Your browser is old and dusty. Try Google Chrome!

Details for slr1115

ORF slr1115
Accession NP_439950.1
Symbol
Category Other
Definition probable methyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -224 -210 13.8643 0.0392
NP_441061.1_2 Forward -218 -204 2.2612 0.178
NP_440795.1_7 Forward -224 -217 14.6904 0.0123
NP_440795.1_7 Reverse -217 -224 14.6904 0.0123
NP_441418.1_6 Forward -225 -206 -10.6203 0.0375
NP_441418.1_6 Forward -165 -146 -11.6036 0.0538
NP_441418.1_6 Reverse -379 -398 -21.0434 0.136
NP_441418.1_6 Reverse -34 -53 -21.7317 0.159
NP_441418.1_6 Forward -255 -236 -29.1065 0.216
NP_441418.1_6 Forward -252 -233 -30.4831 0.28
NP_442291.1_5 Forward -226 -210 15.0048 0.0222
NP_440897.1_6 Reverse -216 -235 1.76863 0.17
NP_440897.1_6 Forward -225 -206 -0.886293 0.187
NP_441453.1_1 Reverse -27 -45 4.14829 0.263
NP_441453.1_4 Reverse -216 -224 16.539 0.00633
NP_441453.1_4 Forward -225 -217 16.539 0.00633
NP_441453.1_4 Forward -43 -35 6.80426 0.121
NP_441453.1_4 Reverse -34 -42 6.11594 0.121
NP_441453.1_4 Reverse -210 -218 5.42762 0.135
NP_442151.1_6 Reverse -216 -230 20.0591 0.0045
NP_442151.1_6 Forward -225 -211 18.7808 0.00618
NP_442151.1_6 Forward -219 -205 5.50613 0.274
NP_441818.1_1 Forward -224 -213 18.446 0.0046
NP_441818.1_1 Reverse -35 -46 10.1862 0.232
NP_441818.1_9 Forward -348 -329 -2.36049 0.203
NP_441818.1_9 Forward -183 -164 -7.67036 0.273
NP_440226.1_1 Forward -246 -227 3.14605 0.237
NP_442623.1_3 Forward -224 -205 -18.5851 0.263
NP_440996.1_4 Forward -261 -251 15.713 0.27
NP_442744.1_8 Reverse -216 -235 1.57275 0.216
NP_442287.1_5 Forward -247 -237 17.8763 0.19
NP_442173.1_1 Forward -224 -216 15.4574 0.00633
NP_442173.1_1 Reverse -217 -225 15.4574 0.00633
NP_442173.1_1 Reverse -35 -43 12.0158 0.0316
NP_442173.1_1 Forward -42 -34 10.7375 0.0611
NP_442752.1_4 Forward -225 -218 13.8055 0.0199
NP_442752.1_4 Reverse -216 -223 13.8055 0.0199
NP_442752.1_4 Forward -43 -36 13.8055 0.0199
NP_442752.1_4 Forward -246 -239 10.5605 0.1
NP_443027.1_4 Reverse -214 -224 14.0414 0.0452
NP_442975.1_10 Reverse -212 -226 12.782 0.0459
NP_442975.1_10 Forward -229 -215 2.65393 0.269
NP_441225.1_4 Forward -379 -360 -1.37718 0.237
NP_440784.1_7 Forward -224 -217 15.9687 0.0123
NP_440784.1_7 Reverse -217 -224 15.9687 0.0123
NP_440784.1_7 Forward -83 -76 6.43063 0.218
NP_440784.1_7 Forward -42 -35 6.23397 0.241
NP_440784.1_7 Reverse -35 -42 6.13563 0.241
NP_442909.1_7 Forward -224 -210 13.8636 0.12
NP_442909.1_7 Reverse -211 -225 9.83206 0.14
NP_440061.1_9 Reverse -32 -46 15.8302 0.0366
NP_440061.1_9 Forward -227 -213 12.9786 0.0878
NP_440061.1_9 Reverse -214 -228 10.422 0.124
NP_441054.1_1 Reverse -344 -358 16.5192 0.208
NP_441054.1_4 Reverse -206 -224 -0.275845 0.181
NP_441476.1_5 Reverse -205 -224 -5.21209 0.26
NP_439979.1_9 Reverse -288 -306 8.57394 0.26
NP_439979.1_9 Forward -359 -341 7.4923 0.288
NP_442062.1_8 Forward -225 -215 17.3846 0.00193
NP_442062.1_8 Reverse -216 -226 17.3846 0.00193
NP_442062.1_8 Reverse -127 -137 9.22315 0.0658
NP_442062.1_8 Forward -43 -33 7.25653 0.104
NP_442062.1_8 Forward -165 -155 2.83163 0.293
NP_441859.1_3 Reverse -209 -228 5.2102 0.206
NP_441859.1_3 Reverse -33 -52 3.53858 0.239
NP_440304.1_4 Reverse -214 -224 10.8948 0.051
NP_440304.1_4 Reverse -154 -164 5.28991 0.218
NP_440304.1_4 Forward -227 -217 1.84832 0.299
NP_442242.1_4 Forward -224 -217 14.3954 0.0124
NP_442242.1_4 Reverse -217 -224 14.3954 0.0124
NP_440044.1_8 Reverse -217 -236 11.1109 0.0513
NP_440044.1_8 Forward -224 -205 1.76941 0.164
NP_441781.1_7 Forward -387 -368 5.70265 0.186
NP_441781.1_7 Forward -225 -206 4.12936 0.187
NP_440916.1_1 Reverse -280 -294 8.06273 0.28
NP_441935.1_9 Forward -361 -342 15.899 0.142
NP_441208.1_9 Forward -228 -214 7.07942 0.227
NP_441594.1_6 Reverse -207 -226 1.86774 0.261
NP_441594.1_6 Reverse -78 -97 1.76941 0.262
NP_440132.1_1 Forward -45 -27 12.7038 0.193
NP_442110.1_7 Forward -225 -211 18.6825 0.0142
NP_442110.1_7 Reverse -216 -230 10.6193 0.0644
NP_441925.1_4 Reverse -230 -249 -5.1145 0.177
NP_440856.1_4 Reverse -68 -87 -1.7705 0.203
NP_440856.1_7 Reverse -198 -217 -2.16383 0.191
NP_441083.1_5 Forward -225 -215 20.3345 0.00053
NP_441083.1_5 Reverse -216 -226 20.3345 0.00053
NP_441083.1_5 Reverse -34 -44 8.73149 0.0307
NP_441083.1_5 Forward -43 -33 8.04317 0.046
NP_441083.1_5 Reverse -210 -220 -0.41329 0.267
NP_442827.1_8 Reverse -208 -227 0.293673 0.212
NP_441738.1_2 Forward -223 -216 15.28 0.0102
NP_441738.1_2 Reverse -218 -225 15.28 0.0102
NP_441738.1_2 Reverse -36 -43 15.28 0.0102
NP_441738.1_2 Forward -378 -371 6.72528 0.236
NP_441558.1_5 Forward -221 -202 6.29264 0.22
NP_441955.1_8 Reverse -150 -167 6.62702 0.281
NP_440209.1_1 Reverse -216 -224 18.1123 0.00295
NP_440209.1_1 Forward -225 -217 18.1123 0.00295
NP_440209.1_1 Forward -43 -35 8.57422 0.0425
NP_442889.1_1 Forward -360 -341 -14.2585 0.272
NP_442889.1_8 Forward -46 -32 11.4053 0.0733
NP_442889.1_8 Reverse -213 -227 4.22722 0.27
NP_440447.1_6 Forward -51 -33 1.19912 0.267
NP_441713.1_1 Forward -231 -212 -5.40875 0.113
NP_441713.1_1 Reverse -204 -223 -9.53865 0.178
NP_441713.1_2 Forward -36 -17 15.0441 0.291
NP_441770.1_4 Forward -245 -226 -11.2103 0.29
NP_440178.1_7 Forward -226 -207 -4.91709 0.0594
NP_440178.1_7 Forward -387 -368 -21.9284 0.246
NP_440178.1_7 Forward -285 -266 -22.42 0.265
NP_442706.1_5 Reverse -323 -342 12.8632 0.262
NP_442570.1_3 Reverse -26 -45 0.491109 0.206
NP_442570.1_3 Forward -389 -370 -8.26035 0.283
NP_441716.1_1 Forward -225 -211 15.7325 0.0467
NP_441716.1_1 Forward -165 -151 8.94771 0.13
NP_441716.1_1 Reverse -216 -230 3.93283 0.259
NP_441716.1_1 Reverse -210 -224 3.44117 0.265
NP_442111.1_4 Reverse -33 -47 20.2558 0.00327
NP_442111.1_4 Reverse -215 -229 12.0943 0.0451
NP_442111.1_4 Forward -226 -212 9.83269 0.0575
NP_442111.1_4 Forward -220 -206 3.53951 0.24
NP_440343.1_9 Forward -256 -237 15.7324 0.139
NP_440906.1_5 Forward -224 -217 15.8704 0.0124
NP_440906.1_5 Reverse -217 -224 15.8704 0.0124
NP_440906.1_5 Forward -42 -35 6.23397 0.234
NP_440906.1_5 Reverse -35 -42 6.13563 0.241
NP_440747.1_10 Forward -228 -216 24.7201 0.00036
NP_440747.1_10 Reverse -213 -225 7.51213 0.00286
NP_440747.1_10 Reverse -31 -43 5.05386 0.019
NP_440747.1_10 Reverse -72 -84 -11.9574 0.178
NP_440747.1_10 Forward -46 -34 -12.1541 0.227
NP_441486.1_1 Reverse -213 -227 23.4024 0.00162
NP_441486.1_1 Forward -228 -214 12.586 0.0112
NP_441486.1_1 Reverse -31 -45 -5.90027 0.266
NP_441880.2_10 Reverse -20 -38 9.45892 0.239
NP_442330.1_3 Reverse -354 -373 15.1424 0.0846
NP_442634.1_4 Forward -45 -31 -3.44199 0.161
NP_441265.1_3 Forward -231 -217 1.57289 0.2
NP_441014.1_5 Forward -230 -212 16.1454 0.2
NP_442848.1_1 Reverse -210 -224 8.35772 0.0791
NP_442848.1_1 Forward -99 -85 -4.4253 0.291
NP_442848.1_9 Reverse -373 -392 -0.0988766 0.278
NP_441012.1_4 Reverse -341 -354 5.72248 0.291
NP_443018.1_3 Forward -224 -217 14.8871 0.0123
NP_443018.1_3 Reverse -217 -224 14.8871 0.0123
NP_443018.1_3 Reverse -35 -42 11.7405 0.0655
NP_443018.1_3 Reverse -211 -218 10.6589 0.0967
NP_443018.1_3 Forward -42 -35 5.44732 0.193
NP_443018.1_3 Forward -218 -211 4.16902 0.278
NP_441634.1_8 Reverse -376 -390 -1.37704 0.288
NP_441634.1_8 Forward -227 -213 -3.93365 0.295
NP_441634.1_9 Forward -370 -351 11.0117 0.252
NP_440376.1_1 Forward -225 -216 19.4693 0.000692
