Your browser is old and dusty. Try Google Chrome!

Details for slr1127

ORF slr1127
Accession NP_439976.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_1 Reverse -174 -192 18.7125 0.149
NP_441061.1_2 Reverse -318 -332 2.85119 0.17
NP_441061.1_2 Forward -337 -323 2.35953 0.177
NP_441061.1_2 Reverse -330 -344 -2.65535 0.3
NP_440557.1_1 Reverse -330 -349 -0.197208 0.267
NP_440795.1_7 Forward -337 -330 14.6904 0.0123
NP_440795.1_7 Reverse -330 -337 14.6904 0.0123
NP_441418.1_6 Forward -338 -319 -9.047 0.0273
NP_441418.1_6 Reverse -317 -336 -11.8986 0.0576
NP_441418.1_6 Reverse -329 -348 -29.7948 0.238
NP_440815.1_5 Forward -338 -319 10.1275 0.225
NP_442291.1_5 Forward -339 -323 1.63183 0.142
NP_440897.1_6 Forward -216 -197 3.44025 0.147
NP_441453.1_4 Reverse -329 -337 16.539 0.00633
NP_441453.1_4 Forward -338 -330 16.539 0.00633
NP_442151.1_6 Reverse -329 -343 7.66941 0.192
NP_442151.1_6 Reverse -39 -53 7.17775 0.206
NP_441818.1_1 Forward -337 -326 9.79292 0.232
NP_441818.1_9 Forward -275 -256 3.83436 0.18
NP_441818.1_9 Reverse -117 -136 -0.688862 0.196
NP_440226.1_1 Forward -338 -319 13.5691 0.0352
NP_440226.1_1 Reverse -329 -348 9.53756 0.0719
NP_440150.1_6 Reverse -311 -330 8.55425 0.2
NP_440150.1_6 Reverse -326 -345 7.7676 0.223
NP_440150.1_6 Forward -329 -310 2.65439 0.268
NP_440150.1_6 Forward -341 -322 1.17943 0.295
NP_442744.1_8 Forward -230 -211 -6.98204 0.299
NP_442173.1_1 Forward -337 -329 15.4574 0.00633
NP_442173.1_1 Reverse -330 -338 15.4574 0.00633
NP_442752.1_4 Forward -338 -331 13.8055 0.0199
NP_442752.1_4 Reverse -329 -336 13.8055 0.0199
NP_442752.1_4 Reverse -29 -36 5.84064 0.166
NP_442752.1_4 Forward -264 -257 5.34899 0.221
NP_443027.1_4 Reverse -327 -337 11.0914 0.107
NP_443027.1_4 Forward -266 -256 8.92815 0.181
NP_443027.1_4 Forward -340 -330 5.87989 0.294
NP_443027.1_4 Forward -197 -187 5.87989 0.294
NP_441812.1_3 Reverse -328 -342 6.88276 0.287
NP_442975.1_10 Forward -342 -328 10.8154 0.0516
NP_442975.1_10 Forward -220 -206 6.29216 0.184
NP_440784.1_7 Forward -337 -330 15.9687 0.0123
NP_440784.1_7 Reverse -330 -337 15.9687 0.0123
NP_440061.1_9 Forward -340 -326 18.7801 0.00768
NP_440061.1_9 Reverse -327 -341 5.89884 0.266
NP_440061.1_9 Reverse -253 -267 4.91554 0.3
NP_441476.1_5 Forward -343 -324 -7.17871 0.284
NP_442062.1_8 Reverse -329 -339 19.4496 0.000558
NP_442062.1_8 Forward -338 -328 17.3846 0.00193
NP_441859.1_3 Forward -327 -308 5.40686 0.201
NP_441859.1_3 Reverse -250 -269 4.03023 0.228
NP_440304.1_4 Forward -218 -208 4.0116 0.281
NP_440304.1_4 Forward -340 -330 1.84832 0.299
NP_440304.1_4 Reverse -327 -337 1.84832 0.299
NP_442242.1_4 Forward -337 -330 14.3954 0.0124
NP_442242.1_4 Reverse -330 -337 14.3954 0.0124
NP_441781.1_7 Forward -338 -319 -1.37718 0.272
NP_441035.1_1 Forward -152 -133 19.5673 0.198
NP_442276.1_2 Reverse -51 -70 5.60432 0.291
NP_442110.1_7 Forward -338 -324 0.491246 0.259
NP_440014.1_7 Forward -347 -333 16.5185 0.216
NP_440856.1_4 Reverse -322 -341 -1.57384 0.202
NP_440856.1_7 Reverse -311 -330 -1.37718 0.182
NP_441083.1_5 Forward -338 -328 20.3345 0.00053
NP_441083.1_5 Reverse -329 -339 11.3864 0.0159
NP_441083.1_5 Forward -326 -316 -1.10161 0.295
NP_442827.1_8 Forward -325 -306 -1.27961 0.245
NP_441434.1_7 Reverse -287 -301 3.8345 0.225
NP_441738.1_2 Forward -336 -329 15.28 0.0102
NP_441738.1_2 Reverse -331 -338 15.28 0.0102
NP_441738.1_2 Forward -36 -29 8.20023 0.181
NP_441738.1_2 Reverse -257 -264 8.00357 0.235
NP_441558.1_5 Reverse -327 -346 12.4875 0.0677
NP_441558.1_5 Forward -110 -91 7.86593 0.167
NP_441558.1_5 Reverse -205 -224 4.12936 0.29
NP_440209.1_1 Reverse -329 -337 18.1123 0.00295
NP_440209.1_1 Forward -338 -330 18.1123 0.00295
NP_442889.1_1 Forward -300 -281 -12.6852 0.238
NP_442889.1_8 Forward -341 -327 4.03056 0.27
NP_440447.1_1 Reverse -324 -342 3.46073 0.255
NP_441713.1_1 Forward -270 -251 -2.45882 0.113
NP_441713.1_1 Reverse -323 -342 -8.85033 0.159
NP_441713.1_5 Forward -336 -317 5.70265 0.271
NP_441770.1_4 Reverse -344 -363 -6.68705 0.228
NP_440178.1_7 Forward -39 -20 -21.24 0.215
NP_441716.1_1 Forward -338 -324 11.0127 0.0936
NP_441716.1_1 Forward -216 -202 4.71948 0.252
NP_442111.1_4 Reverse -328 -342 8.06273 0.081
NP_442111.1_4 Forward -339 -325 3.44117 0.244
NP_441624.1_7 Forward -332 -318 9.83269 0.217
NP_441163.1_1 Forward -346 -329 9.5762 0.225
NP_441163.1_1 Reverse -310 -327 4.16803 0.291
NP_440906.1_5 Forward -337 -330 15.8704 0.0124
NP_440906.1_5 Reverse -330 -337 15.8704 0.0124
NP_440012.1_6 Reverse -318 -337 8.55425 0.247
NP_440747.1_10 Reverse -326 -338 26.5883 0.000317
NP_440747.1_10 Forward -341 -329 5.44718 0.0137
NP_441130.1_10 Reverse -327 -341 7.27608 0.164
NP_441486.1_1 Forward -341 -327 13.5693 0.0082
NP_441486.1_1 Reverse -326 -340 5.1128 0.0391
NP_442848.1_1 Reverse -323 -337 -3.44199 0.267
NP_443018.1_3 Forward -337 -330 14.8871 0.0123
NP_443018.1_3 Reverse -330 -337 14.8871 0.0123
