Your browser is old and dusty. Try Google Chrome!

Details for slr1100

ORF slr1100
Accession NP_440079.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -360 -346 11.3077 0.249
NP_441061.1_2 Reverse -168 -182 3.14618 0.168
NP_441061.1_2 Reverse -373 -387 -0.590395 0.234
NP_440795.1_7 Reverse -177 -184 14.1988 0.0267
NP_441418.1_6 Forward -360 -341 -28.8115 0.211
NP_442291.1_5 Forward -361 -345 -4.66135 0.281
NP_441453.1_4 Reverse -351 -359 7.09925 0.0962
NP_441453.1_4 Reverse -176 -184 6.90259 0.121
NP_441453.1_4 Forward -360 -352 6.80426 0.121
NP_441453.1_4 Forward -185 -177 6.80426 0.121
NP_442151.1_6 Reverse -351 -365 7.76774 0.19
NP_441465.1_8 Forward -371 -353 6.41066 0.269
NP_442169.1_1 Reverse -4 -23 -3.54046 0.295
NP_442623.1_1 Forward -101 -82 -17.3068 0.264
NP_442287.1_4 Reverse -115 -134 16.3215 0.199
NP_442655.1_1 Forward -365 -346 -1.18052 0.261
NP_442173.1_1 Forward -184 -176 7.59091 0.163
NP_442173.1_1 Reverse -177 -185 7.59091 0.163
NP_442173.1_1 Forward -359 -351 5.82095 0.2
NP_442173.1_1 Reverse -352 -360 5.72262 0.203
NP_442173.1_6 Forward -384 -370 13.9626 0.118
NP_442752.1_4 Forward -360 -353 13.8055 0.0199
NP_441745.1_3 Forward -240 -221 15.0432 0.222
NP_442975.1_10 Reverse -347 -361 3.34225 0.259
NP_440784.1_7 Forward -184 -177 13.2155 0.0365
NP_440784.1_7 Reverse -177 -184 12.1338 0.0604
NP_440784.1_7 Forward -359 -352 6.23397 0.241
NP_440784.1_7 Reverse -352 -359 6.13563 0.241
NP_440061.1_9 Reverse -370 -384 6.58715 0.239
NP_441054.1_2 Forward -118 -99 15.8307 0.136
NP_440878.1_4 Reverse -356 -374 15.8504 0.191
NP_442062.1_8 Forward -360 -350 7.84651 0.0871
NP_442062.1_8 Reverse -351 -361 7.55152 0.0946
NP_442062.1_8 Forward -185 -175 5.19158 0.181
NP_442062.1_8 Reverse -176 -186 4.89658 0.193
NP_442268.1_9 Forward -384 -365 16.9124 0.207
NP_442242.1_4 Reverse -177 -184 12.0355 0.0521
NP_442242.1_4 Forward -184 -177 11.5438 0.089
NP_442242.1_4 Reverse -352 -359 10.8555 0.127
NP_440044.1_8 Reverse -352 -371 -2.36049 0.262
NP_439918.1_2 Forward -330 -311 -4.52377 0.278
NP_439923.1_3 Reverse -174 -193 16.2241 0.164
NP_442359.1_1 Forward -136 -117 -6.49039 0.206
NP_441208.1_9 Reverse -127 -141 5.21113 0.275
NP_442110.1_7 Forward -337 -323 1.67122 0.222
NP_441925.1_4 Reverse -368 -387 -16.0292 0.278
NP_442804.1_1 Forward -236 -217 17.0107 0.118
NP_441083.1_3 Forward -227 -217 13.7459 0.195
NP_441083.1_5 Reverse -351 -361 10.9931 0.017
NP_441083.1_5 Forward -242 -232 1.94665 0.197
NP_441083.1_5 Forward -360 -350 1.74999 0.198
NP_441738.1_2 Reverse -353 -360 15.28 0.0102
NP_441738.1_2 Forward -240 -233 8.29857 0.176
NP_441558.1_5 Reverse -174 -193 9.63589 0.117
NP_441558.1_5 Reverse -349 -368 7.86593 0.167
NP_441955.1_8 Reverse -326 -343 8.59364 0.258
NP_440209.1_1 Reverse -351 -359 14.8674 0.012
NP_440209.1_1 Forward -360 -352 8.57422 0.0425
NP_442889.1_8 Reverse -348 -362 10.6187 0.0817
NP_440178.1_7 Reverse -350 -369 -14.6519 0.156
NP_442570.1_3 Forward -168 -149 -5.9004 0.25
NP_442570.1_3 Forward -339 -320 -6.29373 0.257
NP_441716.1_1 Forward -266 -252 8.35772 0.143
NP_441327.1_4 Forward -367 -353 14.5526 0.282
NP_441598.1_1 Forward -102 -83 10.2259 0.248
NP_442111.1_4 Forward -361 -347 12.3893 0.0437
NP_441163.1_1 Reverse -337 -354 5.64298 0.271
NP_441163.1_1 Reverse -85 -102 4.16803 0.291
NP_440343.1_3 Reverse -368 -386 3.75497 0.266
NP_440906.1_5 Forward -184 -177 13.3138 0.0268
NP_440906.1_5 Forward -359 -352 6.23397 0.234
NP_440906.1_5 Reverse -352 -359 6.13563 0.241
NP_440906.1_5 Reverse -177 -184 6.13563 0.241
NP_440747.1_10 Forward -363 -351 5.25052 0.0154
NP_440747.1_10 Reverse -348 -360 -2.4193 0.0434
NP_440747.1_10 Reverse -173 -185 -12.1541 0.227
NP_440747.1_10 Reverse -325 -337 -12.3507 0.27
NP_441486.1_1 Forward -363 -349 -3.44199 0.178
NP_441486.1_1 Reverse -348 -362 -3.63866 0.18
NP_441486.1_1 Forward -188 -174 -3.93365 0.184
NP_442634.1_4 Forward -383 -369 -5.21195 0.241
NP_442848.1_9 Reverse -103 -122 6.78429 0.182
NP_441012.1_4 Reverse -111 -124 8.47575 0.272
NP_443018.1_3 Forward -359 -352 12.6255 0.0471
NP_443018.1_3 Reverse -352 -359 5.25066 0.214
NP_443018.1_3 Reverse -177 -184 5.15232 0.226
NP_443018.1_3 Forward -184 -177 5.05399 0.238
NP_443018.1_3 Forward -336 -329 4.26735 0.267