NP_440376.1_1 Reverse -216 -225 19.4693 0.000692
NP_440376.1_1 Forward -43 -34 5.99792 0.111
NP_440376.1_1 Forward -387 -378 1.76968 0.242
NP_440376.1_1 Reverse -34 -43 -0.196935 0.285
NP_441588.1_4 Reverse -218 -228 9.02648 0.14
NP_442730.1_8 Forward -233 -214 16.0265 0.0772
NP_442687.1_7 Forward -226 -216 8.92815 0.0994
NP_442687.1_7 Reverse -215 -225 8.92815 0.0994
NP_442687.1_7 Forward -44 -34 7.25653 0.136
NP_442485.1_3 Reverse -145 -164 -3.24547 0.272
NP_441846.1_10 Reverse -361 -380 -23.7966 0.298
NP_440642.1_10 Forward -282 -268 4.71887 0.25
NP_440642.1_10 Forward -383 -369 3.53891 0.271
NP_440642.1_10 Forward -326 -312 1.96562 0.284
NP_441013.1_2 Reverse -205 -223 14.2771 0.0862
NP_441013.1_2 Forward -170 -152 -0.275845 0.266
NP_441422.1_7 Forward -45 -28 -9.20427 0.294
NP_442658.1_1 Reverse -208 -218 8.23937 0.199
NP_442658.1_1 Reverse -214 -224 6.76441 0.214
NP_442658.1_1 Forward -227 -217 6.76441 0.214
NP_442658.1_1 Forward -45 -35 6.27276 0.234
NP_442198.1_3 Forward -181 -162 5.40766 0.259
NP_442198.1_3 Forward -237 -218 4.12936 0.281
NP_442198.1_7 Forward -168 -149 18.5831 0.084
NP_440141.1_8 Reverse -363 -382 7.86593 0.232
NP_441855.2_4 Reverse -148 -167 9.61947 0.275
NP_442782.1_7 Reverse -208 -227 1.47442 0.197
NP_442205.1_9 Reverse -210 -226 -2.20308 0.268
NP_442205.1_9 Reverse -345 -361 -3.8747 0.297
NP_440656.1_8 Reverse -205 -224 -5.80207 0.229
NP_441414.1_9 Reverse -216 -235 -2.85214 0.124
NP_441414.1_9 Forward -225 -206 -10.0303 0.275
NP_440607.1_8 Forward -254 -235 -0.4922 0.289
NP_441256.1_1 Forward -168 -149 -3.04881 0.233
NP_441256.1_1 Reverse -348 -367 -5.70374 0.233
NP_442937.1_5 Forward -254 -235 11.8975 0.126
NP_442937.1_5 Forward -98 -79 9.63589 0.185
NP_442937.1_5 Forward -230 -211 7.37428 0.254
NP_441958.1_5 Forward -226 -216 12.2714 0.00183
NP_441958.1_5 Reverse -215 -225 12.2714 0.00183
NP_441958.1_5 Forward -44 -34 9.12481 0.025
NP_442836.1_5 Reverse -210 -229 1.0811 0.288
NP_440203.1_5 Forward -162 -152 15.8108 0.0611
NP_440203.1_5 Forward -222 -212 14.8275 0.0886
NP_440203.1_5 Reverse -219 -229 14.2375 0.0886
NP_440203.1_5 Forward -378 -368 12.7626 0.138
NP_439905.1_1 Reverse -346 -359 12.9006 0.178
NP_443001.1_7 Reverse -144 -163 3.24438 0.279
NP_443001.1_7 Forward -164 -145 0.786102 0.295
NP_440984.1_7 Forward -230 -216 9.34103 0.127
NP_440984.1_7 Reverse -205 -219 8.06273 0.158
NP_439990.1_5 Forward -230 -217 11.229 0.128
NP_442376.1_2 Reverse -29 -48 -12.7836 0.286
NP_442911.1_2 Reverse -206 -225 3.14605 0.0458
NP_441580.1_6 Reverse -205 -224 2.3594 0.117
NP_440153.1_5 Forward -224 -210 18.7808 0.0435
NP_442064.1_1 Forward -230 -211 -10.4236 0.259
NP_442064.1_4 Forward -235 -216 8.55343 0.232
NP_442536.1_8 Forward -252 -233 15.6341 0.176
NP_442536.1_8 Forward -249 -230 10.7175 0.296
NP_443055.1_3 Reverse -330 -349 12.173 0.229
NP_440993.1_4 Forward -165 -148 6.72535 0.241
NP_440827.1_1 Forward -252 -233 14.4541 0.242
NP_440827.1_3 Reverse -205 -224 14.3558 0.204
NP_440827.1_3 Forward -230 -211 12.0942 0.261
NP_440496.1_9 Forward -279 -260 -3.63879 0.249
NP_442210.1_9 Forward -358 -340 13.9821 0.209
NP_440138.1_6 Reverse -211 -230 2.35861 0.267
NP_441099.1_5 Reverse -206 -225 -0.197208 0.0896
NP_441099.1_5 Forward -53 -34 -3.63879 0.137
NP_441099.1_5 Forward -398 -379 -7.76869 0.18
NP_441099.1_5 Forward -235 -216 -9.83364 0.234
NP_441099.1_5 Reverse -24 -43 -10.3253 0.25
NP_442002.1_9 Forward -44 -37 14.1004 0.074
NP_441294.1_7 Reverse -212 -226 14.146 0.0466
NP_441294.1_7 Reverse -233 -247 11.1704 0.153
NP_441294.1_7 Forward -229 -215 9.15464 0.256
NP_440411.1_10 Forward -368 -349 14.0678 0.21
NP_441646.1_1 Forward -232 -213 3.93269 0.204
NP_441646.1_1 Forward -361 -342 -1.47551 0.287
NP_442438.1_10 Reverse -211 -225 16.3225 0.0222
NP_442438.1_10 Forward -230 -216 9.04604 0.0692
NP_442438.1_10 Forward -365 -351 5.50613 0.132
NP_442438.1_10 Reverse -29 -43 3.24451 0.165
NP_440147.1_4 Forward -227 -214 11.3273 0.0326
NP_440147.1_4 Reverse -214 -227 2.18257 0.209
NP_440147.1_4 Reverse -32 -45 0.0192843 0.268
NP_440147.1_4 Forward -45 -32 -0.472371 0.287
NP_441550.1_8 Forward -45 -35 16.8925 0.00906
NP_441550.1_8 Forward -227 -217 14.6309 0.0132
NP_441550.1_8 Reverse -214 -224 12.3692 0.0336
NP_441550.1_8 Reverse -32 -42 10.4026 0.0684
NP_441916.1_7 Forward -225 -215 10.3048 0.0261
NP_441916.1_7 Reverse -216 -226 10.3048 0.0261
NP_441916.1_10 Reverse -370 -389 9.14423 0.161
NP_441916.1_10 Reverse -208 -227 6.4893 0.202
NP_440206.1_4 Reverse -352 -371 -1.27961 0.29
NP_441041.1_4 Reverse -216 -235 -2.45882 0.112
NP_441041.1_4 Reverse -210 -229 -6.68705 0.172
NP_441041.1_4 Forward -225 -206 -9.44032 0.216
NP_441041.1_4 Forward -360 -341 -11.3086 0.244
NP_441041.1_4 Reverse -339 -358 -13.4719 0.288
NP_441041.1_4 Forward -43 -24 -13.7669 0.295
NP_441041.1_7 Forward -228 -216 8.58373 0.133
NP_440569.1_7 Reverse -333 -352 8.65258 0.286
NP_443063.1_2 Reverse -323 -342 12.5858 0.2
NP_442004.1_6 Forward -225 -211 11.5043 0.115
NP_442004.1_6 Reverse -216 -230 5.80112 0.181
NP_440703.1_9 Reverse -345 -358 9.45847 0.216
NP_441725.1_5 Forward -224 -214 11.2881 0.0247
NP_441725.1_5 Forward -164 -154 7.05986 0.106
NP_441725.1_5 Reverse -217 -227 2.04498 0.115
NP_441725.1_5 Reverse -35 -45 1.94665 0.115
NP_441725.1_5 Reverse -60 -70 -1.29827 0.299
NP_439966.1_7 Reverse -214 -224 15.8108 0.0124
NP_439966.1_7 Forward -227 -217 7.25606 0.15
NP_439966.1_7 Reverse -208 -218 6.76441 0.168
NP_442941.1_3 Forward -224 -214 19.9412 0.00262
NP_442941.1_3 Reverse -217 -227 11.0914 0.0116
NP_442941.1_3 Reverse -35 -45 0.865012 0.163
NP_440289.1_2 Reverse -213 -226 3.85419 0.0735
NP_440289.1_2 Forward -228 -215 -4.9956 0.294
NP_440983.1_5 Reverse -240 -259 -0.197208 0.223
NP_440983.1_5 Reverse -237 -256 -5.9004 0.273
NP_440983.1_5 Reverse -339 -358 -8.55534 0.295
NP_440260.1_8 Reverse -25 -43 15.4571 0.0896
NP_440260.1_8 Forward -390 -372 4.6407 0.154
NP_440260.1_8 Forward -241 -223 -6.96235 0.295
NP_440260.1_8 Forward -234 -216 -7.35568 0.295
NP_440260.1_8 Forward -357 -339 -7.45401 0.295
NP_441514.1_6 Reverse -370 -377 12.8221 0.252
NP_442281.1_1 Forward -230 -216 17.6002 0.00542
NP_442281.1_1 Reverse -151 -165 11.012 0.0511
NP_442281.1_1 Reverse -211 -225 8.25877 0.0832
NP_442281.1_1 Reverse -205 -219 4.03056 0.21
NP_442281.1_1 Reverse -334 -348 1.67063 0.293
NP_442256.1_2 Forward -227 -209 -7.65067 0.214
NP_442256.1_2 Reverse -214 -232 -8.73231 0.235
NP_442012.1_1 Forward -231 -212 6.58763 0.125
NP_442049.1_6 Forward -233 -214 5.01433 0.238
NP_441556.1_10 Forward -230 -216 14.018 0.178
NP_441556.1_10 Forward -170 -156 12.5579 0.195
NP_440498.1_1 Reverse -207 -225 0.609134 0.214
NP_442982.1_5 Reverse -335 -354 -0.590531 0.26
NP_443030.1_4 Reverse -365 -384 -3.3438 0.251
NP_441644.1_6 Forward -225 -215 17.3841 0.00127
NP_441644.1_6 Reverse -216 -226 17.3841 0.00127
NP_441644.1_6 Reverse -210 -220 11.6809 0.0448
NP_441644.1_6 Reverse -339 -349 6.96107 0.141
NP_441644.1_6 Reverse -34 -44 6.0761 0.167
NP_441644.1_6 Forward -43 -33 5.28945 0.199
NP_441644.1_6 Forward -84 -74 4.60114 0.233
NP_443049.1_6 Forward -44 -34 11.9337 0.24
NP_442215.1_2 Reverse -214 -230 16.1848 0.0155
NP_442215.1_2 Forward -227 -211 15.4965 0.0171
NP_442215.1_2 Forward -356 -340 -1.41643 0.185
NP_442215.1_2 Forward -167 -151 -4.56302 0.235
NP_442215.1_2 Forward -383 -367 -6.62797 0.277