NP_443018.1_3 Forward -194 -187 10.2655 0.107
NP_443018.1_3 Forward -293 -286 8.49558 0.141
NP_441634.1_8 Reverse -327 -341 15.5359 0.0248
NP_441634.1_8 Reverse -165 -179 1.86788 0.178
NP_440376.1_1 Forward -338 -329 19.4693 0.000692
NP_440376.1_1 Reverse -329 -338 19.4693 0.000692
NP_440376.1_1 Reverse -317 -326 3.63797 0.2
NP_440376.1_1 Reverse -336 -345 1.76968 0.242
NP_441588.1_4 Reverse -331 -341 7.25653 0.178
NP_442687.1_7 Forward -339 -329 15.8113 0.0125
NP_442687.1_7 Reverse -316 -326 12.4681 0.0721
NP_442687.1_7 Reverse -328 -338 8.92815 0.0994
NP_442191.1_7 Forward -337 -318 14.7491 0.206
NP_442485.1_3 Reverse -312 -331 -1.37718 0.257
NP_442485.1_3 Forward -337 -318 -2.45882 0.262
NP_442485.1_3 Reverse -318 -337 -4.81876 0.285
NP_441846.1_10 Reverse -17 -36 -13.3736 0.204
NP_440642.1_7 Forward -186 -167 13.9625 0.287
NP_441422.1_7 Forward -340 -323 -1.33779 0.186
NP_442296.1_9 Reverse -330 -349 0.196116 0.197
NP_442296.1_9 Forward -337 -318 -5.99873 0.297
NP_442658.1_1 Forward -340 -330 15.9091 0.00966
NP_442658.1_1 Reverse -327 -337 7.94438 0.199
NP_442198.1_3 Reverse -305 -324 5.70265 0.259
NP_442782.1_2 Forward -338 -324 4.81781 0.25
NP_441414.1_9 Reverse -329 -348 6.39097 0.0404
NP_440607.1_5 Forward -329 -310 9.3409 0.127
NP_441256.1_1 Forward -341 -322 -7.27704 0.239
NP_441958.1_5 Forward -339 -329 12.2714 0.00183
NP_441958.1_5 Reverse -328 -338 12.2714 0.00183
NP_441958.1_5 Reverse -316 -326 -1.10161 0.23
NP_441127.1_1 Forward -176 -162 9.73436 0.268
NP_441127.1_1 Forward -185 -171 8.45605 0.295
NP_442836.1_5 Forward -351 -332 5.99764 0.185
NP_440203.1_5 Forward -198 -188 14.4342 0.0886
NP_439905.1_1 Reverse -330 -343 13.1956 0.177
NP_439905.1_2 Reverse -318 -332 8.84938 0.241
NP_440984.1_7 Forward -343 -329 21.3374 0.00311
NP_440984.1_7 Forward -221 -207 9.93102 0.126
NP_439990.1_5 Forward -20 -7 7.19745 0.207
NP_442911.1_2 Forward -348 -329 2.94938 0.0472
NP_442911.1_2 Reverse -319 -338 0.196116 0.069
NP_442911.1_2 Reverse -307 -326 -7.37537 0.208
NP_440153.1_5 Reverse -40 -54 5.80112 0.191
NP_441591.1_10 Reverse -327 -346 9.43923 0.204
NP_443055.1_6 Reverse -321 -339 -0.0799167 0.252
NP_440934.1_1 Reverse -315 -334 7.66927 0.233
NP_439975.1_2 Reverse -19 -37 20.177 0.0962
NP_441099.1_5 Reverse -319 -338 14.3558 0.0166
NP_442002.1_9 Forward -339 -332 10.7572 0.185
NP_441294.1_7 Reverse -332 -346 13.7621 0.0568
NP_441294.1_7 Forward -342 -328 12.9942 0.0767
NP_442438.1_10 Reverse -324 -338 12.9793 0.0368
NP_442438.1_10 Forward -343 -329 3.73617 0.157
NP_442431.1_10 Forward -278 -260 0.609134 0.269
NP_441000.1_6 Forward -339 -325 4.81781 0.0933
NP_441000.1_6 Reverse -328 -342 -4.03198 0.225
NP_442771.1_1 Reverse -315 -333 -4.70074 0.166
NP_440147.1_4 Forward -340 -327 20.2755 0.00228
NP_440147.1_4 Reverse -327 -340 7.49244 0.0678
NP_441550.1_8 Reverse -327 -337 15.1225 0.0132
NP_441550.1_8 Forward -340 -330 8.3377 0.124
NP_441550.1_8 Reverse -315 -325 5.87944 0.224
NP_441916.1_7 Reverse -329 -339 18.4663 0.00144
NP_441916.1_7 Forward -338 -328 10.3048 0.0261
NP_440206.1_4 Reverse -319 -338 0.195343 0.289
NP_440465.1_10 Reverse -305 -324 -0.295539 0.29
NP_441041.1_4 Forward -338 -319 0.687771 0.084
NP_441041.1_4 Reverse -186 -205 -3.54046 0.123
NP_441041.1_4 Forward -206 -187 -13.2752 0.285
NP_441041.1_7 Forward -341 -329 9.65268 0.108
NP_441041.1_7 Reverse -326 -338 7.51478 0.162
NP_441041.1_7 Forward -41 -29 4.98816 0.282
NP_442396.1_5 Forward -342 -329 9.45906 0.129
NP_442004.1_6 Forward -338 -324 8.84938 0.14
NP_442004.1_6 Reverse -255 -269 5.30946 0.191
NP_441725.1_4 Reverse -324 -338 2.94893 0.279
NP_441725.1_5 Forward -337 -327 2.04498 0.115
NP_441725.1_5 Reverse -330 -340 2.04498 0.115
NP_441725.1_5 Reverse -318 -328 -0.806614 0.271
NP_439966.1_7 Reverse -327 -337 15.3192 0.0152
NP_439966.1_7 Forward -340 -330 9.91099 0.0968
NP_439966.1_9 Forward -340 -331 0.884706 0.253
NP_442941.1_3 Forward -337 -327 19.2529 0.00262
NP_442941.1_3 Forward -263 -253 5.38824 0.115
NP_442941.1_3 Reverse -330 -340 2.63497 0.14
NP_440289.1_2 Forward -341 -328 3.16588 0.0811
NP_440289.1_2 Reverse -326 -339 -3.61896 0.267
NP_440983.1_5 Forward -188 -169 -2.85214 0.232
NP_440983.1_9 Reverse -320 -339 1.96607 0.292
NP_440260.1_8 Reverse -320 -338 6.60732 0.154
NP_442281.1_1 Forward -343 -329 11.2087 0.0497
NP_442281.1_1 Reverse -324 -338 7.27547 0.104
NP_442281.1_1 Forward -331 -317 5.1122 0.169
NP_441334.1_7 Forward -340 -321 -20.3551 0.275
NP_442256.1_2 Reverse -327 -345 3.75572 0.107
NP_440437.1_1 Reverse -323 -342 -3.14714 0.232
NP_442012.1_1 Reverse -245 -264 5.211 0.153
NP_442012.1_1 Reverse -311 -330 2.55606 0.198
NP_442012.1_1 Reverse -323 -342 -0.000545616 0.249
NP_441087.1_6 Forward -34 -16 -3.22649 0.296
NP_441556.1_2 Forward -276 -258 18.702 0.236
NP_441556.1_4 Forward -335 -316 14.729 0.165
NP_441556.1_10 Forward -343 -329 17.2301 0.0842