NP_443018.1_3 Reverse -329 -336 4.16902 0.278
NP_441634.1_8 Forward -104 -90 1.57289 0.188
NP_440376.1_1 Forward -360 -351 9.83282 0.0339
NP_440376.1_1 Reverse -351 -360 9.63616 0.0385
NP_440376.1_1 Forward -160 -151 3.44131 0.203
NP_441588.1_4 Reverse -353 -363 18.1713 0.0143
NP_441588.1_4 Reverse -178 -188 14.0414 0.0793
NP_442191.1_4 Forward -380 -366 13.611 0.138
NP_442485.1_3 Forward -386 -367 -0.787193 0.253
NP_441846.1_10 Forward -324 -305 -13.6686 0.207
NP_442958.1_3 Reverse -82 -101 -2.45882 0.293
NP_441013.1_2 Forward -342 -324 -1.65248 0.282
NP_441013.1_3 Forward -393 -374 9.43923 0.23
NP_441682.1_2 Reverse -218 -237 9.14423 0.185
NP_440533.1_6 Reverse -325 -344 6.88262 0.297
NP_440533.1_9 Forward -360 -341 2.26107 0.285
NP_441950.1_7 Reverse -335 -354 0.982764 0.175
NP_441763.1_10 Forward -21 -2 6.09517 0.277
NP_442658.1_1 Reverse -91 -101 12.0743 0.0643
NP_442658.1_1 Forward -199 -189 8.73102 0.181
NP_442658.1_1 Forward -339 -329 5.97777 0.242
NP_442658.1_1 Reverse -174 -184 5.48612 0.265
NP_440656.1_8 Reverse -340 -359 -9.14533 0.276
NP_441414.1_9 Reverse -351 -370 -10.0303 0.275
NP_441487.1_9 Reverse -350 -369 1.76941 0.196
NP_441487.1_9 Forward -361 -342 -3.14714 0.298
NP_442937.1_5 Forward -392 -373 6.4893 0.278
NP_441958.1_5 Reverse -350 -360 11.3864 0.0074
NP_441958.1_5 Forward -361 -351 2.83163 0.0372
NP_441958.1_5 Reverse -175 -185 -0.216628 0.186
NP_441127.1_1 Forward -121 -107 14.7492 0.134
NP_441127.1_1 Reverse -90 -104 13.7659 0.17
NP_439905.1_1 Forward -101 -88 11.3273 0.204
NP_439905.1_1 Reverse -373 -386 7.98409 0.239
NP_440984.1_7 Forward -365 -351 5.30946 0.259
NP_441097.1_2 Reverse -225 -242 3.87375 0.291
NP_439990.1_5 Forward -190 -177 7.09911 0.212
NP_440153.1_8 Reverse -115 -128 6.01747 0.175
NP_442536.1_7 Reverse -161 -180 12.2908 0.273
NP_443055.1_6 Reverse -358 -376 3.36165 0.196
NP_443055.1_6 Reverse -343 -361 -2.53818 0.296
NP_440993.1_3 Reverse -247 -266 8.35677 0.129
NP_440602.1_2 Forward -365 -346 0.294447 0.296
NP_439975.1_2 Reverse -228 -246 4.83737 0.285
NP_441348.1_3 Forward -329 -310 10.7175 0.195
NP_441099.1_5 Reverse -368 -387 -10.3253 0.25
NP_442002.1_1 Reverse -224 -242 2.37909 0.173
NP_442002.1_9 Reverse -175 -182 11.6422 0.185
NP_441294.1_7 Forward -364 -350 12.3223 0.103
NP_441674.1_10 Forward -179 -161 0.412472 0.29
NP_440147.1_4 Forward -362 -349 9.06573 0.0437
NP_440147.1_4 Forward -187 -174 5.32916 0.129
NP_440147.1_4 Reverse -174 -187 3.46087 0.187
NP_440147.1_4 Reverse -349 -362 0.510939 0.252
NP_441550.1_8 Reverse -174 -184 8.23937 0.127
NP_441550.1_8 Forward -187 -177 7.25606 0.169
NP_441550.1_8 Reverse -349 -359 6.56775 0.201
NP_441550.1_8 Forward -362 -352 5.38779 0.252
NP_441916.1_7 Forward -360 -350 9.22315 0.0383
NP_441916.1_7 Reverse -351 -361 7.05986 0.0779
NP_441916.1_7 Forward -185 -175 5.68323 0.124
NP_441916.1_10 Reverse -343 -362 0.982764 0.27
NP_441041.1_4 Reverse -351 -370 -6.58872 0.169
NP_441041.1_7 Reverse -348 -360 6.93171 0.185
NP_441725.1_4 Reverse -346 -360 14.2569 0.0693
NP_439966.1_4 Forward -124 -105 8.45592 0.2
NP_439966.1_7 Reverse -349 -359 12.0743 0.0508
NP_439966.1_7 Reverse -303 -313 5.87944 0.204
NP_442941.1_3 Forward -359 -349 9.51814 0.0306
NP_442941.1_3 Reverse -177 -187 5.97822 0.0989
NP_442941.1_3 Reverse -352 -362 1.25834 0.15
NP_440289.1_2 Reverse -348 -361 2.87088 0.086
NP_440983.1_5 Reverse -103 -122 -0.983855 0.228
NP_440260.1_8 Reverse -128 -146 0.805796 0.195
NP_442281.1_1 Forward -365 -351 13.6669 0.0249
NP_442281.1_1 Reverse -171 -185 7.96378 0.089
NP_442281.1_1 Reverse -346 -360 7.66879 0.0949
NP_001035871.2_7 Forward -379 -369 13.2547 0.219
NP_001035871.2_7 Forward -49 -39 12.8614 0.243
NP_440437.1_1 Reverse -345 -364 2.16274 0.139
NP_440437.1_1 Reverse -366 -385 -4.42544 0.258
NP_442982.1_5 Reverse -362 -381 -0.4922 0.255
NP_442982.1_5 Forward -260 -241 -2.95047 0.289
NP_440375.1_8 Reverse -352 -371 17.699 0.0983
NP_441644.1_6 Forward -360 -350 9.41933 0.0767
NP_441644.1_6 Reverse -351 -361 8.43603 0.0998
NP_441644.1_6 Forward -58 -48 4.10949 0.249
NP_443049.1_6 Forward -325 -315 11.0554 0.282
NP_440867.1_10 Forward -346 -327 2.75272 0.283
NP_442177.1_5 Forward -163 -149 10.4227 0.229
NP_442029.1_1 Forward -322 -303 -19.6667 0.297
NP_442029.1_10 Reverse -105 -124 4.22769 0.293