NP_442029.1_1 Forward -248 -229 -20.0601 0.297
NP_442029.1_6 Forward -230 -211 18.6823 0.0759
NP_442029.1_6 Reverse -211 -230 2.45773 0.296
NP_442247.1_7 Reverse -213 -232 9.43923 0.21
NP_440929.1_8 Forward -225 -216 19.2726 0.000701
NP_440929.1_8 Reverse -216 -225 19.2726 0.000701
NP_440929.1_8 Reverse -34 -43 14.651 0.0105
NP_440929.1_8 Forward -43 -34 7.66954 0.0624
NP_442933.1_10 Forward -225 -216 17.601 0.00325
NP_442933.1_10 Reverse -216 -225 17.601 0.00325
NP_442933.1_10 Reverse -75 -84 8.75118 0.0688
NP_442933.1_10 Reverse -23 -32 6.29291 0.128
NP_441310.1_10 Reverse -272 -282 16.9581 0.0807
NP_441751.2_8 Forward -224 -210 -0.590395 0.129
NP_441751.2_8 Reverse -35 -49 -5.01529 0.19
NP_441751.2_8 Forward -359 -345 -5.50694 0.214
NP_442926.1_3 Reverse -340 -359 5.50599 0.226
NP_442554.1_8 Forward -224 -214 15.9097 0.00747
NP_442554.1_8 Reverse -217 -227 15.3197 0.00882
NP_442554.1_8 Forward -218 -208 12.5664 0.0248
NP_442554.1_8 Forward -42 -32 9.61647 0.0576
NP_442554.1_8 Reverse -35 -45 5.28991 0.153
NP_441762.1_7 Reverse -215 -227 0.432302 0.0747
NP_441762.1_7 Forward -226 -214 -6.84419 0.284
NP_442313.1_8 Reverse -12 -31 7.27595 0.292
NP_442142.1_4 Reverse -234 -247 14.5717 0.0311
NP_442142.1_4 Forward -228 -215 12.2117 0.0464
NP_442142.1_4 Reverse -213 -226 6.31189 0.169
NP_442142.1_4 Reverse -384 -397 4.44361 0.222
NP_442142.1_4 Reverse -153 -166 3.55864 0.251
NP_442292.1_1 Forward -224 -215 18.486 0.00229
NP_442292.1_1 Reverse -217 -226 18.486 0.00229
NP_442292.1_1 Forward -42 -33 8.1612 0.0478
NP_442292.1_1 Reverse -35 -44 -0.295266 0.24
NP_442476.1_6 Reverse -217 -231 3.53951 0.156
NP_440895.1_6 Forward -231 -218 10.7374 0.202
NP_442381.1_8 Forward -399 -380 -14.9469 0.29
NP_443009.1_5 Reverse -215 -226 8.90795 0.0965
NP_443009.1_5 Forward -226 -215 8.90795 0.0965
NP_443009.1_5 Reverse -377 -388 4.67974 0.234
NP_442301.1_2 Reverse -233 -252 8.4551 0.229
NP_442408.2_1 Forward -225 -206 -1.18052 0.234
NP_441715.1_4 Forward -224 -214 14.828 0.0268
NP_441715.1_4 Reverse -217 -227 7.94484 0.107
NP_441715.1_4 Forward -83 -73 4.99491 0.24
NP_440379.1_5 Reverse -362 -381 4.916 0.133
NP_440379.1_5 Forward -168 -149 -8.45701 0.252
NP_440464.1_10 Reverse -217 -227 13.0082 0.169
NP_441468.1_1 Forward -224 -217 15.8704 0.0124
NP_441468.1_1 Reverse -217 -224 15.8704 0.0124
NP_441468.1_1 Forward -42 -35 6.13563 0.209
NP_441468.1_1 Reverse -35 -42 6.0373 0.223
NP_441468.1_1 Reverse -211 -218 3.97235 0.277
NP_441015.1_8 Reverse -69 -88 1.76941 0.272
NP_441015.1_10 Forward -359 -340 7.66927 0.0996
NP_441015.1_10 Forward -224 -205 5.80098 0.112
NP_441015.1_10 Reverse -211 -230 5.80098 0.112
NP_441015.1_10 Forward -230 -211 0.196116 0.167
NP_441015.1_10 Forward -251 -232 -0.4922 0.169
NP_441673.1_1 Forward -225 -216 20.8459 0.000698
NP_441673.1_1 Reverse -216 -225 20.8459 0.000698
NP_441673.1_1 Forward -43 -34 1.37636 0.114
NP_441673.1_1 Reverse -34 -43 1.1797 0.163
NP_442757.1_7 Forward -361 -342 19.2723 0.117
NP_441826.1_2 Reverse -210 -224 23.4024 0.00229
NP_441826.1_2 Forward -231 -217 6.98109 0.0899
NP_441826.1_2 Forward -99 -85 6.78443 0.09
NP_441826.1_2 Forward -225 -211 2.5562 0.125
NP_441826.1_2 Reverse -339 -353 2.2612 0.132
NP_441826.1_2 Reverse -231 -245 -4.4253 0.296
NP_441826.1_2 Reverse -121 -135 -4.4253 0.296
NP_441826.1_5 Forward -313 -294 4.52268 0.254
NP_441826.1_5 Forward -224 -205 3.73603 0.259
NP_442811.1_2 Forward -161 -142 -2.95047 0.281
NP_442868.1_6 Reverse -214 -224 9.91146 0.038
NP_442868.1_6 Forward -227 -217 9.81313 0.038
NP_442868.1_6 Forward -45 -35 8.82982 0.0555
NP_441056.1_1 Forward -225 -206 3.93269 0.131
NP_442677.1_7 Forward -398 -388 18.2696 0.237
NP_441612.1_2 Reverse -216 -226 8.54929 0.21
NP_441612.1_2 Forward -225 -215 8.54929 0.21
NP_442227.1_2 Reverse -200 -219 -1.96717 0.269
NP_442227.1_2 Reverse -353 -372 -3.3438 0.29
NP_442361.1_3 Forward -231 -218 7.98409 0.285
NP_442808.1_1 Reverse -215 -225 8.63269 0.0481
NP_442808.1_1 Forward -226 -216 8.63269 0.0481
NP_442808.1_1 Reverse -236 -246 5.48612 0.151
NP_442808.1_1 Forward -166 -156 5.28945 0.162
NP_441101.1_7 Forward -98 -79 14.5524 0.29
NP_441101.1_10 Forward -229 -210 -7.57203 0.29
NP_442692.1_1 Forward -398 -379 -5.31042 0.274
NP_440145.1_3 Forward -235 -216 6.78429 0.0507
NP_440145.1_3 Reverse -24 -43 -2.16383 0.163
NP_440145.1_4 Reverse -238 -248 13.6475 0.299
NP_442542.1_2 Reverse -208 -221 15.3589 0.0861
NP_442542.1_9 Reverse -209 -223 11.2087 0.111
NP_442542.1_9 Reverse -384 -398 5.80051 0.256
NP_442050.1_5 Reverse -214 -224 16.4991 0.00812
NP_442050.1_5 Forward -227 -217 7.64939 0.243
NP_441114.1_3 Forward -163 -154 7.57121 0.231
NP_440558.1_2 Reverse -207 -226 3.83436 0.153
NP_440558.1_2 Reverse -342 -361 -4.42544 0.245
NP_440558.1_2 Reverse -25 -44 -5.11376 0.253
NP_440558.1_2 Forward -234 -215 -6.39206 0.274
NP_441878.1_6 Forward -226 -216 10.4031 0.0176
NP_441878.1_6 Reverse -215 -225 10.4031 0.0176
NP_441878.1_6 Reverse -155 -165 2.33998 0.0405
NP_441878.1_6 Reverse -74 -84 0.963343 0.128
NP_441878.1_6 Forward -44 -34 0.766681 0.134
NP_441036.1_8 Forward -226 -216 8.33817 0.174
NP_441036.1_8 Reverse -215 -225 8.33817 0.174
NP_442650.1_2 Forward -43 -29 15.6342 0.0712
NP_442650.1_2 Reverse -216 -230 8.25939 0.13
NP_442650.1_2 Forward -225 -211 4.62115 0.165
NP_441557.1_5 Forward -225 -216 19.9609 0.000699
NP_441557.1_5 Reverse -216 -225 19.9609 0.000699
NP_441557.1_5 Reverse -34 -43 7.57121 0.049
NP_441557.1_5 Forward -43 -34 1.08137 0.0794
NP_441445.1_1 Forward -255 -236 7.86593 0.124
NP_441445.1_1 Forward -234 -215 -0.197208 0.286
NP_442066.2_4 Reverse -216 -235 1.67108 0.151
NP_442419.1_2 Reverse -205 -224 -4.22878 0.283
NP_440744.1_2 Forward -226 -207 15.4978 0.264
NP_440101.1_3 Forward -359 -340 3.73603 0.224
NP_441458.1_10 Forward -234 -215 8.35759 0.186
NP_442183.1_1 Forward -225 -211 7.07942 0.149
NP_442397.1_9 Reverse -371 -390 1.96607 0.283
NP_440356.1_1 Forward -171 -152 11.995 0.277
NP_441574.1_1 Forward -360 -341 8.16093 0.11
NP_441549.1_9 Reverse -212 -230 -5.38906 0.198
NP_442347.1_2 Forward -224 -215 12.4878 0.056
NP_442347.1_2 Reverse -217 -226 12.4878 0.056
NP_442645.1_2 Reverse -208 -227 -6.78538 0.0946
NP_442645.1_2 Forward -227 -208 -18.8801 0.28
NP_442645.1_2 Reverse -26 -45 -22.3217 0.29
NP_442965.1_2 Reverse -373 -392 -8.35868 0.283
NP_441037.1_4 Reverse -208 -218 11.0211 0.17
NP_441037.1_4 Forward -227 -217 7.9999 0.237
NP_442594.1_7 Reverse -205 -224 8.06178 0.187
NP_442594.1_8 Forward -255 -236 2.0644 0.295
NP_441633.1_3 Forward -138 -125 4.24752 0.0699
NP_441633.1_3 Reverse -32 -45 2.57589 0.0926
NP_441633.1_3 Forward -227 -214 1.10092 0.109
NP_441633.1_3 Reverse -214 -227 -5.97891 0.236
NP_440136.1_2 Forward -224 -217 15.9687 0.0123
NP_440136.1_2 Reverse -217 -224 15.9687 0.0123
NP_440136.1_2 Forward -42 -35 6.23397 0.171
NP_440136.1_2 Reverse -35 -42 6.13563 0.193
NP_442590.1_10 Forward -225 -206 14.5524 0.122
NP_442590.1_10 Reverse -210 -229 13.3725 0.135
NP_442590.1_10 Forward -171 -152 8.45592 0.208
NP_442590.1_10 Forward -360 -341 5.60432 0.258
NP_442590.1_10 Forward -243 -224 3.73603 0.286
NP_442998.1_5 Reverse -227 -237 9.22315 0.248
NP_442998.1_10 Forward -223 -216 15.5754 0.0102
NP_442998.1_10 Reverse -218 -225 15.5754 0.0102
NP_442998.1_10 Reverse -36 -43 15.5754 0.0102
NP_440899.1_2 Reverse -205 -224 12.4867 0.112
