Your browser is old and dusty. Try Google Chrome!

Details for slr1099

ORF slr1099
Accession NP_440078.1
Symbol ubiX
Category Menaquinone and ubiquinone
Definition 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -201 -215 1.57289 0.186
NP_441418.1_6 Forward -209 -190 -11.0136 0.043
NP_441418.1_6 Reverse -231 -250 -22.5183 0.179
NP_442291.1_5 Forward -210 -194 -4.26803 0.269
NP_441453.1_4 Reverse -200 -208 7.19758 0.0757
NP_441453.1_4 Forward -209 -201 6.80426 0.121
NP_440226.1_1 Forward -209 -190 13.6675 0.0352
NP_440996.1_3 Forward -222 -204 12.4089 0.221
NP_442173.1_1 Forward -208 -200 7.68924 0.142
NP_442173.1_1 Reverse -201 -209 5.72262 0.203
NP_442752.1_4 Forward -209 -202 13.8055 0.0199
NP_443027.1_4 Forward -211 -201 10.9931 0.109
NP_443027.1_4 Reverse -282 -292 6.37155 0.283
NP_441812.1_3 Forward -210 -196 11.111 0.215
NP_442975.1_10 Reverse -196 -210 1.86729 0.29
NP_440784.1_7 Forward -208 -201 6.23397 0.241
NP_440784.1_7 Reverse -201 -208 6.13563 0.241
NP_441438.1_1 Forward -55 -36 9.63589 0.228
NP_440061.1_9 Forward -127 -113 7.47213 0.205
NP_441054.1_2 Forward -260 -241 9.53756 0.292
NP_441476.1_5 Forward -390 -371 0.196116 0.19
NP_442062.1_8 Forward -209 -199 16.6963 0.00399
NP_442062.1_8 Reverse -200 -210 7.15819 0.107
NP_442062.1_8 Reverse -196 -206 5.78156 0.152
NP_441859.1_3 Forward -210 -191 10.2251 0.121
NP_440304.1_4 Reverse -229 -239 6.27322 0.167
NP_442242.1_4 Reverse -201 -208 10.8555 0.127
NP_442762.1_10 Forward -271 -252 -18.4868 0.297
NP_441200.1_6 Reverse -237 -254 16.0668 0.177
NP_441208.1_1 Reverse -184 -203 2.85105 0.212
NP_441208.1_9 Forward -289 -275 5.60446 0.267
NP_441208.1_9 Forward -296 -282 4.91614 0.282
NP_442110.1_7 Reverse -200 -214 3.73617 0.21
NP_441082.1_10 Forward -136 -123 9.65572 0.242
NP_442726.1_7 Reverse -178 -196 6.50899 0.192
NP_441925.1_4 Reverse -106 -125 -16.0292 0.278
NP_441925.1_4 Reverse -112 -131 -16.7175 0.285
NP_441083.1_5 Forward -147 -137 -0.609952 0.272
NP_441083.1_5 Reverse -116 -126 -1.00328 0.289
NP_441434.1_1 Forward -24 -10 7.65097 0.267
NP_441738.1_2 Reverse -202 -209 15.28 0.0102
NP_441738.1_2 Forward -326 -319 6.72528 0.236
NP_441955.1_8 Forward -215 -198 12.3302 0.199
NP_440209.1_1 Forward -209 -201 8.57422 0.0425
NP_440209.1_1 Reverse -200 -208 5.32929 0.139
NP_442136.1_1 Forward -55 -36 6.68596 0.27
NP_440447.1_1 Forward -214 -196 12.1139 0.148
NP_441713.1_1 Forward -246 -227 -15.7335 0.27
NP_441770.1_4 Forward -229 -210 -8.94866 0.246
NP_440906.1_5 Forward -208 -201 6.23397 0.234
NP_440906.1_5 Reverse -201 -208 6.13563 0.241
NP_440747.1_10 Forward -128 -116 -11.7607 0.142
NP_440747.1_10 Reverse -113 -125 -11.7607 0.142
NP_440747.1_10 Forward -212 -200 -11.8591 0.161
NP_440747.1_10 Forward -92 -80 -12.3507 0.27
NP_441486.1_1 Reverse -197 -211 -0.787057 0.162
NP_441486.1_1 Forward -212 -198 -5.60527 0.248
NP_442145.1_4 Reverse -10 -29 3.96249 0.283
NP_441667.1_1 Forward -25 -10 14.6858 0.284
NP_440470.1_5 Reverse -7 -26 10.3605 0.204
NP_440842.1_4 Reverse -36 -55 -0.118524 0.289
NP_440842.1_10 Reverse -248 -262 3.14618 0.266
NP_443017.1_1 Reverse -37 -56 22.1904 0.0167
NP_441014.1_8 Reverse -252 -271 -0.197208 0.218
NP_441014.1_10 Reverse -32 -51 4.32522 0.197