NP_440253.1_2 Forward -360 -342 -1.35749 0.238
NP_440929.1_8 Reverse -351 -360 9.63616 0.0262
NP_440929.1_8 Forward -360 -351 9.53783 0.0296
NP_442933.1_10 Reverse -351 -360 15.1427 0.00958
NP_442933.1_10 Forward -185 -176 13.9627 0.0192
NP_442933.1_10 Forward -360 -351 7.96454 0.0937
NP_442933.1_10 Reverse -176 -185 7.86621 0.103
NP_442933.1_10 Forward -181 -172 3.63797 0.293
NP_441751.2_8 Forward -359 -345 -5.40861 0.206
NP_442554.1_8 Forward -359 -349 7.84651 0.0825
NP_442554.1_8 Reverse -352 -362 5.48657 0.146
NP_442554.1_8 Forward -336 -326 2.24165 0.276
NP_441762.1_7 Reverse -175 -187 -6.45087 0.284
NP_442142.1_4 Forward -363 -350 7.49186 0.137
NP_442142.1_4 Reverse -348 -361 3.06699 0.268
NP_442292.1_1 Reverse -352 -361 8.65285 0.0335
NP_442292.1_1 Forward -359 -350 7.76787 0.0615
NP_442292.1_1 Reverse -177 -186 -0.196935 0.239
NP_440919.1_7 Forward -231 -213 6.89704 0.238
NP_442476.1_6 Forward -101 -87 4.71948 0.142
NP_440895.1_10 Reverse -111 -128 -2.81276 0.164
NP_443009.1_5 Forward -186 -175 7.03967 0.141
NP_443009.1_5 Forward -361 -350 4.77807 0.23
NP_442741.1_2 Reverse -324 -343 16.7157 0.178
NP_441715.1_4 Forward -359 -349 7.05986 0.118
NP_441715.1_4 Reverse -177 -187 6.66654 0.132
NP_441715.1_7 Reverse -335 -345 18.3679 0.192
NP_441448.1_1 Forward -120 -101 3.44104 0.297
NP_440464.1_10 Reverse -352 -362 11.8623 0.275
NP_441468.1_1 Forward -184 -177 6.3323 0.202
NP_441468.1_1 Forward -359 -352 6.13563 0.209
NP_441468.1_1 Reverse -177 -184 6.13563 0.209
NP_441468.1_1 Reverse -352 -359 6.0373 0.223
NP_441468.1_1 Forward -336 -329 4.36568 0.237
NP_441020.2_6 Forward -362 -345 9.87194 0.159
NP_441015.1_10 Forward -386 -367 -1.08219 0.169
NP_441015.1_10 Forward -336 -317 -7.27704 0.265
NP_441015.1_10 Forward -129 -110 -11.0136 0.29
NP_441673.1_1 Forward -360 -351 11.1111 0.0121
NP_441673.1_1 Reverse -351 -360 11.0128 0.018
NP_441731.1_2 Forward -126 -107 8.25926 0.292
NP_441826.1_5 Forward -130 -111 13.3725 0.115
NP_441330.1_1 Reverse -171 -190 5.80098 0.0293
NP_442868.1_6 Reverse -349 -359 0.57002 0.217
NP_442868.1_6 Reverse -174 -184 0.176696 0.247
NP_442868.1_6 Forward -362 -352 0.0783647 0.248
NP_442719.1_2 Reverse -103 -121 -3.61981 0.2
NP_442227.1_2 Reverse -114 -133 0.196116 0.252
NP_442227.1_2 Reverse -111 -130 -3.83545 0.298
NP_442808.1_1 Reverse -350 -360 7.45273 0.0783
NP_442808.1_1 Reverse -314 -324 1.84789 0.281
NP_441290.1_3 Forward -127 -108 15.6341 0.187
NP_440031.1_10 Forward -298 -279 2.75272 0.257
NP_440145.1_3 Forward -370 -351 7.86593 0.0466
NP_440145.1_3 Reverse -341 -360 -0.39387 0.14
NP_442542.1_2 Forward -120 -107 7.6891 0.173
NP_442542.1_9 Reverse -344 -358 5.40719 0.264
NP_442050.1_1 Forward -331 -312 10.0292 0.245
NP_442050.1_1 Forward -326 -307 9.43923 0.247
NP_442050.1_5 Reverse -349 -359 11.8776 0.0802
NP_441114.1_3 Reverse -94 -103 7.37455 0.239
NP_440558.1_2 Reverse -342 -361 -5.50708 0.26
NP_440558.1_2 Reverse -369 -388 -5.80207 0.264
NP_440558.1_2 Reverse -158 -177 -6.68705 0.279
NP_440558.1_2 Reverse -89 -108 -7.27704 0.291
NP_440079.1_1 Forward -262 -243 19.469 0.191
NP_440079.1_2 Forward -293 -274 18.7807 0.231
NP_440079.1_3 Forward -69 -50 30.9737 0.000353
NP_440079.1_6 Forward -25 -6 21.1397 0.127
NP_440079.1_7 Forward -232 -213 21.2389 0.124
NP_441878.1_6 Reverse -371 -381 0.668351 0.139
NP_441878.1_6 Forward -361 -351 0.668351 0.139
NP_441878.1_6 Reverse -350 -360 0.668351 0.139
NP_441878.1_6 Forward -382 -372 -7.29646 0.217
NP_441036.1_8 Forward -361 -351 7.25653 0.203
NP_441036.1_8 Reverse -350 -360 6.37155 0.234
NP_440614.1_2 Reverse -159 -178 13.4708 0.156
NP_441557.1_5 Forward -360 -351 10.2261 0.0144
NP_441557.1_5 Reverse -351 -360 10.1278 0.0188
NP_441557.1_5 Reverse -176 -185 -0.491928 0.193
NP_441557.1_5 Forward -185 -176 -0.590259 0.219
NP_441590.1_4 Reverse -368 -387 9.14342 0.249
NP_441590.1_4 Reverse -285 -304 4.81688 0.279
NP_441433.1_8 Forward -225 -206 -0.000545616 0.244
NP_442777.1_3 Reverse -313 -331 9.75313 0.158
NP_440101.1_10 Forward -191 -172 2.0644 0.267
NP_442830.1_5 Reverse -303 -317 6.19383 0.219
NP_441564.1_2 Forward -325 -306 11.1109 0.0727
NP_442183.1_1 Forward -360 -346 7.66941 0.134
NP_441407.1_6 Forward -46 -27 6.98095 0.121