NP_441556.1_10 Reverse -171 -185 13.7259 0.178
NP_440498.1_1 Forward -347 -329 18.112 0.0181
NP_440498.1_1 Reverse -320 -338 -1.35749 0.223
NP_442982.1_5 Forward -348 -329 -1.7705 0.269
NP_443030.1_4 Forward -207 -188 -5.50708 0.272
NP_441196.1_7 Reverse -312 -331 10.4225 0.294
NP_441644.1_6 Forward -338 -328 17.3841 0.00127
NP_441644.1_6 Forward -326 -316 11.091 0.0552
NP_441644.1_6 Reverse -329 -339 10.1076 0.0628
NP_440652.1_10 Forward -341 -322 3.04771 0.283
NP_442215.1_2 Forward -340 -324 3.79511 0.0918
NP_442215.1_2 Reverse -327 -343 -2.39974 0.197
NP_442029.1_1 Reverse -108 -127 -20.3551 0.297
NP_442029.1_6 Forward -269 -250 14.1591 0.125
NP_442029.1_6 Reverse -324 -343 8.84924 0.2
NP_440929.1_8 Forward -338 -329 19.2726 0.000701
NP_440929.1_8 Reverse -329 -338 19.2726 0.000701
NP_442933.1_10 Forward -338 -329 17.601 0.00325
NP_442933.1_10 Reverse -329 -338 17.601 0.00325
NP_442933.1_10 Reverse -255 -264 5.3096 0.203
NP_440430.1_4 Forward -210 -191 16.2232 0.214
NP_441751.2_8 Forward -337 -323 14.6509 0.0119
NP_442926.1_3 Forward -337 -318 8.25926 0.173
NP_442554.1_8 Forward -337 -327 16.2046 0.0065
NP_442554.1_8 Reverse -330 -340 13.2547 0.0187
NP_442554.1_8 Reverse -318 -328 1.84832 0.292
NP_441762.1_7 Reverse -328 -340 10.1671 0.0142
NP_441762.1_7 Forward -339 -327 2.39892 0.0676
NP_442142.1_4 Reverse -326 -339 16.0466 0.0264
NP_442142.1_4 Reverse -288 -301 6.21356 0.17
NP_442142.1_4 Forward -341 -328 4.73861 0.212
NP_442142.1_4 Forward -198 -185 3.36198 0.258
NP_442292.1_1 Forward -337 -328 18.486 0.00229
NP_442292.1_1 Reverse -330 -339 9.63616 0.0183
NP_440919.1_2 Reverse -122 -141 -2.36049 0.274
NP_442476.1_6 Forward -337 -323 7.57108 0.112
NP_442476.1_6 Reverse -330 -344 7.37441 0.114
NP_442476.1_6 Reverse -256 -270 7.37441 0.114
NP_442381.1_8 Forward -341 -322 -5.21209 0.141
NP_441711.1_4 Forward -225 -206 15.8307 0.0429
NP_443009.1_5 Reverse -328 -339 18.3477 0.00265
NP_442408.2_1 Reverse -329 -348 8.16093 0.143
NP_441371.1_3 Forward -169 -151 8.08229 0.277
NP_441715.1_4 Forward -337 -327 17.3846 0.0106
NP_441715.1_4 Reverse -330 -340 9.41981 0.097
NP_440357.1_3 Forward -340 -321 3.34271 0.242
NP_440158.1_8 Reverse -315 -334 11.0125 0.249
NP_440183.1_9 Forward -331 -312 -13.3736 0.26
NP_440379.1_5 Reverse -314 -333 6.98095 0.133
NP_440379.1_5 Forward -342 -323 2.0644 0.153
NP_441468.1_1 Forward -337 -330 15.8704 0.0124
NP_441468.1_1 Reverse -330 -337 15.8704 0.0124
NP_441020.2_6 Forward -328 -311 9.87194 0.159
NP_441020.2_6 Forward -340 -323 9.67528 0.165
NP_441020.2_6 Forward -65 -48 8.00365 0.212
NP_441015.1_10 Reverse -324 -343 -5.21209 0.219
NP_441015.1_10 Forward -337 -318 -9.047 0.278
NP_441673.1_1 Forward -338 -329 20.8459 0.000698
NP_441673.1_1 Reverse -329 -338 20.8459 0.000698
NP_441876.1_9 Reverse -163 -173 11.1893 0.28
NP_441826.1_2 Reverse -323 -337 -4.13031 0.292
NP_442490.1_9 Reverse -305 -324 0.196116 0.175
NP_442490.1_9 Reverse -317 -336 -5.60541 0.273
NP_442490.1_9 Forward -338 -319 -5.99873 0.273
NP_441764.1_8 Reverse -229 -239 12.3635 0.284
NP_442868.1_6 Reverse -327 -337 19.2529 0.00563
NP_442868.1_6 Forward -340 -330 0.865012 0.205
NP_441056.1_1 Forward -338 -319 -0.000545616 0.156
NP_441612.1_2 Forward -338 -328 8.54929 0.21
NP_441612.1_2 Reverse -152 -162 7.19391 0.26
NP_442427.1_5 Forward -327 -308 12.1925 0.148
NP_442808.1_1 Forward -339 -329 18.4657 0.00201
NP_442808.1_1 Reverse -328 -338 8.63269 0.0481
NP_442542.1_2 Forward -340 -327 9.36073 0.135
NP_442542.1_9 Forward -345 -331 11.4053 0.111
NP_442050.1_5 Reverse -327 -337 14.3359 0.0206
NP_442050.1_5 Reverse -253 -263 10.206 0.162
NP_442342.1_9 Reverse -315 -331 2.41848 0.29
NP_441937.1_5 Forward -194 -175 6.19431 0.26
NP_440558.1_2 Reverse -320 -339 6.19431 0.136
NP_440558.1_2 Forward -204 -185 -1.37718 0.214
NP_440558.1_2 Reverse -188 -207 -2.16383 0.223
NP_441048.1_4 Forward -320 -301 10.5209 0.266
NP_441518.1_3 Reverse -319 -338 -14.7502 0.28
NP_441878.1_4 Reverse -315 -334 6.88262 0.24
NP_441878.1_6 Forward -339 -329 10.4031 0.0176
NP_441878.1_6 Reverse -328 -338 10.4031 0.0176
NP_441878.1_6 Forward -327 -317 2.53664 0.0363
NP_441878.1_6 Reverse -316 -326 -0.0199663 0.163
NP_441878.1_6 Reverse -284 -294 -7.59145 0.245
NP_441878.1_6 Reverse -317 -327 -7.98478 0.285
NP_441036.1_8 Forward -339 -329 17.7779 0.000554
NP_441036.1_8 Reverse -328 -338 8.33817 0.174
NP_441557.1_5 Forward -338 -329 19.9609 0.000699
NP_441557.1_5 Reverse -329 -338 19.9609 0.000699
NP_441445.1_1 Forward -335 -316 4.42435 0.195
NP_441445.1_1 Reverse -320 -339 3.93269 0.204
NP_442419.1_2 Forward -337 -318 -2.0655 0.246
NP_440744.1_2 Reverse -317 -336 14.916 0.276
NP_440101.1_3 Forward -343 -324 16.6174 0.0483
NP_440101.1_5 Forward -345 -326 1.27776 0.256
NP_442469.1_7 Reverse -312 -331 15.3391 0.282
NP_442166.1_7 Forward -337 -323 10.1277 0.19
NP_442397.1_9 Forward -345 -326 3.04771 0.264