NP_440299.1_1 Forward -229 -216 22.3398 0.000547
NP_440299.1_1 Reverse -212 -225 19.9798 0.00161
NP_440299.1_1 Reverse -30 -43 7.49186 0.112
NP_441799.1_1 Forward -229 -215 8.84875 0.105
NP_441799.1_1 Reverse -212 -226 7.17714 0.149
NP_441007.1_10 Forward -251 -238 7.29578 0.145
NP_441007.1_10 Reverse -211 -224 -0.570702 0.287
NP_441007.1_10 Forward -230 -217 -0.669033 0.287
NP_442201.1_10 Forward -236 -217 -4.22878 0.152
NP_442333.2_5 Reverse -205 -224 -12.4886 0.249
NP_440256.1_1 Forward -228 -209 10.9142 0.0168
NP_441559.1_8 Reverse -70 -84 6.78443 0.0752
NP_441559.1_8 Forward -392 -378 4.22782 0.127
NP_441559.1_8 Reverse -211 -225 -6.78525 0.279
NP_441559.1_8 Forward -230 -216 -6.88358 0.281
NP_441559.1_8 Forward -169 -155 -6.98191 0.281
NP_441270.1_5 Forward -256 -237 15.8244 0.191
NP_441270.1_5 Forward -259 -240 13.3846 0.225
NP_440915.1_6 Forward -229 -215 3.73617 0.1
NP_440915.1_6 Reverse -206 -220 3.14618 0.107
NP_440915.1_6 Forward -47 -33 2.85119 0.111
NP_441704.1_8 Reverse -205 -224 9.93006 0.168
NP_441704.1_8 Forward -236 -217 5.60352 0.284
NP_442967.1_10 Reverse -209 -223 15.219 0.272
NP_442866.1_1 Forward -170 -151 10.5209 0.0832
NP_442866.1_1 Reverse -79 -98 -9.73531 0.298
NP_440748.1_5 Reverse -347 -366 -2.16383 0.271
NP_441464.1_10 Forward -259 -245 8.45605 0.281
NP_440026.1_4 Forward -168 -149 11.1109 0.239
NP_441199.1_3 Forward -377 -359 0.707465 0.231
NP_439985.1_7 Reverse -210 -229 9.24257 0.18
NP_442993.1_1 Forward -291 -275 -13.2161 0.288
NP_442386.1_9 Reverse -215 -224 13.8639 0.0289
NP_442386.1_9 Forward -226 -217 13.8639 0.0289
NP_442386.1_9 Reverse -209 -218 9.83239 0.149
NP_442386.1_9 Reverse -33 -42 8.75075 0.184
NP_442386.1_9 Forward -220 -211 4.62087 0.294
NP_440570.1_5 Reverse -43 -62 3.83436 0.234
NP_440570.1_5 Forward -103 -84 -0.590531 0.262
NP_440570.1_5 Reverse -335 -354 -2.95047 0.283
NP_441750.1_1 Forward -255 -236 -13.3736 0.3
NP_441340.1_5 Forward -224 -217 15.6737 0.0124
NP_441340.1_5 Reverse -217 -224 15.6737 0.0124
NP_441340.1_5 Forward -42 -35 13.5105 0.0314
NP_441340.1_5 Forward -218 -211 11.3472 0.0526
NP_441340.1_5 Reverse -35 -42 5.84064 0.208
NP_442484.1_2 Reverse -205 -224 4.62101 0.184
NP_442484.1_2 Forward -380 -361 -0.4922 0.266
NP_440168.1_9 Reverse -73 -92 -5.31042 0.296
NP_440168.1_9 Forward -382 -363 -5.9004 0.296
NP_440327.1_6 Forward -267 -248 6.98095 0.228
NP_442240.1_2 Reverse -217 -236 -9.047 0.137
NP_440586.1_1 Forward -256 -237 -3.24547 0.265
NP_440586.1_1 Forward -293 -274 -4.81876 0.278
NP_440586.1_8 Forward -224 -217 13.2151 0.026
NP_440586.1_8 Reverse -217 -224 13.2151 0.026
NP_440586.1_8 Reverse -35 -42 9.47853 0.146
NP_440586.1_8 Forward -42 -35 5.74197 0.283
NP_440586.1_8 Reverse -211 -218 5.74197 0.283
NP_442251.1_6 Forward -224 -217 15.2804 0.0124
NP_442251.1_6 Reverse -217 -224 15.2804 0.0124
NP_440684.1_9 Reverse -210 -224 7.37441 0.266
NP_441262.1_3 Reverse -216 -223 14.7888 0.0223
NP_441262.1_3 Forward -225 -218 14.7888 0.0223
NP_441262.1_3 Forward -43 -36 14.7888 0.0223
NP_440027.1_3 Reverse -237 -255 7.68819 0.207
NP_440027.1_3 Reverse -372 -390 4.24662 0.262
NP_440027.1_8 Forward -228 -209 7.86512 0.254
NP_440027.1_8 Reverse -213 -232 4.52188 0.287
NP_443051.1_1 Forward -44 -35 15.1427 0.00754
NP_443051.1_1 Reverse -215 -224 10.4228 0.00754
NP_443051.1_1 Forward -226 -217 10.4228 0.00754
NP_439996.1_6 Forward -256 -237 7.62177 0.257
NP_439937.1_8 Reverse -208 -227 4.62101 0.2
NP_439937.1_9 Forward -220 -203 -11.6632 0.261
NP_439937.1_9 Reverse -215 -232 -16.2847 0.287
NP_440408.1_3 Reverse -210 -229 -2.36049 0.251
NP_440408.1_7 Forward -225 -206 15.8307 0.138
NP_440408.1_7 Reverse -216 -235 11.7008 0.218
NP_440439.1_1 Reverse -213 -226 2.37923 0.135
NP_442239.1_8 Forward -181 -162 5.70265 0.266
NP_439943.1_1 Forward -354 -335 5.11266 0.0987
NP_440372.1_2 Forward -224 -217 16.3621 0.0124
NP_440372.1_2 Reverse -217 -224 16.3621 0.0124
NP_440372.1_2 Forward -42 -35 13.8055 0.0214
NP_440372.1_2 Reverse -35 -42 6.52896 0.188
NP_440271.1_2 Reverse -147 -166 8.84924 0.23
NP_440819.1_5 Reverse -274 -282 7.98423 0.228
NP_442663.1_1 Reverse -322 -341 1.47364 0.249
NP_441803.1_2 Forward -230 -211 11.5042 0.0716
NP_441803.1_2 Reverse -211 -230 5.60432 0.166
NP_439977.1_5 Forward -231 -212 3.83436 0.157
NP_439977.1_5 Reverse -28 -47 -0.0988766 0.217
NP_440139.1_1 Forward -225 -206 1.86696 0.245
NP_440139.1_1 Reverse -210 -229 1.27698 0.266
NP_440139.1_1 Forward -49 -30 0.883656 0.279
NP_441572.1_7 Forward -49 -30 3.53937 0.117
NP_441572.1_7 Forward -231 -212 -0.590531 0.182
NP_441572.1_7 Reverse -210 -229 -2.65548 0.197
NP_441572.1_7 Reverse -204 -223 -4.03212 0.224
NP_441572.1_7 Reverse -366 -385 -4.32711 0.232
NP_442384.1_10 Forward -225 -212 18.9972 0.00338
NP_442384.1_10 Reverse -216 -229 17.4239 0.00585
NP_442384.1_10 Reverse -34 -47 9.65572 0.0508
NP_442384.1_10 Reverse -210 -223 5.32916 0.131
NP_442384.1_10 Forward -360 -347 1.78924 0.247
NP_440364.1_6 Reverse -209 -222 14.8666 0.275
NP_441877.1_5 Reverse -15 -34 0.884433 0.276
NP_441018.1_7 Forward -358 -339 16.1257 0.0925
NP_441018.1_7 Forward -229 -210 12.6841 0.154
NP_441018.1_7 Forward -235 -216 6.29264 0.294
NP_442790.1_4 Forward -52 -33 -3.83545 0.13
NP_442262.1_10 Forward -224 -217 14.1988 0.0123
NP_442262.1_10 Reverse -217 -224 14.1988 0.0123
NP_442262.1_10 Reverse -35 -42 13.2155 0.0213
NP_442262.1_10 Reverse -211 -218 12.0355 0.062
NP_441689.1_5 Reverse -214 -224 15.3192 0.0403
NP_441689.1_5 Forward -227 -217 5.78111 0.197
NP_440344.1_10 Forward -232 -215 2.30045 0.0283
NP_440344.1_10 Reverse -209 -226 -6.94266 0.115
NP_440282.1_10 Reverse -341 -360 1.96607 0.165
NP_440282.1_10 Reverse -206 -225 -3.14714 0.237
NP_440531.1_6 Reverse -208 -227 7.7676 0.0947
NP_440531.1_6 Forward -173 -154 1.37609 0.177
NP_442910.1_1 Forward -232 -213 3.04771 0.118
NP_442910.1_1 Reverse -27 -46 2.45773 0.118
NP_440562.1_1 Reverse -220 -239 10.1267 0.297
NP_441965.1_3 Reverse -206 -225 12.5858 0.0921
NP_441965.1_3 Forward -235 -216 -1.08219 0.279
NP_441965.1_10 Reverse -213 -229 11.8583 0.107
NP_441640.1_8 Reverse -211 -230 6.19431 0.111
NP_442693.1_7 Reverse -344 -363 10.0292 0.227
NP_440297.1_9 Forward -224 -214 9.32148 0.0917
NP_440297.1_9 Forward -164 -154 6.96153 0.161
NP_440297.1_9 Reverse -217 -227 -0.118297 0.282
NP_440297.1_9 Reverse -35 -45 -0.216628 0.282
NP_442280.1_10 Forward -235 -217 10.9088 0.215
NP_442280.1_10 Forward -168 -150 7.01283 0.268
NP_442280.1_10 Reverse -24 -42 5.94143 0.28
NP_441896.1_3 Forward -52 -33 2.0644 0.206
NP_441896.1_3 Reverse -268 -287 -0.197208 0.234
NP_440894.1_10 Reverse -287 -306 7.37428 0.205
NP_440894.1_10 Forward -230 -211 2.26107 0.292
NP_441679.1_1 Forward -346 -327 3.93269 0.152
NP_442067.1_4 Forward -176 -157 2.3594 0.298
NP_440999.1_9 Forward -229 -215 3.24451 0.133
NP_440999.1_9 Reverse -212 -226 2.35953 0.151
NP_440999.1_9 Reverse -288 -302 0.491246 0.183
NP_440999.1_9 Reverse -80 -94 -2.26202 0.264
NP_440888.1_2 Forward -225 -211 20.4518 0.000632
NP_440888.1_2 Reverse -216 -230 10.717 0.0861
NP_440888.1_2 Forward -387 -373 10.422 0.0946
NP_440888.1_2 Forward -219 -205 6.48882 0.232
NP_440888.1_4 Forward -354 -340 19.1511 0.129
NP_440600.1_4 Forward -233 -215 0.21581 0.142
NP_440600.1_4 Reverse -208 -226 -4.40575 0.26
NP_440491.1_1 Reverse -213 -232 12.1797 0.157
NP_440052.1_5 Forward -236 -217 -3.3438 0.234