NP_441574.1_1 Forward -197 -178 0.786102 0.186
NP_441574.1_1 Forward -387 -368 -5.11376 0.26
NP_441549.1_9 Forward -385 -367 -6.96235 0.206
NP_442347.1_2 Reverse -352 -361 12.2911 0.056
NP_442347.1_2 Reverse -363 -372 4.32629 0.284
NP_442347.1_2 Reverse -153 -162 3.7363 0.284
NP_442645.1_2 Forward -368 -349 -22.2233 0.29
NP_442594.1_8 Forward -395 -376 3.6377 0.279
NP_442594.1_8 Forward -332 -313 3.24438 0.286
NP_442594.1_8 Forward -333 -314 2.94938 0.291
NP_442508.1_8 Forward -333 -316 9.47861 0.289
NP_442764.1_8 Forward -342 -323 3.73603 0.262
NP_440136.1_2 Forward -184 -177 6.43063 0.154
NP_440136.1_2 Forward -359 -352 6.23397 0.171
NP_440136.1_2 Reverse -177 -184 6.23397 0.171
NP_440136.1_2 Reverse -352 -359 6.13563 0.193
NP_442590.1_10 Forward -177 -158 7.57094 0.223
NP_442998.1_5 Forward -245 -235 8.04317 0.274
NP_442998.1_10 Reverse -353 -360 15.5754 0.0102
NP_442998.1_10 Forward -358 -351 5.84064 0.235
NP_440299.1_1 Forward -189 -176 9.5568 0.0699
NP_440299.1_1 Reverse -324 -337 8.2785 0.0962
NP_440299.1_1 Reverse -105 -118 5.52525 0.172
NP_440299.1_1 Reverse -45 -58 3.16532 0.256
NP_441799.1_1 Reverse -172 -186 8.3571 0.117
NP_441799.1_1 Forward -364 -350 4.8172 0.236
NP_440640.1_6 Forward -130 -111 0.0977854 0.276
NP_441007.1_10 Forward -386 -373 0.412608 0.23
NP_442334.1_2 Forward -201 -184 -13.5308 0.297
NP_442334.1_2 Reverse -341 -358 -13.9242 0.297
NP_440256.1_1 Reverse -325 -344 7.07928 0.0275
NP_440256.1_1 Forward -363 -344 3.53937 0.0518
NP_440256.1_1 Reverse -348 -367 -10.1286 0.295
NP_441559.1_8 Forward -355 -341 -5.90027 0.271
NP_441559.1_8 Forward -165 -151 -7.2769 0.289
NP_441559.1_8 Reverse -346 -360 -7.57189 0.295
NP_440915.1_6 Reverse -347 -361 1.47456 0.138
NP_441179.1_9 Reverse -159 -169 16.3025 0.236
NP_440717.1_1 Reverse -116 -135 12.0942 0.199
NP_440717.1_3 Reverse -318 -332 8.65209 0.26
NP_442031.1_5 Forward -175 -156 5.89931 0.272
NP_441464.1_10 Reverse -231 -245 12.9793 0.201
NP_440306.1_4 Forward -61 -42 6.98095 0.299
NP_440306.1_5 Forward -153 -134 -2.26216 0.298
NP_442386.1_9 Reverse -327 -336 9.04574 0.175
NP_442386.1_9 Reverse -92 -101 7.17747 0.219
NP_442386.1_9 Forward -186 -177 5.40752 0.253
NP_442386.1_9 Forward -338 -329 5.11253 0.266
NP_441340.1_5 Forward -359 -352 6.23397 0.132
NP_441340.1_5 Reverse -177 -184 5.93897 0.198
NP_441340.1_5 Reverse -352 -359 5.84064 0.208
NP_441340.1_5 Forward -184 -177 5.84064 0.208
NP_441340.1_5 Reverse -329 -336 4.07068 0.239
NP_440168.1_4 Reverse -362 -381 -6.78538 0.26
NP_440327.1_6 Reverse -75 -94 3.34271 0.285
NP_440059.1_3 Reverse -312 -331 5.01354 0.299
NP_442240.1_1 Reverse -320 -339 7.27514 0.253
NP_440586.1_8 Forward -359 -352 14.69 0.026
NP_440586.1_8 Reverse -177 -184 11.1501 0.0845
NP_440586.1_8 Reverse -329 -336 7.70858 0.227
NP_440586.1_8 Forward -169 -162 5.8403 0.283
NP_442251.1_6 Reverse -177 -184 13.7071 0.0268
NP_442251.1_6 Reverse -352 -359 12.0355 0.0627
NP_440684.1_9 Forward -191 -177 12.8809 0.168
NP_441262.1_3 Forward -360 -353 14.7888 0.0223
NP_440027.1_3 Reverse -151 -169 5.22993 0.245
NP_443051.1_1 Reverse -350 -359 9.73449 0.0265
NP_443051.1_1 Forward -361 -352 0.884706 0.125
NP_443051.1_1 Reverse -175 -184 -0.983583 0.269
NP_439937.1_9 Reverse -108 -125 -10.5815 0.231
NP_439937.1_9 Forward -103 -86 -11.2699 0.248
NP_440926.1_5 Forward -386 -367 12.4875 0.23
NP_440926.1_8 Reverse -338 -357 13.1758 0.222
NP_440439.1_1 Forward -317 -304 -0.472371 0.221
NP_442239.1_8 Forward -131 -112 4.42435 0.297
NP_439943.1_4 Forward -177 -158 5.60432 0.284
NP_440372.1_2 Forward -359 -352 6.82395 0.0854
NP_440372.1_2 Reverse -177 -184 6.62729 0.151
NP_440372.1_2 Reverse -352 -359 6.52896 0.188
NP_440372.1_2 Forward -184 -177 6.52896 0.188
NP_440316.1_10 Forward -294 -284 7.35486 0.251
NP_441803.1_2 Reverse -110 -129 9.24257 0.102
NP_440139.1_1 Reverse -170 -189 2.26028 0.235
NP_441572.1_7 Reverse -356 -375 -4.91709 0.245
NP_440267.1_2 Reverse -171 -185 11.1104 0.125
NP_440267.1_2 Reverse -346 -360 9.73373 0.156
NP_440267.1_2 Reverse -357 -371 4.8172 0.292
NP_442384.1_7 Reverse -12 -26 15.9292 0.264
NP_442384.1_10 Reverse -176 -189 4.14919 0.167
NP_442384.1_10 Forward -360 -347 1.78924 0.247
NP_442384.1_10 Forward -185 -172 1.10092 0.268
NP_442384.1_10 Forward -337 -324 0.314277 0.294