NP_441574.1_1 Reverse -116 -135 3.6377 0.142
NP_440276.1_8 Forward -29 -10 15.2408 0.101
NP_441549.1_9 Forward -342 -324 -2.0458 0.186
NP_441549.1_9 Reverse -313 -331 -10.1089 0.269
NP_442347.1_2 Forward -337 -328 12.4878 0.056
NP_442347.1_2 Reverse -330 -339 11.1111 0.056
NP_442347.1_2 Reverse -256 -265 5.99792 0.201
NP_442645.1_2 Reverse -321 -340 6.68596 0.0177
NP_442645.1_2 Forward -218 -199 -16.9135 0.245
NP_441037.1_4 Forward -340 -330 14.7245 0.028
NP_440690.1_1 Forward -60 -41 6.98095 0.249
NP_441633.1_3 Reverse -327 -340 10.8357 0.0286
NP_441633.1_3 Forward -340 -327 3.46087 0.0699
NP_440136.1_2 Forward -337 -330 15.9687 0.0123
NP_440136.1_2 Reverse -330 -337 15.9687 0.0123
NP_440136.1_2 Forward -263 -256 3.97235 0.288
NP_442590.1_10 Forward -345 -326 6.19431 0.249
NP_442998.1_5 Reverse -151 -161 13.1564 0.158
NP_442998.1_10 Forward -336 -329 15.5754 0.0102
NP_442998.1_10 Reverse -331 -338 15.5754 0.0102
NP_440299.1_1 Reverse -325 -338 16.5383 0.00987
NP_440299.1_1 Forward -342 -329 8.08184 0.098
NP_440299.1_1 Forward -123 -110 3.55864 0.241
NP_441799.1_1 Forward -342 -328 18.2885 0.00852
NP_441799.1_1 Reverse -325 -339 17.0102 0.0123
NP_441007.1_10 Forward -343 -330 1.88757 0.203
NP_441007.1_10 Reverse -324 -337 1.39592 0.203
NP_442333.2_5 Forward -337 -318 -3.3438 0.214
NP_440256.1_1 Reverse -326 -345 2.85105 0.0589
NP_440256.1_1 Forward -70 -51 0.687771 0.0814
NP_440256.1_1 Forward -341 -322 -9.34199 0.278
NP_440256.1_1 Reverse -288 -307 -10.227 0.297
NP_441512.1_4 Reverse -325 -344 8.06259 0.264
NP_441559.1_8 Reverse -324 -338 0.786239 0.161
NP_441559.1_8 Reverse -172 -186 0.392915 0.167
NP_441559.1_8 Reverse -300 -314 -5.90027 0.271
NP_441559.1_8 Forward -343 -329 -7.17857 0.287
NP_441559.1_8 Forward -205 -191 -7.37523 0.291
NP_441270.1_5 Forward -282 -263 12.2135 0.244
NP_440915.1_6 Reverse -325 -339 7.86607 0.0637
NP_440915.1_6 Forward -42 -28 -1.67204 0.243
NP_440915.1_6 Forward -268 -254 -3.44199 0.296
NP_440717.1_1 Reverse -330 -349 22.4189 0.0374
NP_442785.1_7 Reverse -327 -341 10.3243 0.229
NP_441866.1_6 Reverse -55 -74 18.0915 0.117
NP_442866.1_1 Reverse -312 -331 -1.96717 0.205
NP_440695.1_5 Reverse -317 -336 -1.57384 0.285
NP_441939.1_3 Forward -337 -318 18.879 0.014
NP_441939.1_3 Reverse -330 -349 10.6192 0.123
NP_441199.1_6 Forward -330 -311 0.786102 0.233
NP_442993.1_1 Forward -168 -152 -1.3181 0.0893
NP_442993.1_1 Reverse -329 -345 -8.98791 0.178
NP_442993.1_1 Reverse -170 -186 -9.77456 0.194
NP_442386.1_9 Forward -339 -330 15.7322 0.0144
NP_442386.1_9 Reverse -328 -337 13.8639 0.0289
NP_441340.1_5 Forward -337 -330 15.6737 0.0124
NP_441340.1_5 Reverse -330 -337 15.6737 0.0124
NP_441947.1_4 Reverse -190 -209 10.8159 0.283
NP_442484.1_2 Reverse -318 -337 12.3892 0.0782
NP_440168.1_9 Reverse -190 -209 -1.86883 0.28
NP_439976.1_1 Forward -158 -146 20.8845 0.128
NP_439976.1_3 Forward -76 -57 19.6648 0.0607
NP_439976.1_4 Forward -307 -288 23.008 0.0517
NP_439976.1_5 Forward -240 -226 16.3219 0.257
NP_439976.1_6 Forward -372 -359 20.4721 0.187
NP_439976.1_7 Forward -204 -187 24.9166 0.0206
NP_442506.1_2 Reverse -318 -337 2.55606 0.278
NP_440586.1_8 Forward -337 -330 13.2151 0.026
NP_440586.1_8 Reverse -330 -337 13.2151 0.026
NP_440586.1_8 Forward -194 -187 9.08521 0.178
NP_442251.1_6 Forward -337 -330 15.2804 0.0124
NP_442251.1_6 Reverse -330 -337 15.2804 0.0124
NP_440192.1_4 Forward -340 -321 8.52442 0.296
NP_440684.1_9 Forward -185 -171 6.98109 0.283
NP_441262.1_3 Reverse -329 -336 14.7888 0.0223
NP_441262.1_3 Forward -338 -331 14.7888 0.0223
NP_440027.1_3 Reverse -285 -303 1.78836 0.295
NP_443051.1_1 Reverse -328 -337 10.4228 0.00754
NP_443051.1_1 Forward -339 -330 10.4228 0.00754
NP_441232.1_10 Reverse -318 -337 9.63589 0.133
NP_440408.1_7 Reverse -317 -336 12.2908 0.212
NP_440439.1_1 Reverse -326 -339 9.16406 0.0465
NP_440439.1_1 Reverse -26 -39 5.03416 0.0943
NP_440439.1_1 Forward -341 -328 3.65753 0.11
NP_442239.1_8 Reverse -311 -330 5.70265 0.266
NP_440372.1_2 Forward -337 -330 16.3621 0.0124
NP_440372.1_2 Reverse -330 -337 16.3621 0.0124
NP_440819.1_5 Reverse -151 -159 7.59091 0.272
NP_441803.1_2 Reverse -324 -343 0.196116 0.258
NP_441616.1_1 Reverse -247 -266 1.96607 0.198
NP_441572.1_7 Forward -344 -325 -2.45882 0.196
NP_442384.1_10 Forward -338 -325 19.8821 0.00338
NP_442384.1_10 Reverse -329 -342 15.4572 0.00986
NP_441980.1_4 Forward -274 -255 2.94938 0.283
NP_441877.1_5 Forward -204 -185 0.392778 0.276
NP_441877.1_7 Forward -196 -177 3.73524 0.218
NP_441018.1_7 Forward -342 -323 13.0775 0.142
NP_442790.1_4 Reverse -308 -327 -13.6686 0.266
NP_442262.1_10 Forward -337 -330 14.1988 0.0123
NP_442262.1_10 Reverse -330 -337 14.1988 0.0123
NP_442262.1_10 Forward -194 -187 9.18389 0.211
NP_442262.1_10 Forward -293 -286 8.59391 0.22
NP_441689.1_5 Reverse -253 -263 15.0242 0.0617
NP_441689.1_5 Forward -69 -59 5.78111 0.197
NP_441689.1_5 Reverse -327 -337 5.78111 0.197