NP_441012.1_4 Reverse -202 -215 8.57408 0.272
NP_443018.1_3 Forward -208 -201 12.6255 0.0471
NP_443018.1_3 Reverse -201 -208 5.25066 0.214
NP_441634.1_8 Forward -211 -197 1.96621 0.175
NP_440376.1_1 Reverse -116 -125 5.50626 0.131
NP_440376.1_1 Forward -240 -231 3.7363 0.195
NP_440376.1_1 Forward -124 -115 1.57302 0.246
NP_440376.1_1 Forward -209 -200 -0.000272808 0.285
NP_440376.1_1 Reverse -200 -209 -0.0986038 0.285
NP_441588.1_4 Reverse -343 -353 5.68323 0.245
NP_442687.1_7 Forward -210 -200 5.78156 0.188
NP_441077.1_6 Forward -36 -20 9.35753 0.175
NP_441846.1_10 Forward -308 -289 -22.125 0.257
NP_441846.1_10 Forward -131 -112 -22.125 0.257
NP_440642.1_10 Reverse -32 -46 3.14559 0.277
NP_440042.1_2 Reverse -190 -209 0.294447 0.213
NP_441080.1_7 Reverse -10 -28 7.09821 0.238
NP_440667.1_2 Reverse -326 -345 -7.57203 0.28
NP_441763.1_10 Forward -220 -201 10.3234 0.16
NP_442658.1_1 Reverse -198 -208 8.23937 0.199
NP_442658.1_1 Forward -211 -201 6.17443 0.235
NP_442198.1_7 Reverse -197 -216 16.8132 0.139
NP_440141.1_8 Forward -163 -144 5.50599 0.273
NP_441553.1_4 Reverse -16 -34 21.0102 0.0789
NP_442205.1_2 Forward -358 -339 11.9368 0.26
NP_442544.1_2 Reverse -348 -362 -0.000409212 0.217
NP_440184.1_1 Forward -53 -34 4.0246 0.229
NP_443061.1_1 Reverse -270 -289 20.2135 0.149
NP_441487.1_9 Reverse -277 -296 5.30933 0.138
NP_442300.1_10 Forward -202 -183 8.75091 0.297
NP_442937.1_5 Forward -226 -207 7.66927 0.244
NP_441958.1_5 Forward -210 -200 1.55333 0.095
NP_441958.1_5 Reverse -387 -397 -0.0199663 0.178
NP_441127.1_1 Reverse -356 -370 9.5377 0.272
NP_441127.1_1 Reverse -320 -334 8.06273 0.3
NP_442486.1_3 Forward -88 -70 14.0805 0.266
NP_442486.1_4 Reverse -70 -89 7.7676 0.273
NP_440269.1_2 Forward -52 -38 14.4542 0.281
NP_442690.1_1 Reverse -6 -25 -8.85033 0.189
NP_442690.1_3 Forward -154 -135 25.4672 0.00741
NP_442911.1_2 Forward -219 -200 -6.78538 0.192
NP_441580.1_6 Reverse -377 -396 0.58944 0.133
NP_440369.1_8 Reverse -335 -354 16.1384 0.253
NP_443055.1_6 Reverse -192 -210 -0.178247 0.254
NP_443055.1_6 Forward -274 -256 -1.55487 0.28
NP_440993.1_2 Reverse -383 -399 1.33684 0.284
NP_440993.1_3 Reverse -233 -252 4.03023 0.17
NP_442002.1_9 Forward -210 -203 10.7572 0.185
NP_441646.1_1 Reverse -205 -224 5.211 0.182
NP_442438.1_10 Reverse -276 -290 6.48943 0.114
NP_442438.1_10 Forward -214 -200 1.67122 0.19
NP_441000.1_6 Forward -210 -196 2.5562 0.136
NP_442771.1_1 Reverse -241 -259 -8.83064 0.208
NP_440147.1_4 Reverse -364 -377 3.16588 0.193
NP_440147.1_4 Forward -211 -198 0.117615 0.265
NP_441916.1_7 Reverse -200 -210 15.9097 0.0072
NP_441916.1_7 Forward -209 -199 6.66654 0.0875
NP_441916.1_7 Forward -205 -195 1.74999 0.275
NP_441916.1_10 Reverse -204 -223 0.491109 0.281
NP_440206.1_9 Reverse -120 -139 8.35759 0.272
NP_441041.1_1 Forward -280 -261 6.29264 0.274
NP_441041.1_4 Reverse -200 -219 13.0775 0.0234
NP_442004.1_6 Reverse -200 -214 8.84938 0.14
NP_441725.1_5 Reverse -201 -211 1.455 0.135
NP_439966.1_7 Forward -211 -201 8.73102 0.13
NP_439966.1_7 Reverse -198 -208 6.96107 0.16
NP_439966.1_7 Reverse -121 -131 4.50281 0.269
NP_439966.1_7 Forward -399 -389 4.10949 0.289
NP_439966.1_9 Forward -211 -202 0.983037 0.253
NP_439966.1_9 Reverse -198 -207 0.884706 0.253