NP_442114.1_8 Reverse -385 -399 3.53891 0.29
NP_441877.1_5 Forward -111 -92 -1.47551 0.286
NP_441018.1_7 Forward -397 -378 7.86593 0.263
NP_441018.1_7 Forward -341 -322 6.98095 0.278
NP_442262.1_10 Forward -359 -352 12.9205 0.0422
NP_441689.1_5 Reverse -349 -359 5.78111 0.197
NP_441689.1_5 Reverse -295 -305 4.7978 0.287
NP_440163.1_10 Reverse -112 -122 11.8781 0.169
NP_440344.1_10 Reverse -344 -361 -8.81095 0.134
NP_440344.1_10 Reverse -85 -102 -12.3509 0.25
NP_440531.1_6 Reverse -324 -343 0.786102 0.187
NP_440562.1_10 Reverse -342 -360 14.6705 0.164
NP_442693.1_7 Forward -119 -100 9.63589 0.229
NP_440297.1_9 Reverse -367 -377 6.07655 0.206
NP_441103.1_9 Reverse -307 -317 15.1264 0.192
NP_440999.1_9 Reverse -347 -361 1.37622 0.166
NP_440888.1_2 Forward -360 -346 5.80051 0.262
NP_439969.1_1 Reverse -327 -346 -6.29373 0.288
NP_442818.1_3 Forward -115 -98 -4.38605 0.243
NP_441543.1_2 Forward -359 -350 14.0611 0.0149
NP_441543.1_2 Reverse -177 -186 10.8161 0.0666
NP_441543.1_2 Reverse -352 -361 7.07956 0.131
NP_442845.1_2 Forward -191 -177 8.94771 0.183
NP_441551.1_5 Forward -385 -369 7.13767 0.249
NP_441469.1_8 Reverse -92 -101 12.1928 0.123
NP_442315.1_2 Forward -165 -153 13.8053 0.291
NP_443064.1_6 Reverse -351 -361 11.6943 0.124
NP_443064.1_6 Reverse -176 -186 10.046 0.181
NP_442578.1_7 Forward -359 -352 14.6904 0.026
NP_442578.1_7 Reverse -177 -184 12.5271 0.0544
NP_440071.1_5 Reverse -323 -342 11.7992 0.22
NP_441462.1_2 Forward -360 -350 10.8948 0.00519
NP_441462.1_2 Reverse -351 -361 1.74999 0.0811
NP_441462.1_2 Forward -185 -175 -0.41329 0.225
NP_443062.1_1 Reverse -351 -369 14.1038 0.0528
NP_443062.1_1 Forward -170 -152 9.32598 0.136
NP_442204.1_1 Reverse -347 -358 9.69511 0.0736
NP_442204.1_5 Reverse -83 -102 3.14605 0.196
NP_442487.1_5 Reverse -304 -323 3.04693 0.289
NP_440516.1_8 Forward -360 -351 8.45619 0.0364
NP_440516.1_8 Reverse -351 -360 7.37455 0.0648
NP_442428.1_5 Forward -184 -177 13.1171 0.038
NP_442428.1_5 Reverse -177 -184 6.23397 0.201
NP_442428.1_5 Forward -359 -352 6.13563 0.209
NP_442428.1_5 Reverse -352 -359 6.0373 0.212
NP_442428.1_5 Forward -336 -329 4.66067 0.244
NP_442120.1_10 Forward -387 -368 -9.63698 0.244
NP_441867.1_2 Reverse -225 -244 3.44104 0.1
NP_440673.1_2 Forward -112 -93 7.65814 0.296
NP_440673.1_3 Reverse -353 -360 12.4288 0.0426
NP_440673.1_3 Forward -183 -176 11.7405 0.0653
NP_441052.1_2 Reverse -351 -361 10.1081 0.0295
NP_441052.1_2 Forward -360 -350 7.05986 0.0818
NP_442219.1_9 Reverse -177 -186 8.94785 0.0681
NP_442219.1_9 Reverse -352 -361 7.96454 0.0696
NP_442219.1_9 Forward -184 -175 5.70292 0.135
NP_440436.1_4 Reverse -352 -361 7.57079 0.124
NP_440436.1_4 Reverse -177 -186 6.39082 0.162
NP_440436.1_4 Forward -184 -175 4.81753 0.239
NP_440436.1_4 Reverse -329 -338 4.52254 0.256
NP_441884.1_8 Forward -182 -163 -13.1769 0.276
NP_441884.1_8 Forward -171 -152 -13.3736 0.28
NP_441884.1_9 Reverse -149 -168 -23.9933 0.284
NP_441336.1_3 Forward -125 -111 16.5192 0.264
NP_442864.1_3 Forward -366 -347 10.3242 0.193
NP_440314.1_9 Forward -359 -340 -6.58872 0.23
NP_441719.1_4 Forward -359 -352 13.5105 0.026
NP_441719.1_4 Reverse -177 -184 6.62729 0.151
NP_441719.1_4 Reverse -352 -359 6.52896 0.188
NP_441719.1_4 Forward -184 -177 6.52896 0.188
NP_441004.1_1 Forward -330 -311 -8.26035 0.2
NP_441004.1_1 Reverse -323 -342 -12.9802 0.251
NP_441004.1_1 Reverse -217 -236 -15.6352 0.276
NP_441004.1_3 Forward -127 -108 5.01433 0.224
NP_442366.1_5 Forward -363 -353 14.8275 0.0375
NP_440129.1_9 Forward -336 -317 5.80098 0.293
NP_442873.1_5 Forward -94 -75 7.96345 0.271
NP_443054.1_2 Reverse -349 -363 -0.197071 0.288
NP_443054.1_2 Forward -315 -301 -0.393733 0.294
NP_441851.1_10 Forward -361 -351 11.8781 0.0602
NP_442208.1_5 Forward -126 -107 -0.0988766 0.248
NP_442856.1_7 Reverse -167 -186 -2.26216 0.236
NP_442856.1_7 Reverse -342 -361 -2.55715 0.236
NP_442515.1_1 Reverse -89 -103 -4.52363 0.298
NP_441683.1_7 Forward -325 -306 -6.49039 0.27
NP_440593.1_3 Reverse -317 -336 4.81767 0.13
NP_440165.1_5 Forward -361 -342 13.0775 0.0454
NP_441349.1_10 Forward -370 -351 -3.24547 0.136
NP_440432.1_9 Forward -359 -344 -3.65835 0.187
NP_440432.1_9 Reverse -352 -367 -4.05167 0.196
NP_440432.1_9 Forward -184 -169 -4.73999 0.22