NP_440344.1_10 Forward -345 -328 -8.81095 0.134
NP_440344.1_10 Reverse -322 -339 -11.4659 0.215
NP_440282.1_10 Reverse -319 -338 -5.80207 0.25
NP_440531.1_6 Forward -302 -283 1.96607 0.166
NP_440531.1_6 Forward -346 -327 0.687771 0.19
NP_440531.1_6 Reverse -321 -340 0.491109 0.191
NP_442910.1_1 Reverse -322 -341 -5.50708 0.254
NP_440189.1_2 Reverse -151 -170 -0.885524 0.293
NP_441965.1_10 Reverse -326 -342 7.82668 0.14
NP_441965.1_10 Forward -341 -325 3.99177 0.252
NP_440297.1_9 Reverse -318 -328 0.176696 0.282
NP_440297.1_9 Forward -337 -327 -0.118297 0.282
NP_440297.1_9 Reverse -330 -340 -0.118297 0.282
NP_440297.1_9 Reverse -187 -197 -0.314959 0.282
NP_440350.1_5 Forward -23 -4 -6.58872 0.296
NP_441592.1_4 Forward -338 -319 -0.590531 0.244
NP_441592.1_4 Forward -332 -313 -1.57384 0.254
NP_442067.1_4 Reverse -165 -184 8.65258 0.194
NP_442067.1_4 Forward -349 -330 4.52268 0.256
NP_440999.1_9 Forward -342 -328 9.04604 0.0683
NP_440999.1_9 Reverse -377 -391 -3.147 0.287
NP_440999.1_9 Forward -304 -290 -3.34366 0.291
NP_440888.1_2 Forward -338 -324 15.2402 0.0118
NP_440888.1_2 Reverse -329 -343 8.16044 0.171
NP_439969.1_3 Forward -343 -324 0.0977854 0.27
NP_442033.1_10 Reverse -174 -193 -8.06369 0.189
NP_440917.1_2 Reverse -70 -89 17.18 0.294
NP_441543.1_2 Reverse -330 -339 18.486 0.00236
NP_441543.1_2 Forward -337 -328 16.9127 0.00359
NP_442845.1_2 Forward -270 -256 8.16106 0.195
NP_442845.1_2 Forward -338 -324 4.42448 0.259
NP_441178.1_4 Reverse -322 -341 12.2908 0.21
NP_441319.1_8 Reverse -323 -341 9.85225 0.205
NP_441469.1_8 Forward -339 -330 16.126 0.00797
NP_441469.1_8 Reverse -328 -337 6.48957 0.227
NP_443064.1_6 Forward -338 -328 12.5669 0.0796
NP_442578.1_7 Forward -337 -330 14.5921 0.026
NP_442578.1_7 Reverse -330 -337 14.5921 0.026
NP_440710.1_1 Reverse -321 -339 -7.65067 0.241
NP_441462.1_2 Forward -338 -328 11.5831 0.00406
NP_441462.1_2 Reverse -329 -339 11.5831 0.00406
NP_441462.1_2 Reverse -317 -327 7.05986 0.0598
NP_441621.1_7 Forward -340 -326 -3.24533 0.188
NP_443062.1_1 Reverse -186 -204 11.1786 0.103
NP_443062.1_1 Reverse -58 -76 5.71821 0.22
NP_443062.1_6 Forward -334 -315 1.37609 0.276
NP_441601.1_2 Forward -266 -247 0.58944 0.219
NP_442204.1_1 Reverse -203 -214 2.41861 0.266
NP_442204.1_1 Reverse -325 -336 1.82863 0.266
NP_442204.1_2 Forward -336 -317 6.39097 0.287
NP_442204.1_5 Forward -348 -329 18.4857 0.0277
NP_440516.1_2 Reverse -195 -213 3.65739 0.145
NP_440516.1_2 Forward -344 -326 -1.55415 0.287
NP_440516.1_8 Forward -338 -329 16.9127 0.00442
NP_440516.1_8 Reverse -329 -338 16.9127 0.00442
NP_442428.1_4 Forward -339 -320 5.80098 0.211
NP_442428.1_4 Reverse -316 -335 2.75272 0.248
NP_442428.1_5 Forward -337 -330 15.8704 0.0124
NP_442428.1_5 Reverse -330 -337 15.8704 0.0124
NP_441032.1_1 Reverse -289 -308 10.3242 0.271
NP_440673.1_3 Forward -336 -329 12.4288 0.0426
NP_440673.1_3 Reverse -331 -338 12.4288 0.0426
NP_441052.1_2 Forward -338 -328 19.9412 0.00106
NP_441052.1_2 Reverse -329 -339 10.5014 0.0285
NP_441052.1_2 Reverse -39 -49 2.53664 0.201
NP_441052.1_2 Reverse -221 -231 0.766681 0.256
NP_442219.1_9 Forward -337 -328 17.7976 0.00718
NP_442219.1_9 Reverse -330 -339 8.35786 0.0681
NP_442219.1_9 Reverse -256 -265 5.70292 0.135
NP_440436.1_4 Reverse -330 -339 18.1905 0.00233
NP_440436.1_4 Forward -337 -328 17.2072 0.00233
NP_441884.1_8 Forward -339 -320 -10.0303 0.268
NP_441884.1_9 Forward -219 -200 -10.4236 0.0774
NP_441884.1_9 Forward -341 -322 -22.0267 0.275
NP_441884.1_9 Reverse -326 -345 -23.6983 0.284
NP_442864.1_7 Reverse -311 -329 6.90232 0.274
NP_441719.1_4 Forward -337 -330 16.3621 0.0124
NP_441719.1_4 Reverse -330 -337 16.3621 0.0124
NP_441719.1_4 Forward -263 -256 3.77569 0.285
NP_441733.1_10 Reverse -326 -339 7.39411 0.153
NP_442366.1_3 Reverse -328 -346 -3.42244 0.247
NP_442366.1_5 Forward -341 -331 15.2208 0.0375
NP_440296.1_10 Reverse -326 -345 -12.8819 0.269
NP_442206.1_10 Forward -200 -185 1.2582 0.236
NP_440328.1_4 Forward -344 -325 4.52268 0.164
NP_443054.1_2 Forward -328 -314 8.94771 0.104
NP_443054.1_2 Reverse -327 -341 8.94771 0.104
NP_443054.1_2 Forward -225 -211 6.78443 0.18
NP_443054.1_2 Reverse -165 -179 0.589577 0.258
NP_442308.1_4 Reverse -323 -342 8.75091 0.267
NP_441851.1_9 Forward -330 -311 7.66927 0.279
NP_441851.1_10 Forward -339 -329 16.008 0.00552
NP_441851.1_10 Reverse -328 -338 15.8113 0.00552
NP_442011.1_1 Reverse -328 -347 -1.57384 0.268
NP_442856.1_7 Forward -347 -328 12.0942 0.069
NP_442856.1_7 Reverse -320 -339 -6.58872 0.299
NP_442515.1_1 Reverse -328 -342 4.42448 0.107
NP_440593.1_3 Forward -241 -222 -6.58872 0.278
NP_441349.1_10 Reverse -319 -338 -7.08038 0.242
NP_441349.1_10 Reverse -211 -230 -7.96535 0.262
NP_441349.1_10 Forward -348 -329 -9.24366 0.287
NP_441409.1_6 Reverse -201 -220 -3.83545 0.0877
NP_442843.1_1 Forward -194 -175 -4.03212 0.232
NP_442843.1_1 Reverse -286 -305 -6.88371 0.245