NP_440052.1_8 Forward -254 -235 24.4839 0.00734
NP_440052.1_8 Forward -251 -232 15.9291 0.0748
NP_442033.1_10 Reverse -82 -101 -13.5702 0.287
NP_441543.1_2 Forward -224 -215 16.9127 0.00359
NP_441543.1_2 Reverse -217 -226 16.9127 0.00359
NP_441543.1_2 Forward -218 -209 6.8829 0.135
NP_442845.1_2 Reverse -210 -224 17.0108 0.0608
NP_442845.1_2 Forward -225 -211 16.8142 0.0608
NP_442845.1_2 Forward -231 -217 13.0776 0.0999
NP_442845.1_2 Reverse -216 -230 7.37441 0.195
NP_442845.1_2 Forward -354 -340 6.19444 0.215
NP_442845.1_2 Reverse -276 -290 4.12949 0.267
NP_441178.1_5 Forward -105 -86 8.25926 0.3
NP_441469.1_8 Forward -226 -217 6.48957 0.227
NP_441469.1_8 Reverse -215 -224 6.48957 0.227
NP_441469.1_8 Reverse -209 -218 5.11294 0.289
NP_443064.1_6 Forward -225 -215 12.5669 0.0796
NP_443064.1_6 Reverse -216 -226 12.5669 0.0796
NP_442578.1_7 Forward -224 -217 14.5921 0.026
NP_442578.1_7 Reverse -217 -224 14.5921 0.026
NP_442578.1_7 Forward -42 -35 6.0373 0.18
NP_441462.1_2 Forward -225 -215 11.5831 0.00406
NP_441462.1_2 Reverse -216 -226 11.5831 0.00406
NP_441462.1_2 Forward -43 -33 0.963343 0.109
NP_441462.1_2 Reverse -34 -44 0.471689 0.148
NP_441621.1_7 Forward -221 -207 -4.81863 0.246
NP_441621.1_7 Forward -86 -72 -6.29359 0.283
NP_442736.1_5 Forward -217 -198 12.4875 0.254
NP_443062.1_1 Reverse -216 -234 6.69328 0.194
NP_443062.1_6 Reverse -148 -167 5.40766 0.204
NP_442204.1_1 Forward -229 -218 8.7118 0.0852
NP_442204.1_1 Reverse -212 -223 7.92515 0.108
NP_442204.1_1 Forward -47 -36 2.22195 0.266
NP_442204.1_1 Reverse -152 -163 1.04198 0.281
NP_442204.1_1 Reverse -71 -82 0.94365 0.281
NP_442204.1_1 Reverse -265 -276 0.157002 0.283
NP_440516.1_6 Forward -165 -151 15.0436 0.188
NP_440516.1_8 Forward -225 -216 16.9127 0.00442
NP_440516.1_8 Reverse -216 -225 16.9127 0.00442
NP_440516.1_8 Forward -43 -34 9.53783 0.0136
NP_440516.1_8 Reverse -210 -219 7.17789 0.0754
NP_440516.1_8 Reverse -34 -43 5.01461 0.118
NP_442080.1_7 Forward -313 -294 -2.85214 0.287
NP_442428.1_4 Forward -172 -153 3.93269 0.238
NP_442428.1_5 Forward -224 -217 15.8704 0.0124
NP_442428.1_5 Reverse -217 -224 15.8704 0.0124
NP_442428.1_5 Forward -42 -35 6.13563 0.209
NP_442428.1_5 Reverse -35 -42 6.0373 0.212
NP_442428.1_5 Reverse -211 -218 4.36568 0.271
NP_442428.1_8 Forward -370 -351 -1.08219 0.28
NP_441443.1_10 Forward -379 -361 12.703 0.149
NP_442120.1_10 Reverse -210 -229 -9.24366 0.242
NP_442120.1_10 Reverse -78 -97 -16.3235 0.3
NP_440673.1_3 Forward -223 -216 12.4288 0.0426
NP_440673.1_3 Reverse -218 -225 12.4288 0.0426
NP_440673.1_3 Reverse -36 -43 12.4288 0.0426
NP_440673.1_3 Forward -163 -156 8.98723 0.203
NP_440673.1_7 Reverse -205 -224 23.3039 0.0154
NP_441052.1_2 Forward -225 -215 19.9412 0.00106
NP_441052.1_2 Reverse -216 -226 19.9412 0.00106
NP_441052.1_2 Reverse -237 -247 4.69992 0.149
NP_441052.1_2 Reverse -345 -355 2.04498 0.22
NP_441052.1_2 Forward -354 -344 1.16001 0.25
NP_441052.1_2 Forward -43 -33 0.668351 0.256
NP_442219.1_8 Forward -358 -339 10.1964 0.21
NP_442219.1_9 Forward -224 -215 17.7976 0.00718
NP_442219.1_9 Reverse -217 -226 17.7976 0.00718
NP_440436.1_4 Forward -224 -215 17.2072 0.00233
NP_440436.1_4 Reverse -217 -226 17.2072 0.00233
NP_440436.1_4 Reverse -35 -44 6.29249 0.164
NP_440436.1_4 Forward -218 -209 5.70251 0.186
NP_440436.1_4 Forward -113 -104 4.52254 0.256
NP_441884.1_9 Forward -360 -341 -11.9969 0.135
NP_441884.1_9 Forward -228 -209 -13.0786 0.138
NP_442086.1_3 Forward -42 -23 13.6675 0.13
NP_442864.1_3 Forward -231 -212 10.7175 0.192
NP_442864.1_3 Forward -374 -355 6.78429 0.297
NP_441719.1_4 Forward -224 -217 16.3621 0.0124
NP_441719.1_4 Reverse -217 -224 16.3621 0.0124
NP_441719.1_4 Forward -42 -35 6.82395 0.0855
NP_441719.1_4 Reverse -35 -42 6.52896 0.188
NP_441004.1_1 Forward -255 -236 -2.45882 0.147
NP_441004.1_1 Reverse -210 -229 -11.2103 0.234
NP_441004.1_1 Forward -372 -353 -12.0953 0.244
NP_441004.1_1 Forward -252 -233 -14.9469 0.271
NP_441004.1_1 Reverse -29 -48 -17.7985 0.294
NP_441004.1_5 Forward -250 -236 7.07942 0.292
NP_442813.1_4 Forward -383 -364 11.1109 0.139
NP_442366.1_3 Forward -166 -148 2.18243 0.134
NP_442366.1_3 Forward -233 -215 -2.63579 0.231
NP_442366.1_3 Reverse -215 -233 -3.52077 0.251
NP_442366.1_5 Forward -228 -218 14.0409 0.0497
NP_440129.1_10 Reverse -149 -163 6.29277 0.177
NP_440296.1_10 Reverse -153 -172 -11.7019 0.269
NP_441115.1_4 Forward -85 -67 9.6548 0.206
NP_441115.1_4 Reverse -215 -233 8.86816 0.234
NP_442206.1_7 Forward -227 -208 17.8957 0.254
NP_442206.1_10 Reverse -366 -381 2.24151 0.205
NP_442206.1_10 Reverse -216 -231 2.14318 0.205
NP_442206.1_10 Forward -43 -28 0.963207 0.241
NP_442854.1_6 Forward -365 -346 5.30933 0.249
NP_440328.1_4 Reverse -210 -229 1.37609 0.225
NP_443054.1_2 Reverse -376 -390 6.3911 0.198
NP_443054.1_2 Reverse -214 -228 1.57289 0.245
NP_441851.1_10 Forward -226 -216 15.8113 0.00552
NP_441851.1_10 Reverse -215 -225 15.8113 0.00552
NP_441851.1_10 Forward -44 -34 7.64985 0.135
NP_441851.1_10 Reverse -33 -43 4.40493 0.271
NP_442622.1_8 Forward -225 -207 -18.4671 0.222
NP_442856.1_7 Reverse -207 -226 15.0441 0.0463
NP_442515.1_1 Forward -226 -212 8.84938 0.0698
NP_442515.1_1 Reverse -215 -229 -4.81863 0.298
NP_440593.1_3 Reverse -211 -230 10.3242 0.107
NP_440593.1_3 Forward -230 -211 -1.27885 0.211
NP_440593.1_3 Forward -224 -205 -6.58872 0.278
NP_440593.1_3 Forward -359 -340 -7.4737 0.295
NP_440593.1_10 Reverse -20 -39 9.14423 0.272
NP_442473.1_1 Forward -303 -284 9.73422 0.22
NP_441046.1_2 Forward -365 -346 0.786102 0.262
NP_441349.1_10 Forward -235 -216 11.8975 0.022
NP_441349.1_10 Reverse -206 -225 -6.09707 0.221
NP_441409.1_6 Forward -231 -212 -9.34199 0.182
NP_441409.1_6 Reverse -210 -229 -10.3253 0.203
NP_440432.1_2 Forward -231 -212 -1.96717 0.249
NP_442843.1_1 Reverse -373 -392 -11.1119 0.286
NP_440726.1_9 Reverse -340 -359 7.66846 0.263
NP_441477.1_10 Reverse -209 -227 0.314141 0.284
NP_440431.1_3 Reverse -215 -234 -11.8003 0.291
NP_440431.1_4 Reverse -310 -329 -8.16498 0.275
NP_442450.1_5 Reverse -214 -224 9.32148 0.115
NP_442450.1_5 Forward -227 -217 7.55152 0.13
NP_442168.1_5 Forward -42 -23 -1.47551 0.264
NP_440588.1_2 Forward -228 -209 10.6192 0.0376
NP_440588.1_2 Forward -234 -215 3.53937 0.0988
NP_440588.1_2 Reverse -207 -226 -1.57384 0.155
NP_441031.1_8 Forward -371 -352 -5.50708 0.285
NP_439950.1_1 Forward -209 -200 14.7494 0.195
NP_440195.1_4 Reverse -204 -223 6.88262 0.269
NP_442006.1_2 Reverse -365 -382 -16.3824 0.25
NP_442006.1_2 Reverse -147 -164 -18.8407 0.296
NP_441003.1_9 Reverse -336 -355 13.6675 0.213
NP_442243.1_1 Forward -231 -213 4.04996 0.2
NP_442243.1_1 Reverse -210 -228 -2.53818 0.293
NP_441570.1_1 Forward -225 -207 11.2289 0.00811
NP_441570.1_1 Reverse -216 -234 -8.33898 0.109
NP_441570.1_1 Reverse -210 -228 -16.9921 0.26
NP_441570.1_1 Forward -43 -25 -17.4838 0.278
NP_441078.1_4 Forward -225 -216 19.6659 0.0007
NP_441078.1_4 Reverse -216 -225 19.6659 0.0007
NP_441078.1_4 Forward -43 -34 0.196389 0.205
NP_441078.1_4 Reverse -34 -43 -0.000272808 0.205
NP_441078.1_4 Reverse -156 -165 -1.57357 0.266
NP_441078.1_4 Reverse -75 -84 -1.96689 0.282
NP_442729.1_5 Forward -247 -237 8.1415 0.248
NP_442729.1_8 Reverse -212 -225 8.47575 0.125
NP_442480.1_6 Reverse -98 -116 18.0137 0.293
NP_441091.1_5 Reverse -206 -225 1.67108 0.29
NP_440526.1_3 Reverse -217 -228 8.02298 0.126