NP_442843.1_1 Forward -169 -150 -3.44213 0.222
NP_442843.1_1 Forward -110 -91 -9.44032 0.266
NP_442843.1_1 Reverse -94 -113 -9.73531 0.269
NP_439960.1_10 Reverse -321 -339 -4.50408 0.293
NP_441124.1_5 Reverse -98 -108 12.7217 0.215
NP_440588.1_2 Reverse -363 -382 -6.1954 0.273
NP_440483.1_1 Reverse -221 -240 -1.67217 0.208
NP_441570.1_1 Forward -360 -342 -12.0756 0.208
NP_441570.1_1 Forward -191 -173 -17.5821 0.283
NP_441078.1_4 Forward -360 -351 9.93116 0.0203
NP_441078.1_4 Reverse -351 -360 9.83282 0.0226
NP_441078.1_4 Forward -381 -372 6.39124 0.0775
NP_441078.1_4 Reverse -372 -381 -1.77023 0.266
NP_442388.1_4 Forward -242 -223 14.1583 0.201
NP_442348.1_2 Reverse -233 -242 7.37455 0.28
NP_442443.1_1 Forward -126 -107 -6.88371 0.299
NP_440526.1_3 Reverse -316 -327 0.943182 0.267
NP_440526.1_3 Reverse -352 -363 0.64819 0.273
NP_441432.1_8 Forward -361 -352 7.27622 0.101
NP_441432.1_8 Reverse -350 -359 6.98123 0.112
NP_441432.1_8 Forward -382 -373 3.34298 0.248
NP_441432.1_8 Forward -332 -323 2.85133 0.281
NP_441432.1_8 Forward -102 -93 2.65466 0.292
NP_443024.1_2 Reverse -189 -202 14.08 0.289
NP_443024.1_3 Forward -369 -359 14.238 0.255
NP_442320.1_8 Forward -366 -352 3.73617 0.0578
NP_442320.1_8 Forward -191 -177 -3.83532 0.134
NP_442344.1_7 Reverse -352 -371 -6.68705 0.172
NP_441732.1_2 Reverse -368 -384 11.3666 0.0091
NP_441732.1_2 Reverse -347 -363 -15.6744 0.155
NP_440199.1_10 Forward -363 -353 7.25653 0.231
NP_442727.1_1 Reverse -80 -94 12.586 0.259
NP_442489.1_7 Reverse -351 -360 17.306 0.00302
NP_442489.1_7 Forward -360 -351 10.4228 0.0151
NP_442489.1_7 Forward -381 -372 -1.37691 0.195
NP_440559.1_1 Reverse -352 -361 7.76787 0.0918
NP_440559.1_1 Reverse -177 -186 7.76787 0.0918
NP_440559.1_1 Forward -184 -175 7.57121 0.106
NP_440559.1_1 Forward -359 -350 5.60459 0.139
NP_441659.2_8 Forward -360 -350 11.3864 0.0184
NP_441659.2_8 Reverse -351 -361 8.53483 0.0412
NP_441022.1_1 Forward -195 -186 12.4095 0.232
NP_440363.1_9 Forward -110 -92 15.3588 0.187
NP_442913.1_10 Reverse -342 -361 6.88262 0.0577
NP_442913.1_10 Forward -369 -350 4.42435 0.0878
NP_441040.1_2 Forward -126 -107 -13.9635 0.284
NP_442849.1_1 Forward -326 -312 9.14437 0.261
NP_442346.1_5 Reverse -175 -185 11.9764 0.0538
NP_442346.1_5 Forward -171 -161 10.3048 0.101
NP_442346.1_5 Forward -186 -176 9.61647 0.118
NP_442346.1_5 Forward -361 -351 7.55152 0.165
NP_442346.1_5 Reverse -350 -360 6.46988 0.201
NP_442346.1_5 Reverse -377 -387 4.89658 0.269
NP_440545.1_3 Reverse -105 -122 -3.5994 0.208
NP_440545.1_3 Forward -106 -89 -4.38605 0.224
NP_440545.1_3 Forward -385 -368 -5.36936 0.247
NP_440545.1_3 Reverse -368 -385 -5.76269 0.259
NP_440025.1_1 Forward -364 -345 17.2074 0.147
NP_440459.1_2 Forward -369 -352 7.61033 0.285
NP_440459.1_10 Forward -156 -137 13.7658 0.226
NP_440010.1_4 Reverse -172 -191 -2.16459 0.275
NP_440847.1_3 Reverse -359 -373 10.8154 0.282
NP_442828.1_8 Forward -399 -380 29.4004 0.000109
NP_441888.1_7 Reverse -346 -360 2.2612 0.225
NP_441050.1_5 Reverse -226 -244 -3.22577 0.286
NP_440946.1_4 Reverse -327 -346 10.8159 0.229
NP_441358.1_2 Forward -331 -312 9.0459 0.246
NP_441833.1_4 Reverse -352 -359 6.52896 0.0924
NP_441833.1_4 Forward -184 -177 6.3323 0.134
NP_441833.1_4 Forward -359 -352 6.23397 0.163
NP_441833.1_4 Reverse -177 -184 6.23397 0.163
NP_441895.1_2 Reverse -323 -342 -26.6482 0.246
NP_442162.1_9 Forward -359 -352 6.62729 0.142
NP_442162.1_9 Reverse -352 -359 6.52896 0.178
NP_442162.1_9 Reverse -177 -184 6.52896 0.178
NP_442162.1_9 Forward -184 -177 6.43063 0.208
NP_442045.1_5 Reverse -319 -338 1.17943 0.265
NP_442140.1_3 Forward -169 -159 7.64985 0.133
NP_442021.1_6 Forward -217 -198 4.916 0.268
NP_441671.1_1 Forward -181 -162 1.27776 0.263
NP_440875.1_9 Forward -358 -348 11.7788 0.152
NP_441813.1_5 Reverse -349 -359 8.53483 0.0394
NP_441813.1_5 Reverse -174 -184 7.84651 0.0573
NP_441813.1_5 Forward -339 -329 -0.609952 0.261
NP_440590.1_4 Reverse -352 -365 -0.275709 0.182
NP_440590.1_4 Reverse -177 -190 -1.94734 0.233
NP_440590.1_4 Forward -359 -346 -3.32397 0.255
NP_440567.1_1 Reverse -352 -366 4.52282 0.118
NP_440567.1_1 Reverse -177 -191 2.45787 0.174
NP_440567.1_1 Forward -180 -166 0.982901 0.224
NP_442497.1_10 Forward -184 -175 8.1612 0.0625