NP_439960.1_10 Reverse -322 -340 3.75572 0.163
NP_440474.1_8 Reverse -330 -344 5.30886 0.251
NP_441150.1_6 Reverse -76 -95 19.8614 0.0874
NP_442450.1_5 Forward -340 -330 7.55152 0.13
NP_442168.1_5 Forward -337 -318 8.35759 0.159
NP_442168.1_5 Reverse -256 -275 -1.37718 0.264
NP_440588.1_2 Forward -347 -328 10.1275 0.0396
NP_440588.1_2 Reverse -320 -339 -0.787193 0.154
NP_440040.1_6 Forward -394 -375 11.4058 0.181
NP_440943.1_1 Reverse -144 -163 8.75091 0.29
NP_442006.1_2 Forward -72 -55 -16.2841 0.247
NP_442006.1_2 Forward -176 -159 -18.4474 0.291
NP_441570.1_1 Forward -338 -320 9.65558 0.0103
NP_441570.1_1 Reverse -329 -347 -16.3038 0.242
NP_441078.1_4 Forward -338 -329 19.6659 0.0007
NP_441078.1_4 Reverse -329 -338 19.6659 0.0007
NP_441078.1_4 Forward -326 -317 -1.86856 0.272
NP_440526.1_3 Forward -337 -326 8.02298 0.126
NP_441432.1_8 Reverse -328 -337 16.8143 0.00595
NP_441432.1_8 Forward -339 -330 8.25953 0.0755
NP_441432.1_8 Reverse -191 -200 2.65466 0.292
NP_442320.1_8 Forward -270 -256 -3.54032 0.124
NP_442344.1_7 Reverse -330 -349 -6.29373 0.171
NP_441732.1_2 Forward -342 -326 -7.80794 0.0935
NP_441732.1_2 Reverse -325 -341 -15.9694 0.164
NP_441732.1_2 Reverse -203 -219 -17.4444 0.258
NP_440497.1_2 Forward -337 -318 4.916 0.287
NP_442540.1_5 Forward -338 -319 11.7 0.233
NP_440629.1_6 Reverse -323 -342 15.7259 0.117
NP_440760.1_1 Reverse -329 -348 -12.2919 0.0927
NP_440760.1_1 Forward -338 -319 -13.0786 0.0976
NP_442797.1_7 Reverse -322 -340 3.95239 0.234
NP_440199.1_10 Reverse -237 -247 6.76487 0.269
NP_442353.1_4 Forward -344 -325 10.6184 0.106
NP_442353.1_4 Forward -212 -193 1.96529 0.24
NP_442510.1_5 Reverse -320 -339 16.8141 0.171
NP_440913.1_3 Reverse -311 -324 15.3589 0.215
NP_442751.1_2 Reverse -175 -194 3.9319 0.263
NP_441072.1_2 Reverse -325 -344 6.29264 0.283
NP_440713.1_4 Reverse -319 -338 23.5989 0.00429
NP_440713.1_4 Forward -336 -317 6.09597 0.196
NP_440713.1_4 Reverse -197 -216 0.982764 0.298
NP_442489.1_7 Forward -338 -329 20.1576 0.000695
NP_442489.1_7 Reverse -329 -338 20.1576 0.000695
NP_442489.1_7 Forward -326 -317 -1.18024 0.18
NP_440757.1_7 Forward -331 -313 10.6389 0.156
NP_442079.1_7 Forward -337 -318 3.24438 0.212
NP_442079.1_7 Reverse -256 -275 0.982764 0.266
NP_440559.1_1 Forward -337 -328 17.4043 0.00658
NP_440559.1_1 Reverse -330 -339 8.75118 0.0586
NP_441659.2_8 Forward -338 -328 18.1713 0.00133
NP_441659.2_8 Reverse -329 -339 11.9764 0.0147
NP_441659.2_8 Reverse -317 -327 4.79825 0.125
NP_442913.1_10 Forward -347 -328 17.699 0.0136
NP_442913.1_10 Forward -225 -206 -1.7705 0.176
NP_441040.1_2 Forward -347 -328 -14.9469 0.286
NP_441040.1_5 Forward -343 -324 7.07928 0.229
NP_439956.1_7 Reverse -186 -205 7.7676 0.257
NP_442008.1_2 Forward -341 -322 5.30933 0.226
NP_442008.1_2 Reverse -314 -333 2.3594 0.289
NP_442776.1_1 Reverse -318 -337 8.94757 0.181
NP_442346.1_5 Reverse -328 -338 16.6963 0.00248
NP_442346.1_5 Forward -339 -329 9.02648 0.118
NP_440545.1_3 Reverse -325 -342 5.9387 0.0587
NP_440545.1_3 Reverse -313 -330 2.98877 0.0903
NP_440545.1_3 Forward -342 -325 -3.79607 0.212
NP_440545.1_3 Forward -330 -313 -4.18939 0.22
NP_441856.1_3 Reverse -237 -256 2.75272 0.19
NP_441856.1_6 Reverse -290 -304 15.9292 0.26
NP_440831.1_3 Forward -347 -328 7.64914 0.247
NP_440486.1_6 Reverse -316 -335 13.6675 0.207
NP_441653.1_2 Reverse -318 -337 12.8065 0.0959
NP_442311.1_5 Forward -306 -287 4.32602 0.245
NP_440847.1_3 Reverse -160 -174 17.6985 0.115
NP_440449.1_6 Forward -346 -328 9.1312 0.187
NP_441948.1_4 Reverse -322 -340 0.21581 0.136
NP_441948.1_4 Forward -345 -327 -1.35749 0.146
NP_441047.1_2 Forward -200 -181 -2.16383 0.273
NP_441833.1_4 Forward -337 -330 15.9687 0.0124
NP_441833.1_4 Reverse -330 -337 15.9687 0.0124
NP_442060.1_5 Reverse -316 -335 11.8975 0.29
NP_442162.1_9 Forward -337 -330 16.2637 0.0124
NP_442162.1_9 Reverse -330 -337 16.2637 0.0124
NP_440671.1_4 Forward -332 -318 7.17775 0.226
NP_440224.1_1 Reverse -318 -337 1.67108 0.132
NP_440772.1_8 Forward -216 -197 7.27595 0.287
NP_442199.1_5 Reverse -321 -340 2.75272 0.142
NP_442140.1_3 Reverse -330 -340 16.2046 0.0255
NP_442140.1_3 Forward -337 -327 10.3048 0.0902
NP_440875.1_9 Forward -336 -326 8.37203 0.233
NP_440875.1_9 Forward -198 -188 7.00932 0.287
NP_440875.1_9 Forward -36 -26 6.91198 0.294
NP_441813.1_5 Reverse -327 -337 18.1713 0.00743
NP_441813.1_5 Forward -340 -330 9.91146 0.021
NP_440590.1_4 Reverse -330 -343 10.4424 0.027
NP_440590.1_4 Forward -337 -324 2.96921 0.0783
NP_440590.1_4 Forward -66 -53 -0.865694 0.203
NP_440567.1_1 Reverse -330 -344 15.4376 0.0176
NP_440567.1_1 Forward -337 -323 10.9143 0.0313
NP_440567.1_1 Reverse -256 -270 7.86607 0.0642
NP_440719.1_3 Forward -60 -41 18.5079 0.125
NP_442497.1_10 Forward -337 -328 10.4228 0.0087
NP_442497.1_10 Reverse -330 -339 10.4228 0.0087
NP_440821.1_4 Forward -340 -330 10.2065 0.0163