NP_440526.1_3 Forward -224 -213 0.844851 0.267
NP_440526.1_3 Forward -218 -207 0.254868 0.292
NP_441432.1_3 Forward -114 -95 11.5033 0.275
NP_441432.1_8 Reverse -215 -224 16.8143 0.00595
NP_441432.1_8 Forward -226 -217 16.8143 0.00595
NP_441432.1_8 Forward -44 -35 5.60459 0.147
NP_442320.1_8 Forward -231 -217 5.21113 0.0401
NP_442320.1_8 Reverse -210 -224 3.8345 0.0578
NP_442320.1_8 Reverse -204 -218 -3.83532 0.134
NP_441732.1_2 Forward -229 -213 11.6616 0.00594
NP_441732.1_2 Reverse -212 -228 2.02515 0.0253
NP_441732.1_2 Reverse -224 -240 -6.92296 0.0558
NP_441732.1_2 Reverse -341 -357 -15.3794 0.145
NP_440497.1_2 Forward -224 -205 3.83436 0.293
NP_442003.1_4 Forward -224 -205 9.73422 0.299
NP_442815.1_2 Forward -359 -341 2.47742 0.295
NP_440760.1_1 Forward -225 -206 -4.91709 0.0475
NP_440760.1_1 Reverse -34 -53 -16.0285 0.163
NP_442797.1_7 Reverse -209 -227 3.55906 0.234
NP_442797.1_7 Forward -220 -202 -0.275845 0.282
NP_440131.1_1 Forward -364 -345 4.81767 0.194
NP_440199.1_10 Reverse -213 -223 15.5163 0.0861
NP_440199.1_10 Forward -222 -212 7.25653 0.231
NP_441945.1_10 Forward -262 -243 9.43923 0.267
NP_441057.1_4 Forward -241 -223 5.23069 0.207
NP_442353.1_4 Reverse -210 -229 3.44025 0.219
NP_440913.1_3 Reverse -240 -253 13.4906 0.289
NP_442400.1_10 Reverse -325 -338 9.32449 0.271
NP_440713.1_4 Reverse -206 -225 10.5209 0.123
NP_440713.1_4 Forward -229 -210 4.12936 0.231
NP_442489.1_2 Forward -230 -211 16.1257 0.126
NP_442489.1_2 Reverse -211 -230 9.3409 0.168
NP_442489.1_7 Forward -225 -216 20.1576 0.000695
NP_442489.1_7 Reverse -216 -225 20.1576 0.000695
NP_442489.1_7 Forward -165 -156 4.91628 0.0892
NP_442489.1_7 Forward -43 -34 0.688044 0.152
NP_442489.1_7 Reverse -34 -43 0.688044 0.152
NP_442489.1_7 Reverse -210 -219 -1.47524 0.203
NP_442489.1_7 Reverse -75 -84 -1.47524 0.203
NP_442489.1_7 Reverse -156 -165 -1.57357 0.213
NP_442079.1_6 Reverse -148 -167 13.8641 0.273
NP_442079.1_7 Reverse -217 -236 1.67108 0.244
NP_440559.1_1 Forward -224 -215 17.4043 0.00658
NP_440559.1_1 Reverse -217 -226 17.4043 0.00658
NP_440559.1_1 Forward -42 -33 13.7661 0.0357
NP_440559.1_1 Reverse -35 -44 7.66954 0.0999
NP_441659.2_8 Forward -225 -215 18.1713 0.00133
NP_441659.2_8 Reverse -216 -226 18.1713 0.00133
NP_441659.2_8 Reverse -34 -44 6.66654 0.0694
NP_441659.2_8 Forward -43 -33 5.28991 0.112
NP_441659.2_8 Forward -84 -74 -0.216628 0.292
NP_440363.1_9 Reverse -379 -397 12.6055 0.265
NP_442913.1_10 Reverse -207 -226 5.30933 0.0746
NP_442913.1_10 Reverse -69 -88 -4.22878 0.23
NP_441040.1_2 Forward -227 -208 -11.6036 0.255
NP_441800.1_3 Forward -359 -341 4.54237 0.289
NP_442346.1_5 Forward -226 -216 16.6963 0.00248
NP_442346.1_5 Reverse -215 -225 16.6963 0.00248
NP_442346.1_5 Forward -44 -34 7.55152 0.165
NP_442346.1_5 Reverse -350 -360 7.45319 0.169
NP_442346.1_5 Reverse -155 -165 5.28991 0.253
NP_440545.1_3 Forward -229 -212 12.7235 0.0199
NP_440545.1_3 Reverse -30 -47 0.92382 0.129
NP_440545.1_3 Reverse -212 -229 -0.649475 0.157
NP_440545.1_3 Reverse -273 -290 -2.22277 0.181
NP_440545.1_3 Forward -223 -206 -6.35267 0.276
NP_441856.1_3 Reverse -213 -232 -0.197208 0.216
NP_440025.1_3 Reverse -194 -208 12.547 0.264
NP_440831.1_3 Reverse -207 -226 14.0562 0.117
NP_440831.1_3 Forward -228 -209 10.8527 0.166
NP_440459.1_2 Forward -221 -204 17.5418 0.0834
NP_440459.1_2 Reverse -214 -231 13.6085 0.128
NP_440459.1_2 Forward -227 -210 11.1502 0.181
NP_440459.1_2 Reverse -207 -224 11.0519 0.183
NP_441653.1_2 Forward -54 -35 4.59259 0.255
NP_440010.1_4 Reverse -206 -225 5.60352 0.199
NP_440010.1_4 Reverse -338 -357 -2.75457 0.289
NP_440010.1_7 Reverse -269 -288 14.2574 0.293
NP_440010.1_10 Forward -171 -152 5.89931 0.226
NP_442603.1_7 Forward -225 -211 22.5167 0.00306
NP_442603.1_7 Reverse -216 -230 12.2903 0.1
NP_442603.1_7 Forward -219 -205 5.80051 0.273
NP_441888.1_7 Forward -33 -19 3.04785 0.225
NP_441502.1_3 Reverse -214 -233 10.5209 0.21
NP_441833.1_4 Forward -224 -217 15.9687 0.0124
NP_441833.1_4 Reverse -217 -224 15.9687 0.0124
NP_441833.1_4 Reverse -35 -42 6.52896 0.0924
NP_441833.1_4 Forward -42 -35 6.23397 0.163
NP_442162.1_9 Forward -224 -217 16.2637 0.0124
NP_442162.1_9 Reverse -217 -224 16.2637 0.0124
NP_442162.1_9 Forward -42 -35 12.9205 0.0282
NP_442162.1_9 Reverse -35 -42 12.9205 0.0282
NP_440671.1_4 Reverse -210 -224 11.111 0.141
NP_440671.1_4 Forward -231 -217 9.14437 0.184
NP_440671.1_4 Reverse -204 -218 6.98109 0.23
NP_440224.1_1 Forward -236 -217 11.4058 0.0566
NP_442140.1_3 Reverse -217 -227 12.2714 0.0632
NP_442140.1_3 Reverse -35 -45 9.51814 0.107
NP_442140.1_3 Forward -224 -214 4.40493 0.243
NP_442140.1_3 Forward -218 -208 4.40493 0.243
NP_442140.1_3 Forward -42 -32 4.0116 0.265
NP_442140.1_3 Reverse -340 -350 3.91327 0.271
NP_441813.1_5 Reverse -214 -224 15.9097 0.01
NP_441813.1_5 Forward -227 -217 8.63316 0.0367
NP_441813.1_5 Forward -45 -35 8.63316 0.0367
NP_441813.1_5 Reverse -32 -42 4.69992 0.148
NP_441259.1_8 Reverse -240 -259 11.3067 0.264
NP_440590.1_4 Forward -224 -211 12.704 0.013
NP_440590.1_4 Reverse -217 -230 10.934 0.0235
NP_440590.1_4 Reverse -35 -48 3.46087 0.0735
NP_440590.1_4 Forward -218 -205 3.26421 0.0749
NP_440567.1_1 Reverse -217 -231 14.5526 0.0187
NP_440567.1_1 Forward -224 -210 13.3726 0.0213
NP_440567.1_1 Forward -42 -28 1.57289 0.2
NP_440567.1_1 Forward -218 -204 -0.492064 0.287
NP_442497.1_10 Forward -224 -215 10.4228 0.0087
NP_442497.1_10 Reverse -217 -226 10.4228 0.0087
NP_442497.1_10 Reverse -35 -44 10.0295 0.0222
NP_442497.1_10 Forward -42 -33 -1.18024 0.256
NP_440821.1_4 Reverse -214 -224 18.2696 0.00448
NP_440821.1_4 Forward -227 -217 9.41981 0.0286
NP_440821.1_4 Forward -45 -35 1.25834 0.139
NP_440821.1_4 Reverse -208 -218 -0.806614 0.296
NP_442810.1_7 Reverse -233 -252 3.83436 0.248
NP_441239.1_9 Reverse -32 -44 5.64384 0.213
NP_441239.1_9 Forward -81 -69 5.15219 0.227
NP_441239.1_9 Reverse -208 -220 4.75886 0.243
NP_441239.1_9 Reverse -73 -85 4.46387 0.253
NP_441239.1_9 Reverse -214 -226 4.36554 0.253
NP_441239.1_9 Forward -227 -215 3.38223 0.285
NP_441951.1_4 Reverse -378 -397 7.27595 0.273
NP_441951.1_4 Forward -380 -361 5.01433 0.273
NP_441951.1_4 Forward -225 -206 2.26107 0.283
NP_441951.1_9 Reverse -164 -183 3.6377 0.254
NP_441951.1_9 Reverse -76 -95 -1.7705 0.299
NP_441009.1_4 Reverse -216 -235 10.6192 0.263
NP_441727.1_3 Forward -232 -213 12.1925 0.136
NP_441892.1_1 Reverse -207 -224 3.48043 0.125
NP_441892.1_1 Forward -234 -217 -4.38605 0.26
NP_441892.1_1 Reverse -363 -380 -5.56602 0.283
NP_442044.1_1 Reverse -223 -242 -3.73712 0.176
NP_442044.1_1 Forward -43 -24 -5.50708 0.188
NP_442193.1_8 Reverse -213 -232 9.43841 0.294
NP_442270.1_9 Reverse -205 -224 1.96607 0.14
NP_442270.1_9 Forward -230 -211 -7.57203 0.213
NP_441017.1_6 Reverse -212 -226 16.4202 0.0651
NP_440354.1_5 Forward -228 -209 10.0292 0.174
NP_440546.1_4 Forward -225 -215 10.046 0.109
NP_440546.1_4 Reverse -216 -226 10.046 0.109
NP_440546.1_4 Forward -219 -209 8.49468 0.186
NP_440546.1_4 Reverse -210 -220 8.00989 0.209
NP_441230.1_5 Forward -170 -151 4.42435 0.188
NP_441230.1_5 Reverse -205 -224 0.196116 0.273
NP_440675.1_3 Forward -351 -332 5.01433 0.296
NP_440462.1_4 Forward -367 -353 8.25939 0.268
NP_440462.1_6 Reverse -214 -224 7.74818 0.0699
NP_440462.1_6 Reverse -208 -218 5.28991 0.161
NP_440462.1_6 Forward -227 -217 1.35667 0.294