NP_442497.1_10 Forward -359 -350 7.86621 0.0695
NP_442497.1_10 Reverse -352 -361 0.589713 0.153
NP_442497.1_10 Reverse -177 -186 -1.18024 0.256
NP_440821.1_4 Forward -362 -352 -0.314959 0.251
NP_440227.1_2 Forward -253 -237 8.61333 0.29
NP_441239.1_9 Reverse -349 -361 3.67722 0.279
NP_441951.1_4 Forward -130 -111 2.16274 0.283
NP_441727.1_3 Forward -388 -369 12.0942 0.139
NP_441892.1_1 Reverse -167 -184 -5.95935 0.294
NP_442270.1_9 Forward -342 -323 3.24438 0.14
NP_442643.1_3 Reverse -113 -132 -2.85214 0.261
NP_440354.1_7 Forward -373 -355 6.50899 0.282
NP_442138.1_10 Forward -360 -341 -0.688862 0.16
NP_442052.1_8 Reverse -364 -374 11.9764 0.297
NP_440546.1_4 Forward -170 -160 6.55553 0.291
NP_441230.1_5 Reverse -317 -336 0.491109 0.266
NP_440462.1_6 Reverse -349 -359 9.12481 0.0498
NP_440462.1_6 Reverse -170 -180 1.65166 0.294
NP_442340.1_3 Forward -100 -81 -8.16202 0.244
NP_440868.1_2 Reverse -198 -212 16.9075 0.275
NP_440868.1_4 Reverse -347 -359 -0.551008 0.274
NP_441204.1_1 Reverse -342 -361 5.80098 0.291
NP_441497.1_3 Reverse -92 -111 -11.9969 0.294
NP_441249.1_8 Forward -324 -305 4.62101 0.259
NP_441084.1_6 Reverse -174 -188 12.8346 0.152
NP_441843.2_9 Reverse -353 -371 11.951 0.205
NP_442923.1_4 Reverse -217 -236 9.63589 0.0739
NP_442039.1_7 Forward -205 -195 8.33817 0.263
NP_441811.1_8 Forward -191 -177 14.3559 0.175
NP_440825.1_7 Reverse -352 -362 13.0072 0.152
NP_440825.1_7 Reverse -177 -187 10.8602 0.286
NP_442837.1_3 Forward -184 -177 13.5105 0.0268
NP_442837.1_3 Reverse -352 -359 12.1338 0.0702
NP_442837.1_3 Reverse -177 -184 6.13563 0.25
NP_442837.1_3 Forward -359 -352 6.0373 0.25
NP_442053.1_1 Reverse -351 -360 16.3227 0.00389
NP_442053.1_1 Forward -360 -351 8.65285 0.0741
NP_440505.1_3 Reverse -349 -359 7.35486 0.157
NP_441959.1_10 Reverse -327 -345 11.9102 0.225
NP_442971.1_3 Forward -318 -299 14.8474 0.167
NP_442255.1_1 Forward -336 -317 15.3391 0.095
NP_440548.1_8 Reverse -77 -96 17.5024 0.233
NP_442174.1_9 Forward -199 -180 6.39097 0.288
NP_440914.1_1 Reverse -93 -103 11.6404 0.0843
NP_440914.1_1 Reverse -351 -361 8.51751 0.186
NP_440914.1_1 Forward -360 -350 6.66328 0.269
NP_441011.1_8 Forward -184 -175 12.8811 0.0391
NP_441011.1_8 Forward -359 -350 6.98123 0.18
NP_441011.1_8 Reverse -329 -338 5.01461 0.289
NP_442533.1_1 Forward -263 -244 -15.7335 0.257
NP_442533.1_1 Forward -392 -373 -16.8151 0.277
NP_442533.1_6 Reverse -351 -360 7.57121 0.0898
NP_442533.1_6 Forward -360 -351 7.47288 0.0898
NP_442533.1_6 Forward -381 -372 4.91628 0.165
NP_442533.1_6 Reverse -176 -185 2.85133 0.236
NP_442541.1_10 Reverse -372 -386 4.71887 0.248
NP_440263.1_3 Forward -331 -312 7.37428 0.243
NP_441482.1_7 Reverse -345 -359 -4.32697 0.147
NP_441482.1_7 Reverse -366 -380 -11.4068 0.262
NP_441482.1_9 Reverse -100 -113 15.26 0.278
NP_441028.1_6 Reverse -134 -144 9.51767 0.216
NP_441028.1_6 Reverse -193 -203 8.04271 0.217
NP_441028.1_6 Reverse -279 -289 3.42118 0.296
NP_440116.1_5 Forward -363 -346 7.41366 0.155
NP_440116.1_8 Forward -359 -340 -3.54046 0.154
NP_441527.1_8 Reverse -24 -43 5.01433 0.279
NP_440115.1_6 Reverse -173 -183 12.1731 0.103
NP_440007.1_9 Reverse -347 -361 1.17956 0.29
NP_443045.1_9 Reverse -109 -127 7.19654 0.279
NP_442673.1_5 Forward -373 -355 17.5221 0.15
NP_441106.1_1 Reverse -350 -359 8.84951 0.0431
NP_441106.1_1 Forward -338 -329 4.62128 0.213
NP_440429.1_2 Reverse -110 -129 7.27595 0.289
NP_441216.1_4 Forward -342 -323 15.0441 0.196
NP_441286.1_1 Forward -361 -349 -3.50094 0.145
NP_441286.1_1 Reverse -350 -362 -6.35254 0.26
NP_441385.1_1 Reverse -226 -241 15.4179 0.28
NP_440670.1_8 Forward -360 -351 9.53783 0.0559
NP_440670.1_8 Reverse -351 -360 9.14451 0.0583
NP_440886.1_7 Forward -235 -225 5.87944 0.158
NP_440828.1_1 Reverse -374 -393 2.26028 0.231
NP_440028.1_6 Forward -129 -111 17.1287 0.193
NP_442022.1_4 Forward -124 -105 7.96426 0.268
NP_440907.2_8 Forward -359 -349 6.37109 0.171
NP_442264.1_2 Forward -385 -368 10.8552 0.185
NP_441021.1_1 Reverse -177 -196 -0.197208 0.098
NP_441626.1_2 Forward -359 -352 6.13563 0.177
NP_441626.1_2 Reverse -177 -184 6.0373 0.212
NP_441626.1_2 Reverse -352 -359 5.93897 0.231
NP_441626.1_2 Forward -184 -177 5.93897 0.231
NP_442211.1_3 Forward -95 -76 13.5996 0.223
NP_442794.1_1 Forward -189 -177 8.88877 0.0906