NP_440821.1_4 Reverse -327 -337 9.41981 0.0286
NP_441239.1_9 Forward -340 -328 12.3303 0.0477
NP_441239.1_9 Reverse -327 -339 7.80712 0.148
NP_441239.1_9 Reverse -165 -177 5.05386 0.231
NP_441239.1_9 Forward -328 -316 4.5622 0.251
NP_441892.1_4 Reverse -166 -185 -1.67217 0.291
NP_440665.1_1 Forward -338 -319 -16.9135 0.295
NP_440665.1_1 Reverse -317 -336 -17.1101 0.298
NP_442193.1_1 Reverse -192 -210 15.2604 0.187
NP_440354.1_7 Reverse -323 -341 6.01734 0.294
NP_440412.1_7 Reverse -151 -170 17.404 0.236
NP_440546.1_4 Reverse -329 -339 11.8882 0.0679
NP_440546.1_4 Forward -338 -328 10.046 0.109
NP_440462.1_6 Reverse -327 -337 9.61647 0.0429
NP_440462.1_6 Forward -340 -330 9.02648 0.0498
NP_440462.1_6 Forward -266 -256 4.60159 0.194
NP_440080.2_2 Forward -297 -283 17.4991 0.165
NP_440868.1_4 Forward -342 -330 20.2952 0.00865
NP_440868.1_4 Reverse -325 -337 15.0836 0.0164
NP_441582.1_5 Reverse -327 -346 10.2251 0.164
NP_440341.1_1 Reverse -15 -34 7.27595 0.214
NP_441084.1_6 Forward -197 -183 9.34412 0.287
NP_440696.1_3 Forward -304 -286 -1.84914 0.266
NP_440696.1_9 Reverse -314 -333 15.8299 0.296
NP_442882.1_7 Forward -345 -331 11.897 0.261
NP_442039.1_3 Reverse -48 -67 17.8957 0.139
NP_442039.1_4 Forward -337 -330 15.1821 0.0124
NP_442039.1_4 Reverse -330 -337 15.1821 0.0124
NP_440825.1_7 Reverse -330 -340 12.4217 0.155
NP_442696.1_2 Reverse -191 -209 10.7372 0.195
NP_442837.1_3 Forward -337 -330 15.7721 0.0124
NP_442837.1_3 Reverse -330 -337 15.7721 0.0124
NP_442837.1_3 Reverse -256 -263 8.79057 0.165
NP_442053.1_1 Forward -338 -329 18.3876 0.0007
NP_442053.1_1 Reverse -329 -338 18.3876 0.0007
NP_440505.1_3 Reverse -327 -337 18.3679 0.00213
NP_440505.1_3 Forward -340 -330 6.76487 0.169
NP_440505.1_7 Forward -345 -326 12.8808 0.146
NP_440505.1_7 Reverse -325 -344 1.0811 0.25
NP_442971.1_5 Reverse -161 -180 11.1109 0.25
NP_442255.1_6 Reverse -309 -328 21.8289 0.0318
NP_440914.1_1 Forward -338 -328 17.5935 0.000537
NP_440914.1_1 Forward -200 -190 8.81029 0.186
NP_440914.1_1 Reverse -329 -339 8.6151 0.186
NP_441011.1_8 Reverse -330 -339 16.9127 0.00602
NP_441011.1_8 Forward -337 -328 8.25953 0.144
NP_442533.1_1 Reverse -23 -42 -17.6018 0.291
NP_442533.1_6 Forward -338 -329 17.2076 0.00137
NP_442533.1_6 Reverse -329 -338 17.2076 0.00137
NP_442533.1_6 Forward -326 -317 10.6195 0.0529
NP_443016.1_1 Reverse -323 -342 -2.55715 0.225
NP_441482.1_7 Reverse -323 -337 -0.983719 0.0612
NP_441482.1_7 Forward -332 -318 -1.27871 0.0666
NP_439944.1_9 Forward -337 -327 10.5014 0.0887
NP_441028.1_6 Reverse -181 -191 5.19112 0.265
NP_440721.1_5 Reverse -264 -283 8.75009 0.221
NP_442202.1_4 Reverse -327 -341 14.1927 0.224
NP_440116.1_8 Forward -337 -318 -3.54046 0.154
NP_440115.1_6 Reverse -326 -336 16.008 0.0325
NP_440115.1_6 Reverse -314 -324 7.15819 0.158
NP_439965.1_1 Reverse -320 -339 -2.65548 0.177
NP_441347.1_5 Reverse -323 -337 11.7987 0.246
NP_443045.1_2 Forward -332 -313 12.7825 0.287
NP_441170.1_4 Reverse -320 -338 3.3624 0.283
NP_441972.1_5 Forward -337 -318 8.84924 0.0695
NP_441106.1_1 Forward -339 -330 18.191 0.0028
NP_441106.1_1 Reverse -328 -337 9.63616 0.0311
NP_439903.1_1 Reverse -288 -307 3.93269 0.214
NP_442306.1_3 Forward -328 -309 12.1925 0.267
NP_441286.1_1 Reverse -328 -340 6.03717 0.0258
NP_441286.1_1 Forward -339 -327 3.38223 0.0467
NP_441286.1_1 Reverse -206 -218 -7.04085 0.3
NP_440670.1_8 Forward -338 -329 18.3876 0.000699
NP_440670.1_8 Reverse -329 -338 18.3876 0.000699
NP_440670.1_8 Forward -216 -207 3.7363 0.23
NP_442908.1_8 Reverse -169 -188 15.4374 0.221
NP_440886.1_7 Forward -339 -329 17.7774 0.0011
NP_440886.1_7 Reverse -328 -338 7.94438 0.0805
NP_442614.1_2 Forward -338 -324 15.3392 0.0773
NP_442614.1_2 Reverse -329 -343 7.37441 0.275
NP_441753.1_10 Forward -347 -328 0.687771 0.287
NP_440907.2_8 Reverse -330 -340 14.2375 0.0312
NP_441287.1_3 Forward -292 -278 20.9441 0.184
NP_441021.1_1 Forward -337 -318 2.75272 0.083
NP_441021.1_8 Reverse -324 -342 1.69077 0.259
NP_441463.1_3 Reverse -319 -338 5.89931 0.0683
NP_441626.1_2 Forward -337 -330 15.7721 0.0124
NP_441626.1_2 Reverse -330 -337 15.7721 0.0124
NP_441626.1_6 Forward -342 -324 12.1131 0.177
NP_442365.1_7 Forward -342 -323 2.45773 0.168
NP_442794.1_1 Reverse -325 -337 10.2654 0.0721
NP_442615.1_1 Forward -347 -329 6.01734 0.0368
NP_442615.1_1 Reverse -320 -338 2.18243 0.0727
NP_441962.1_4 Reverse -324 -343 -8.65367 0.203
NP_441962.1_4 Forward -331 -312 -12.3902 0.256
NP_440387.1_1 Reverse -329 -345 13.7265 0.00818
NP_440387.1_1 Forward -338 -322 4.68009 0.0396
NP_440855.1_2 Forward -334 -315 11.5033 0.299
NP_441431.1_2 Reverse -326 -340 11.1104 0.146
NP_441431.1_2 Forward -341 -327 7.27547 0.244
NP_441836.1_2 Forward -344 -325 1.76941 0.187
NP_441836.1_2 Forward -188 -169 -3.44213 0.238
NP_442224.1_1 Forward -340 -321 -2.75381 0.233
NP_441174.1_2 Reverse -326 -340 13.7659 0.186
NP_440467.1_3 Forward -337 -318 15.5533 0.128