NP_442611.1_1 Reverse -70 -89 -1.47551 0.282
NP_440868.1_4 Reverse -212 -224 8.6921 0.0582
NP_440868.1_4 Forward -229 -217 6.1355 0.0878
NP_440868.1_4 Forward -169 -157 0.923956 0.196
NP_441474.1_1 Reverse -329 -348 -2.16459 0.272
NP_441848.1_4 Reverse -314 -330 9.93796 0.267
NP_441084.1_6 Reverse -73 -87 9.24716 0.29
NP_440653.1_10 Forward -218 -199 10.9142 0.145
NP_440653.1_10 Reverse -217 -236 6.68596 0.203
NP_442039.1_4 Forward -224 -217 15.1821 0.0124
NP_442039.1_4 Reverse -217 -224 15.1821 0.0124
NP_442039.1_4 Forward -42 -35 11.6422 0.0747
NP_441811.1_1 Forward -381 -362 8.16093 0.28
NP_441811.1_8 Reverse -210 -224 7.66941 0.241
NP_440825.1_7 Reverse -217 -227 12.9096 0.152
NP_440825.1_7 Forward -42 -32 11.9337 0.2
NP_442837.1_3 Forward -224 -217 15.7721 0.0124
NP_442837.1_3 Reverse -217 -224 15.7721 0.0124
NP_442837.1_3 Forward -42 -35 6.0373 0.25
NP_442837.1_3 Reverse -35 -42 6.0373 0.25
NP_440160.1_9 Reverse -216 -235 11.1109 0.226
NP_442053.1_1 Forward -225 -216 18.3876 0.0007
NP_442053.1_1 Reverse -216 -225 18.3876 0.0007
NP_442053.1_1 Reverse -34 -43 7.07956 0.105
NP_442053.1_1 Reverse -210 -219 6.09625 0.147
NP_440505.1_3 Reverse -214 -224 16.303 0.00696
NP_440505.1_3 Forward -227 -217 9.22315 0.122
NP_440505.1_3 Forward -45 -35 8.04317 0.147
NP_440505.1_7 Reverse -209 -228 2.45773 0.235
NP_440505.1_7 Reverse -71 -90 1.27776 0.25
NP_441203.1_1 Reverse -217 -236 -18.5851 0.297
NP_442844.1_5 Forward -120 -101 1.17865 0.279
NP_442532.1_7 Reverse -75 -89 1.96621 0.258
NP_441408.2_7 Reverse -337 -356 -3.24547 0.272
NP_440914.1_1 Forward -225 -215 17.5935 0.000537
NP_440914.1_1 Reverse -216 -226 17.5935 0.000537
NP_440914.1_1 Reverse -210 -220 13.2019 0.0378
NP_440914.1_1 Forward -43 -33 11.1525 0.105
NP_442470.1_4 Forward -270 -251 14.5516 0.284
NP_441011.1_8 Forward -224 -215 8.25953 0.144
NP_441011.1_8 Reverse -217 -226 8.25953 0.144
NP_442101.1_10 Forward -233 -214 2.3594 0.0714
NP_442533.1_1 Forward -255 -236 -13.1769 0.237
NP_442533.1_6 Forward -225 -216 17.2076 0.00137
NP_442533.1_6 Reverse -216 -225 17.2076 0.00137
NP_442533.1_6 Forward -84 -75 12.2911 0.0304
NP_442533.1_6 Forward -354 -345 4.62128 0.179
NP_442533.1_6 Reverse -34 -43 4.42462 0.179
NP_442533.1_6 Reverse -210 -219 3.93297 0.197
NP_442533.1_6 Reverse -351 -360 3.53964 0.21
NP_442541.1_10 Reverse -345 -359 2.94893 0.254
NP_441482.1_7 Forward -49 -35 -2.75368 0.0997
NP_441482.1_7 Forward -231 -217 -8.5552 0.193
NP_441482.1_7 Reverse -210 -224 -8.65353 0.193
NP_441482.1_7 Reverse -150 -164 -11.6035 0.275
NP_439944.1_9 Forward -224 -214 19.0562 0.00329
NP_439944.1_9 Reverse -217 -227 10.5014 0.0887
NP_441028.1_6 Forward -283 -273 5.48612 0.255
NP_442202.1_10 Reverse -155 -169 5.01447 0.255
NP_440116.1_5 Reverse -31 -48 2.49712 0.267
NP_440116.1_8 Forward -224 -205 3.53937 0.0795
NP_440115.1_6 Forward -228 -218 9.32148 0.115
NP_440115.1_6 Reverse -213 -223 8.4365 0.13
NP_440115.1_6 Forward -46 -36 7.05986 0.161
NP_440115.1_6 Reverse -56 -66 4.99491 0.277
NP_440007.1_9 Forward -47 -33 9.43936 0.171
NP_440007.1_9 Reverse -206 -220 2.06454 0.281
NP_440007.1_9 Reverse -212 -226 1.57289 0.285
NP_440007.1_9 Forward -229 -215 0.786239 0.29
NP_441961.1_4 Reverse -26 -45 3.83436 0.277
NP_441602.1_3 Forward -224 -205 7.86593 0.117
NP_441170.1_4 Forward -363 -345 8.08229 0.194
NP_441972.1_5 Reverse -217 -236 5.211 0.0938
NP_441972.1_5 Forward -224 -205 -6.98204 0.24
NP_441106.1_1 Forward -226 -217 9.63616 0.0311
NP_441106.1_1 Reverse -215 -224 9.63616 0.0311
NP_441106.1_1 Reverse -209 -218 5.40793 0.151
NP_440429.1_2 Reverse -373 -392 9.73422 0.272
NP_441815.1_9 Reverse -240 -254 20.5501 0.266
NP_439903.1_6 Reverse -186 -205 -0.197979 0.277
NP_439903.1_6 Reverse -336 -355 -0.984623 0.289
NP_442306.1_10 Reverse -70 -89 -12.2919 0.166
NP_440797.1_2 Reverse -205 -224 15.1996 0.207
NP_441286.1_1 Forward -226 -214 21.3768 0.00196
NP_441286.1_1 Reverse -215 -227 12.9203 0.00815
NP_441286.1_1 Reverse -33 -45 4.36554 0.0342
NP_441286.1_1 Forward -137 -125 -6.05754 0.245
NP_442674.1_3 Forward -233 -214 13.6666 0.174
NP_440670.1_8 Forward -225 -216 18.3876 0.000699
NP_440670.1_8 Reverse -216 -225 18.3876 0.000699
NP_440670.1_8 Forward -43 -34 16.0277 0.00443
NP_440670.1_8 Reverse -34 -43 12.5861 0.0253
NP_441479.1_9 Reverse -365 -383 13.4905 0.277
NP_440886.1_7 Forward -226 -216 7.94438 0.0805
NP_440886.1_7 Reverse -215 -225 7.94438 0.0805
NP_440886.1_7 Forward -85 -75 7.94438 0.0805
NP_440886.1_7 Reverse -236 -246 7.64939 0.0865
NP_440886.1_7 Reverse -209 -219 5.48612 0.181
NP_440886.1_7 Reverse -83 -93 4.7978 0.218
NP_440828.1_1 Reverse -239 -258 9.83173 0.197
NP_440828.1_4 Reverse -236 -255 -8.45774 0.297
NP_441001.1_10 Forward -247 -228 6.98095 0.249
NP_442614.1_2 Forward -43 -29 16.1259 0.0715
NP_442614.1_2 Reverse -216 -230 8.16106 0.255
NP_442614.1_2 Forward -225 -211 7.17775 0.275
NP_442614.1_2 Reverse -351 -365 7.07942 0.275
NP_442614.1_2 Reverse -275 -289 6.19444 0.291
NP_440549.1_3 Reverse -333 -352 17.994 0.248
NP_442072.1_9 Forward -226 -208 -22.007 0.216
NP_442213.1_5 Forward -257 -238 4.71934 0.231
NP_442213.1_5 Forward -263 -244 -2.45882 0.296
NP_441753.1_10 Reverse -330 -349 8.35759 0.186
NP_442022.1_4 Forward -258 -239 7.47261 0.268
NP_440907.2_8 Reverse -35 -45 8.14104 0.117
NP_440907.2_8 Reverse -217 -227 7.64939 0.117
NP_442264.1_2 Forward -169 -152 8.10198 0.222
NP_442264.1_2 Forward -358 -341 5.84037 0.27
NP_442264.1_2 Reverse -212 -229 5.15205 0.284
NP_442264.1_4 Forward -87 -73 15.7325 0.25
NP_441021.1_1 Reverse -35 -54 -4.42544 0.17
NP_440841.1_4 Reverse -214 -233 -8.65367 0.25
NP_442459.1_7 Forward -27 -8 2.94938 0.235
NP_441463.1_3 Forward -229 -210 -10.6203 0.299
NP_441463.1_6 Reverse -214 -228 11.151 0.224
NP_441626.1_2 Forward -224 -217 15.7721 0.0124
NP_441626.1_2 Reverse -217 -224 15.7721 0.0124
NP_441626.1_2 Forward -42 -35 12.2322 0.0511
NP_441626.1_2 Reverse -35 -42 5.93897 0.231
NP_442365.1_7 Forward -229 -210 -2.45882 0.2
NP_440107.1_5 Forward -226 -207 1.86774 0.178
NP_440107.1_5 Reverse -377 -396 -0.197208 0.178
NP_442794.1_1 Forward -229 -217 21.9668 0.00123
NP_442794.1_1 Reverse -212 -224 10.1671 0.0721
NP_442794.1_1 Reverse -30 -42 8.9871 0.0865
NP_442615.1_1 Forward -234 -216 6.01734 0.0368
NP_441962.1_4 Forward -224 -205 -2.0655 0.127
NP_441962.1_4 Forward -42 -23 -9.24366 0.215
NP_441962.1_4 Reverse -211 -230 -12.2919 0.255
NP_441796.1_8 Reverse -149 -167 15.9488 0.127
NP_440387.1_1 Forward -225 -209 6.35172 0.0282
NP_440387.1_1 Reverse -216 -232 -3.57971 0.162
NP_441488.1_8 Forward -48 -34 13.9619 0.146
NP_441488.1_8 Forward -230 -216 13.7653 0.146
NP_442647.1_7 Reverse -205 -218 6.60746 0.257
NP_441993.1_1 Forward -225 -206 13.3492 0.0868
NP_441993.1_1 Forward -354 -335 8.86616 0.136
NP_441993.1_1 Forward -307 -288 6.33227 0.181
NP_441993.1_1 Reverse -210 -229 6.33227 0.181
NP_441993.1_1 Forward -292 -273 1.55686 0.274
NP_441174.1_2 Reverse -72 -86 17.4042 0.0497
NP_442090.1_4 Reverse -105 -124 12.9791 0.187
NP_442698.1_10 Reverse -302 -321 0.0977854 0.297
NP_442323.1_7 Forward -230 -211 5.70185 0.202
NP_442323.1_7 Reverse -211 -230 4.62021 0.215
NP_442323.1_7 Reverse -288 -307 2.35861 0.266
NP_441510.2_7 Reverse -210 -224 9.43874 0.281
NP_441552.1_4 Reverse -65 -84 18.9773 0.146
NP_440293.1_10 Forward -252 -233 -0.688862 0.255
NP_440766.1_4 Forward -223 -209 10.226 0.0871
