766.1_2 Forward -44 -35 17.5026 0.00297
NP_441766.1_2 Reverse -35 -44 17.5026 0.00297
NP_440416.1_9 Reverse -28 -47 -15.7335 0.198
NP_440416.1_9 Forward -39 -20 -16.1268 0.208
NP_440416.1_9 Forward -109 -90 -17.8968 0.248
NP_440416.1_9 Reverse -21 -40 -20.7484 0.288
NP_443052.1_8 Forward -54 -35 -9.53865 0.193
NP_443052.1_8 Forward -378 -359 -9.73531 0.194
NP_443052.1_9 Reverse -301 -320 16.6174 0.0322
NP_443052.1_9 Reverse -88 -107 -3.04881 0.245
NP_443052.1_9 Reverse -298 -317 -3.63879 0.251
NP_442154.1_1 Forward -319 -301 -11.8789 0.217
NP_440261.1_7 Reverse -186 -205 -6.98204 0.296
NP_440988.1_10 Forward -46 -32 8.19046 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATGCAGTAAAAACGGTGCAAGTGAGCCTGGAAGCCATGACCATTTTGCTTGATGAAGGTATTGTTTTTCGTCAAGAACGGTTAGCGGAGGCGGTGGCGGAAGATTTTTCCAATGCGACGGATGTGGCGGATTACTTGGCGGCTAAGGGAGTCCCCTTCCGGGAAGCTTATAATCTGGTGGGCAAGGTGGTTAAAACCAGTTTGGCGGCAGGGAAATTGCTCAAGGATTTAACCCTGGCGGAATGGCAAGCGCTCCATCCCGCTTTTGAAGAGGATATTTACCAAGCTATTACCCCCCAGCAAGTGGTGGCGGCACGCAATAGTTACGGGGGCACGGGCTTTGAACAGGTGAAAATGGCGATCGCCAATGCCAAAGCTGAATTAAGCCAGACTTAAATTG

CDS

GTGTGGAGATATGCCCAGGTTTTCATTAAGTTACTGCTCCGTCGTCCCCTATCAGCAGTGACGGTAATTCCGGTTCTATCAGATAGTTCCATAGTCCTAGTCAAACGACGGGATACAGGGCAATGGAGTTTACCAGGGGGGCTGATCGACTGGGGGGAAACAGTGGCAATAACGGCCGCCCGAGAGTTACAGGAAGAAACTGGTTTACGGTTGATAAAAATAGATCGCCTGCTTGGGGTCTATTCCAGTCCCGACAGAGATCCCCGCATGCACTCCGTCACCATTTCCCTGGTGGTTAAAGCGCAAGGTGATTTGCTCATTGGCGATCGCCAGGAAATATCCGAAGTAAAAGCTTTTGCGGTGGAAGATTTACCGTTAGGAGCATTAAGCCATGACCACGATCAACAACTACAGGATTTTTTACGGGGGGAAACAATCATTGCTTGA

Protein

MWRYAQVFIKLLLRRPLSAVTVIPVLSDSSIVLVKRRDTGQWSLPGGLIDWGETVAITAARELQEETGLRLIKIDRLLGVYSSPDRDPRMHSVTISLVVKAQGDLLIGDRQEISEVKAFAVEDLPLGALSHDHDQQLQDFLRGETIIA