NP_442794.1_1 Reverse -253 -265 5.15219 0.231
NP_442615.1_1 Forward -369 -351 -5.09406 0.204
NP_440387.1_1 Forward -360 -344 7.92501 0.0282
NP_440387.1_1 Reverse -176 -192 -6.03799 0.262
NP_440855.1_5 Reverse -370 -389 3.53858 0.287
NP_441431.1_2 Reverse -173 -187 9.14375 0.192
NP_441431.1_2 Reverse -158 -172 7.96378 0.23
NP_441836.1_2 Forward -124 -105 -5.70374 0.284
NP_441993.1_1 Forward -191 -172 11.2051 0.116
NP_441993.1_1 Forward -393 -374 6.52718 0.179
NP_441993.1_1 Forward -366 -347 5.65007 0.198
NP_442224.1_1 Reverse -214 -233 -5.9004 0.291
NP_440114.1_8 Forward -153 -134 12.4875 0.287
NP_441858.1_2 Reverse -92 -111 8.77117 0.293
NP_440293.1_3 Forward -383 -364 3.44104 0.192
NP_439988.1_3 Forward -386 -372 10.521 0.219
NP_441237.1_9 Reverse -352 -362 12.0747 0.139
NP_442942.1_7 Forward -179 -160 5.30933 0.275
NP_439910.1_2 Forward -368 -351 -22.479 0.25
NP_442297.1_4 Forward -364 -345 14.3777 0.201
NP_441332.1_6 Reverse -73 -83 11.8404 0.244
NP_442509.1_9 Forward -139 -129 7.55106 0.214
NP_442514.1_5 Reverse -78 -97 -8.35941 0.285
NP_440554.1_4 Forward -359 -349 8.23984 0.0804
NP_440554.1_4 Reverse -329 -339 6.17489 0.126
NP_441885.1_5 Reverse -351 -361 11.0914 0.00874
NP_441885.1_5 Forward -360 -350 1.94665 0.0935
NP_441885.1_5 Reverse -176 -186 0.471689 0.145
NP_441885.1_5 Forward -118 -108 -1.78992 0.284
NP_442341.1_7 Reverse -108 -122 8.06273 0.0947
NP_442341.1_7 Reverse -350 -364 1.57289 0.286
NP_442341.1_9 Reverse -349 -363 10.3237 0.135
NP_443000.1_7 Reverse -349 -359 10.5014 0.0345
NP_443000.1_7 Reverse -174 -184 8.1415 0.0506
NP_443000.1_7 Forward -187 -177 6.76487 0.114
NP_443000.1_7 Forward -362 -352 0.57002 0.294
NP_440275.1_3 Reverse -349 -359 6.46988 0.105
NP_440091.1_1 Forward -364 -352 -0.846001 0.293
NP_441902.1_3 Forward -203 -193 12.3986 0.253
NP_441359.1_5 Forward -134 -115 0.392778 0.291
NP_439962.1_4 Forward -345 -326 8.45592 0.134
NP_442495.1_5 Forward -101 -82 8.75091 0.291
NP_441105.1_3 Forward -196 -177 -3.83545 0.185
NP_440216.1_1 Reverse -351 -365 -1.47537 0.0328
NP_440216.1_1 Forward -360 -346 -1.77037 0.0383
NP_440216.1_1 Forward -185 -171 -4.13031 0.1
NP_440172.1_1 Forward -360 -350 7.84651 0.0718
NP_440172.1_1 Reverse -351 -361 5.38824 0.145
NP_440172.1_1 Reverse -176 -186 4.69992 0.171
NP_442788.1_7 Forward -332 -313 7.86593 0.278
NP_442015.1_10 Reverse -324 -337 1.19926 0.21
NP_441226.1_7 Reverse -329 -336 11.2485 0.0971
NP_441111.1_7 Forward -359 -351 8.96754 0.0463
NP_441111.1_7 Reverse -352 -360 8.86921 0.0589
NP_440244.1_1 Forward -334 -315 -2.75381 0.216
NP_441766.1_2 Reverse -351 -360 7.76787 0.0714
NP_441766.1_2 Forward -360 -351 7.76787 0.0714
NP_442417.1_5 Forward -360 -346 7.17775 0.195
NP_440416.1_1 Forward -360 -341 -11.5053 0.272
NP_440416.1_9 Reverse -321 -340 -0.885524 0.0621
NP_440416.1_9 Forward -192 -173 -17.7001 0.245
NP_443052.1_8 Forward -370 -351 0.491109 0.0662
NP_443052.1_8 Reverse -341 -360 -12.1936 0.249
NP_443052.1_9 Reverse -111 -130 0.982764 0.188
NP_443052.1_9 Reverse -76 -95 0.884433 0.191
NP_440072.1_5 Forward -293 -275 -1.06249 0.255
NP_442154.1_1 Forward -129 -111 -16.1071 0.232
NP_442154.1_1 Reverse -224 -242 -19.3521 0.298
NP_440261.1_5 Forward -184 -171 -3.22564 0.12
NP_440988.1_10 Reverse -91 -105 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTAGTGGATTTTGTGGTGGCTAGGGCCTTGGATCAATTGGCGATCGACTGTGTGCCCCTCCAGCGTTGGCAAGGGGGTATGGAAGGGGAGTGACGGATTTACTTAGGCTCTGAGGGTAAGTCCTTCTGATGAGTCGATTATGAGGGAAGTGTAAGTCCAAATCCCCCAACCTTGCCGGAGCTTTAGTGAAAATAGTTGGGGGACAAAGGCTTTAGTGATCGCTCGGTGCGCCATGGTTGGGATTAGCCGTTAAGCTAGAGAAAAACCGCCCAGTGTCGGCGGCTGTGGGCAAAGTTTGGCATTGCCGCCAGAAAAGCTGACGGGAGGTGGTTAATTGATAAGCGGTTGTCAAGCGGTTTGTTCTACAGATTCTTACCCTCCACCCAACTGTAAACACC

CDS

ATGGCAAGACGTAAAAAAACTTTTCCCTGTGGCCATAAGGGTTATGGTCAAGAATGTCATCGCTGTGTGCAAAAACACATTGACCAAGAGGAAAGGAAACATTCCCGCGACGCTTGGAAAGCCACCTTTGCTGAAGATCCCATTGATCTGACCCATCTACCCAGAAATGTGGTGCTCAAAGCCAGACAAATTCTCGCAGGTTTGGCCAATCAACATGACTACCGTGAGTTTTACGGCAAACGTCTTAGGCATGATCGCCTAGTGATCAGTATTCCAGTTACTAGACATTACCGGCTTATTTGTCAGGACGATGGCGATCGCCTAGAACCAAAAGAAATCGTCTCCCACGAAGATTACAATGTATGTAAGCCAGGGCATTGA

Protein

MARRKKTFPCGHKGYGQECHRCVQKHIDQEERKHSRDAWKATFAEDPIDLTHLPRNVVLKARQILAGLANQHDYREFYGKRLRHDRLVISIPVTRHYRLICQDDGDRLEPKEIVSHEDYNVCKPGH