NP_440467.1_3 Reverse -318 -337 13.7954 0.183
NP_440114.1_10 Reverse -329 -343 12.9793 0.0681
NP_441237.1_9 Forward -293 -283 11.5831 0.17
NP_442743.1_4 Reverse -330 -349 -8.26035 0.289
NP_442743.1_5 Forward -337 -318 11.3075 0.142
NP_442743.1_5 Reverse -324 -343 7.57094 0.163
NP_440457.1_1 Reverse -325 -337 10.1671 0.092
NP_440457.1_1 Forward -330 -318 3.48056 0.195
NP_440798.1_6 Reverse -330 -343 15.3589 0.0423
NP_440798.1_6 Forward -344 -331 0.60927 0.254
NP_441984.1_3 Reverse -163 -181 5.32902 0.287
NP_440473.1_1 Reverse -326 -345 20.3196 0.0276
NP_440473.1_9 Forward -349 -330 -9.14533 0.26
NP_442509.1_9 Reverse -329 -339 16.2041 0.00739
NP_442509.1_9 Forward -338 -328 8.14104 0.192
NP_442514.1_5 Reverse -321 -340 -6.29447 0.265
NP_440734.1_9 Forward -320 -301 10.2259 0.282
NP_440554.1_4 Forward -337 -327 8.92815 0.0646
NP_440554.1_4 Reverse -330 -340 7.35486 0.103
NP_441885.1_5 Forward -338 -328 20.9245 0.000538
NP_441885.1_5 Reverse -329 -339 11.4848 0.00668
NP_440478.1_9 Reverse -321 -340 19.174 0.143
NP_440478.1_10 Forward -340 -326 17.7975 0.107
NP_440478.1_10 Reverse -199 -213 7.86607 0.257
NP_442341.1_7 Reverse -328 -342 15.6342 0.0218
NP_442341.1_9 Forward -340 -326 9.34041 0.155
NP_441756.1_5 Forward -329 -310 -5.11376 0.298
NP_442534.1_7 Forward -346 -327 5.70265 0.292
NP_443000.1_7 Reverse -327 -337 19.9412 0.00223
NP_443000.1_7 Forward -382 -372 2.63497 0.226
NP_443000.1_7 Forward -340 -330 1.94665 0.226
NP_440076.1_5 Reverse -322 -341 14.7483 0.201
NP_440507.2_3 Reverse -314 -333 10.1267 0.208
NP_441842.1_1 Reverse -331 -344 16.3416 0.0484
NP_441842.1_1 Forward -258 -245 14.5717 0.102
NP_441842.1_10 Forward -345 -331 16.5192 0.0311
NP_440275.1_3 Reverse -327 -337 15.123 0.0182
NP_440275.1_3 Forward -340 -330 8.33817 0.0602
NP_440275.1_3 Reverse -315 -325 6.17489 0.122
NP_440091.1_1 Reverse -325 -337 1.41561 0.197
NP_440091.1_1 Forward -342 -330 0.727295 0.233
NP_443060.1_1 Forward -315 -296 13.0766 0.166
NP_442451.1_2 Reverse -243 -262 -10.0303 0.264
NP_440149.1_8 Forward -338 -319 7.17762 0.0628
NP_440149.1_8 Reverse -329 -348 -6.58872 0.255
NP_440216.1_1 Reverse -329 -343 8.65272 0.00592
NP_440216.1_1 Forward -338 -324 8.55439 0.00592
NP_440172.1_1 Forward -338 -328 15.0247 0.00945
NP_440172.1_1 Reverse -329 -339 8.73149 0.0586
NP_440172.1_1 Reverse -192 -202 2.43831 0.279
NP_442015.1_10 Reverse -325 -338 11.4257 0.0372
NP_442015.1_10 Forward -342 -329 10.7374 0.0391
NP_442015.1_10 Forward -330 -317 5.23083 0.148
NP_441226.1_7 Forward -337 -330 14.4934 0.0123
NP_441226.1_7 Reverse -330 -337 14.4934 0.0123
NP_441226.1_7 Reverse -59 -66 5.93863 0.266
NP_441111.1_7 Forward -337 -329 18.7023 0.00294
NP_441111.1_7 Reverse -330 -338 18.7023 0.00294
NP_442379.1_10 Reverse -322 -339 -0.944468 0.223
NP_441766.1_2 Forward -338 -329 17.5026 0.00297
NP_441766.1_2 Reverse -329 -338 17.5026 0.00297
NP_440416.1_9 Reverse -322 -341 10.2259 0.0222
NP_440416.1_9 Forward -345 -326 -6.88371 0.0951
NP_440416.1_9 Forward -333 -314 -14.5535 0.178
NP_440416.1_9 Reverse -175 -194 -18.9784 0.267
NP_443052.1_8 Forward -348 -329 -8.06369 0.168
NP_442154.1_1 Forward -337 -319 -17.6804 0.262
NP_440261.1_5 Reverse -330 -343 6.90245 0.0316
NP_440261.1_5 Forward -337 -324 -2.73398 0.0924
NP_440261.1_5 Forward -325 -312 -2.73398 0.0924
NP_440988.1_10 Forward -50 -36 4.22114 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTGGCCCCTCCAGATTACAGGTGTACACATACTGTCCTGAGCTAAACCATAACTGCCTGTCGGCGATCGCCAGGCCGGTGGCCCCGATGAATTCCTGCCAGTACTGGCCATTGAGCAACTTAGTGTTGTTGGTGTAGGGATCGATTTCCAACAGATAACCATTTTTGCTGTCCACAGCCAAGAGACGCTCTCCATCGAAGACAATGCCATGGATGGAAACAGCGGCCACGGGACGAATGGTTTTTCCCACAAAAGTAGATGAATCGGGCACAGAATCGACAACCATAGACACTAGATGGCAGGACAGTTTAGGCAATTCTACAGCTTAACAAAGGGACCGGTGGAGCAGATGCTCATCACGAACGTTCCCCTCCTACTGTCCCTAGAGGTCGTGCTACC

CDS

ATGCCGTTAGAATGGAAAGGAGGGCAACAAAAACCACTGTTAAACTGTCCTTCTGTCCTAGGAAAGTGCTTCTGTCTGGGCACAATGTTGAGAGAAATTGCCAAAAGGATTGAGACAATGGCTAATAGGATAGGTTCACTAAGTTTGGGTTTACTCACTGCCCTAATGGGGGGAGAGTCCCTGGTATCCGTGGCGACGGCCGTCCCTTCGGCCCCCCCCCTGGCGATCGCCCAGAATGGAGTTTCCCCTTTGACGGTGGACGTTTTAAAAAACCTGAGCTACACCATTCCCGACCAAGGTACATATTCCCTTAACAATGGTGTGTTCGCTGGGGGAACTTTTAGCCTTAATCTGATCAAGCCCATTGCCATTGGGGATGTGGACCAAGACGGCGACCAGGATGGGGCGGTGATTCTCCGCCGACAGAGTGTAGTTAGTGCCGACGAATTGATCTATCTAGCGGTGGTGACCGTGGAGCCCGATGGTTCCCCCACTAACCCTGACACCTATTTCCTTGGCGATCGGGTGCGGGTGCAAAGTTTAGTGGTTAAAAATGGGCAAATCCGTCTCAACATCTTGAAGCACCAGCCGGGAGATCCCCAATGTTGCCCCAGTGCACTGGTTTCGGAGGCGTATCAGTTGAACAGTGGAGAAGGGACCCTCGCGCCGATCACCCTCAATGAACAGCAACGCCAAGAAATTCACATTCAGGATTTACCAAGCCAGGCCCTTCCGGGGGATCAAGACGAGCCATTCCAGCCCTCCCTCGATCAATTCCAAATTCAACTCTAG

Protein

MPLEWKGGQQKPLLNCPSVLGKCFCLGTMLREIAKRIETMANRIGSLSLGLLTALMGGESLVSVATAVPSAPPLAIAQNGVSPLTVDVLKNLSYTIPDQGTYSLNNGVFAGGTFSLNLIKPIAIGDVDQDGDQDGAVILRRQSVVSADELIYLAVVTVEPDGSPTNPDTYFLGDRVRVQSLVVKNGQIRLNILKHQPGDPQCCPSALVSEAYQLNSGEGTLAPITLNEQQRQEIHIQDLPSQALPGDQDEPFQPSLDQFQIQL