NP_440766.1_4 Reverse -212 -226 7.9644 0.0871
NP_441237.1_9 Reverse -217 -227 14.828 0.0242
NP_441237.1_9 Forward -42 -32 11.5831 0.17
NP_441979.1_5 Forward -225 -206 -12.5869 0.228
NP_442743.1_4 Forward -399 -380 -7.27704 0.279
NP_442743.1_5 Forward -224 -205 7.37428 0.163
NP_442743.1_5 Reverse -211 -230 3.93269 0.242
NP_440457.1_1 Forward -47 -35 18.4269 0.0403
NP_440457.1_1 Reverse -212 -224 8.88877 0.101
NP_440457.1_1 Reverse -368 -380 6.1355 0.128
NP_440457.1_1 Reverse -152 -164 5.54551 0.141
NP_440457.1_1 Forward -229 -217 -0.452677 0.263
NP_440798.1_6 Reverse -217 -230 4.34585 0.145
NP_440798.1_6 Forward -42 -29 1.9859 0.188
NP_440798.1_6 Forward -218 -205 0.60927 0.254
NP_440801.1_10 Forward -223 -204 5.211 0.289
NP_440142.1_7 Reverse -217 -236 17.699 0.068
NP_441984.1_1 Forward -49 -31 9.85225 0.215
NP_441984.1_3 Reverse -377 -395 10.7372 0.184
NP_441889.1_4 Reverse -207 -226 0.294447 0.296
NP_441436.1_8 Reverse -215 -234 9.93088 0.262
NP_442509.1_9 Reverse -34 -44 10.5993 0.167
NP_442509.1_9 Reverse -378 -388 10.501 0.173
NP_442509.1_9 Forward -225 -215 8.14104 0.192
NP_442509.1_9 Reverse -216 -226 8.14104 0.192
NP_442509.1_9 Reverse -5 -15 8.04271 0.192
NP_440554.1_4 Forward -224 -214 7.05986 0.106
NP_440554.1_4 Reverse -35 -45 5.87989 0.129
NP_441761.1_1 Forward -164 -145 5.11266 0.252
NP_442737.1_5 Forward -226 -207 14.4303 0.199
NP_441885.1_5 Forward -225 -215 20.9245 0.000538
NP_441885.1_5 Reverse -216 -226 20.9245 0.000538
NP_441885.1_5 Forward -43 -33 9.51814 0.0206
NP_440478.1_4 Forward -229 -210 22.8122 0.00798
NP_442341.1_7 Forward -226 -212 17.6992 0.0111
NP_442341.1_7 Reverse -215 -229 16.1259 0.0186
NP_442341.1_7 Forward -220 -206 6.48943 0.126
NP_442341.1_7 Forward -166 -152 6.48943 0.126
NP_442341.1_9 Forward -216 -202 9.24208 0.155
NP_442341.1_9 Reverse -214 -228 9.14375 0.156
NP_442341.1_9 Forward -227 -213 7.3738 0.2
NP_441756.1_5 Reverse -206 -225 1.86774 0.215
NP_441756.1_5 Forward -392 -373 1.27776 0.217
NP_441173.1_9 Forward -282 -274 9.75379 0.284
NP_440423.1_6 Forward -51 -32 -20.3551 0.256
NP_443000.1_7 Reverse -214 -224 17.0896 0.00865
NP_443000.1_7 Forward -227 -217 10.3048 0.0345
NP_443000.1_7 Forward -45 -35 1.94665 0.226
NP_442513.1_5 Reverse -208 -227 12.29 0.265
NP_440727.1_2 Forward -248 -229 -3.14714 0.295
NP_441842.1_1 Forward -112 -99 11.7201 0.245
NP_441842.1_10 Forward -232 -218 7.76774 0.245
NP_441842.1_10 Reverse -209 -223 6.48943 0.286
NP_440275.1_3 Forward -45 -35 14.4347 0.0216
NP_440275.1_3 Reverse -214 -224 8.1415 0.0602
NP_440275.1_3 Forward -227 -217 8.04317 0.0602
NP_440091.1_1 Reverse -212 -224 6.43049 0.095
NP_443060.1_5 Reverse -26 -45 13.7649 0.109
NP_443060.1_5 Reverse -208 -227 5.99684 0.25
NP_441397.1_8 Reverse -312 -325 16.6774 0.142
NP_440679.1_10 Forward -253 -234 -11.4069 0.182
NP_443010.1_10 Forward -390 -373 3.54386 0.253
NP_441359.1_5 Forward -222 -203 8.55425 0.166
NP_442451.1_2 Reverse -208 -227 7.96426 0.101
NP_439962.1_4 Forward -227 -208 -4.81876 0.272
NP_442495.1_5 Forward -359 -340 5.40766 0.291
NP_440149.1_8 Forward -225 -206 19.6656 0.00856
NP_440149.1_10 Reverse -156 -175 -6.09707 0.255
NP_441804.1_10 Reverse -24 -34 16.4008 0.297
NP_441105.1_3 Forward -236 -217 0.0977854 0.13
NP_441105.1_3 Forward -230 -211 -4.03212 0.19
NP_442127.1_4 Forward -28 -9 15.5357 0.0714
NP_440216.1_1 Forward -225 -211 0.392915 0.0284
NP_440216.1_1 Reverse -216 -230 -0.492064 0.0284
NP_440216.1_1 Reverse -34 -48 -4.7203 0.114
NP_440216.1_1 Reverse -156 -170 -10.8168 0.148
NP_440216.1_1 Forward -84 -70 -12.4884 0.274
NP_440216.1_9 Reverse -224 -233 12.7828 0.223
NP_440172.1_1 Forward -225 -215 15.0247 0.00945
NP_440172.1_1 Reverse -216 -226 15.0247 0.00945
NP_440172.1_1 Reverse -210 -220 10.3048 0.0524
NP_440172.1_1 Reverse -34 -44 3.51995 0.224
NP_441008.1_4 Reverse -243 -262 14.9603 0.295
NP_442015.1_10 Forward -229 -216 19.8821 0.00366
NP_442015.1_10 Reverse -212 -225 19.2922 0.00444
NP_442015.1_10 Reverse -30 -43 9.85238 0.0433
NP_442015.1_10 Reverse -341 -354 1.39592 0.204
NP_442329.1_8 Forward -237 -218 5.60432 0.249
NP_441226.1_7 Forward -224 -217 14.4934 0.0123
NP_441226.1_7 Reverse -217 -224 14.4934 0.0123
NP_441226.1_7 Forward -42 -35 12.7234 0.0312
NP_441226.1_7 Forward -218 -211 12.4284 0.0404
NP_441226.1_7 Reverse -35 -42 11.5435 0.0757
NP_442834.1_9 Forward -161 -142 3.24438 0.298
NP_441111.1_7 Forward -224 -216 18.7023 0.00294
NP_441111.1_7 Reverse -217 -225 18.7023 0.00294
NP_441111.1_7 Reverse -35 -43 8.86921 0.0589
NP_442379.1_10 Reverse -209 -226 -1.43612 0.223
NP_441766.1_2 Forward -225 -216 17.5026 0.00297
NP_441766.1_2 Reverse -216 -225 17.5026 0.00297
NP_441766.1_2 Reverse -34 -43 12.6844 0.0158
NP_441766.1_9 Forward -173 -154 0.786102 0.246
NP_442417.1_5 Reverse -216 -230 8.06273 0.164
NP_440416.1_9 Forward -232 -213 1.76941 0.0433
NP_440416.1_9 Forward -382 -363 -0.885524 0.0621
NP_440416.1_9 Reverse -27 -46 -6.49039 0.0901
NP_440416.1_9 Forward -226 -207 -10.1286 0.139
NP_440416.1_9 Reverse -209 -228 -17.8968 0.248
NP_443052.1_9 Reverse -236 -255 5.99764 0.138
NP_443052.1_9 Forward -167 -148 0.687771 0.193
NP_443052.1_9 Reverse -288 -307 -0.885524 0.218
NP_440072.1_5 Forward -255 -237 6.70565 0.236
NP_440591.1_9 Forward -226 -208 9.95058 0.135
NP_442154.1_1 Forward -254 -236 -3.6191 0.125
NP_442154.1_1 Forward -251 -233 -14.4355 0.218
NP_442226.1_8 Forward -261 -251 14.1397 0.26
NP_440261.1_5 Reverse -217 -230 -0.964025 0.0655
NP_440261.1_5 Forward -224 -211 -2.63565 0.0924
NP_440261.1_5 Reverse -35 -48 -4.50394 0.151
NP_440261.1_5 Reverse -157 -170 -6.37223 0.201
NP_440261.1_5 Forward -218 -205 -11.1904 0.246
NP_440988.1_10 Reverse -214 -228 15.7419 0.112
NP_440988.1_10 Reverse -343 -357 10.0299 0.19
NP_440988.1_10 Forward -221 -207 8.4809 0.205
NP_440988.1_10 Forward -95 -81 3.44663 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACCAGCACCGGCGGGGTTTCCCATTCCCCTCGGCGGCATAGTGGTGGCCTTGACCATGGGTTTGTTGTGGAATTTTACTTTTGCTACCTTGGTCCAGTGGAGTCTGCTGCGGATGCGTTTTCCCCGTCTCCTGGTATTAATTTTGTCTGTGGTGGTGATGGTGGTTCTTCCCTTGGCGATCGCCATCGGCGCGGGAATTAAGGAAAGCACCGTGATGTGGTTTAGTCCGCTGCCGTCCATTGCCCTGGTGGAAGGAATTAGCTTTCAAACGCCCCTCTTTTTTCTAACGATTCTCACCCAAACAGTGGTAATTGCGGCCAGCACCTGGCAGTTTAATCGCTACGTTCAACGTCTCGGGCGATCGGAAAGCCAGCAATATCTTGCCCCGGTTCAGCCAGA

CDS

GTGAGAAATGGCAAATTCCCTATCCCCGCATTTTCCGCCATCACCATGACCACACCCCTTGAAAAAAAGTCAACCATTGAAGACATCCGTTCCCGTTTTGATAAAGATGTGGCCCGTTTTTCTTCCCTCGAAACTGGCCAGGCGACAACCATTGATGCTCCCCTAGCGATGTCCCTAATTACCGAGGCGGCTATCTCCTGCACTAAGAATATTCGCCACGTACTAGATATTGGCTGTGGTGCTGGTAACAACACCCTTCGATTGCGTCAATCTGCCAACTATGATTTCAATGTTGACCTACTTGATCTAAGCGCACCCATGCTGATGAAAGCGGCGGAACGGGTCCAGCAATTAAATAGGGGTTTAGTCCGTACCATACAGGGGGATTTTCGCTCAGTAAGCCTGCCAAACTCCACCTACGATGTGCTCATTGCAGCGGCCGTGTTGCACCATTTACGGGATGACGAAGACTGGCGACAAGCTTTTCAGAAAATTTACAATTTACTTGCCCCCGGTGGTAGCGTTTGGATCACCGATTTAGTTTCCCATGAGCAACCCGCCGTCCAAGCAATGATGTGGGACCGGTACGGCGACTATTTGGTCTCCCTTGGTGGTGCGGAATATCGGGACAAGGTGTTCGGCTACATTGACCGTGAAGATTCTCCCCGACCCGTTACTTACCAGCTTGATTTGCTCCGTTCCGTTGGCTTTGATGCGGTTGATCTTCTGCATAAAAACTCTTGCTTTGCTGCATTTGGTGCGGTGAAGCATTGA

Protein

MRNGKFPIPAFSAITMTTPLEKKSTIEDIRSRFDKDVARFSSLETGQATTIDAPLAMSLITEAAISCTKNIRHVLDIGCGAGNNTLRLRQSANYDFNVDLLDLSAPMLMKAAERVQQLNRGLVRTIQGDFRSVSLPNSTYDVLIAAAVLHHLRDDEDWRQAFQKIYNLLAPGGSVWITDLVSHEQPAVQAMMWDRYGDYLVSLGGAEYRDKVFGYIDREDSPRPVTYQLDLLRSVGFDAVDLLHKNSCFAAFGAVKH