NP_442941.1_3 Reverse -201 -211 1.65166 0.147
NP_442281.1_1 Forward -214 -200 10.422 0.0589
NP_442012.1_1 Forward -215 -196 8.65258 0.0986
NP_442049.1_4 Reverse -146 -165 -6.39206 0.29
NP_442049.1_10 Forward -248 -229 2.16274 0.289
NP_441087.1_6 Reverse -236 -254 -0.571569 0.258
NP_440723.1_8 Forward -267 -253 12.291 0.195
NP_441556.1_10 Reverse -110 -124 9.92981 0.281
NP_440498.1_1 Reverse -191 -209 4.9357 0.114
NP_443030.1_4 Forward -221 -202 -6.29373 0.281
NP_441644.1_6 Reverse -206 -216 7.84605 0.115
NP_442215.1_2 Reverse -275 -291 -7.0213 0.284
NP_440253.1_2 Forward -209 -191 -2.53746 0.268
NP_440929.1_8 Reverse -388 -397 5.50626 0.132
NP_442933.1_10 Reverse -200 -209 15.1427 0.00958
NP_442933.1_10 Forward -209 -200 7.96454 0.0937
NP_440382.1_2 Forward -34 -15 6.48849 0.259
NP_441751.2_8 Reverse -201 -215 -3.83532 0.156
NP_442554.1_8 Reverse -201 -211 4.0116 0.2
NP_442554.1_8 Forward -292 -282 2.53664 0.268
NP_442970.1_3 Reverse -8 -26 19.078 0.0681
NP_441762.1_7 Forward -210 -198 4.36554 0.0504
NP_441762.1_7 Reverse -199 -211 3.97222 0.0602
NP_442142.1_4 Forward -212 -199 14.08 0.0317
NP_442292.1_1 Reverse -201 -210 -0.196935 0.239
NP_441525.1_1 Forward -253 -240 11.524 0.291
NP_442476.1_6 Reverse -232 -246 0.687908 0.247
NP_442381.1_8 Reverse -112 -131 -8.65367 0.227
NP_441711.1_4 Reverse -379 -398 14.7491 0.053
NP_441711.1_4 Reverse -191 -210 4.916 0.191
NP_443009.1_5 Reverse -230 -241 13.2345 0.036
NP_441715.1_4 Reverse -201 -211 6.46988 0.143
NP_441198.1_8 Reverse -229 -239 10.3415 0.28
NP_440379.1_5 Forward -224 -205 -10.1286 0.276
NP_441758.1_10 Forward -26 -7 -1.8696 0.275
NP_441468.1_1 Forward -208 -201 6.13563 0.209
NP_441468.1_1 Reverse -201 -208 6.0373 0.223
NP_441020.2_6 Forward -211 -194 7.02034 0.245
NP_441673.1_1 Forward -209 -200 1.27803 0.155
NP_441673.1_1 Reverse -200 -209 1.27803 0.155
NP_441673.1_1 Forward -125 -116 -7.76842 0.168
NP_441673.1_1 Reverse -388 -397 -7.86675 0.187
NP_441673.1_1 Forward -397 -388 -7.96508 0.206
NP_441673.1_1 Reverse -116 -125 -8.06341 0.254
NP_441826.1_2 Reverse -278 -292 0.687908 0.177
NP_442490.1_9 Forward -221 -202 -0.295539 0.179
NP_441764.1_4 Forward -55 -38 16.5706 0.0836
NP_442868.1_6 Reverse -114 -124 6.66654 0.103
NP_442719.1_2 Forward -338 -320 -2.14486 0.184
NP_441251.1_8 Forward -35 -22 11.7118 0.27
NP_442227.1_2 Forward -336 -317 -1.96717 0.269
NP_442361.1_3 Forward -215 -202 8.27909 0.285
NP_442427.1_8 Forward -366 -347 5.01433 0.284
NP_442808.1_1 Reverse -199 -209 8.63269 0.0481
NP_442808.1_1 Forward -330 -320 3.12618 0.248
NP_442808.1_1 Reverse -114 -124 1.35624 0.287
NP_442775.1_4 Forward -193 -174 12.7825 0.263
NP_440145.1_3 Forward -99 -80 -2.45882 0.17
NP_442113.1_10 Reverse -244 -263 -9.14533 0.294
NP_442342.1_9 Reverse -198 -214 2.41848 0.29
NP_442342.1_9 Reverse -249 -265 1.92682 0.296
NP_440558.1_2 Reverse -227 -246 -3.24547 0.234
NP_440558.1_2 Forward -218 -199 -3.54046 0.236
NP_440558.1_2 Reverse -107 -126 -5.60541 0.262
NP_441878.1_6 Forward -287 -277 0.865012 0.132
NP_441878.1_6 Forward -261 -251 -7.0998 0.204
NP_441878.1_6 Forward -125 -115 -7.88644 0.278
NP_441036.1_8 Forward -210 -200 12.7631 0.0678
NP_441036.1_8 Reverse -199 -209 8.1415 0.176
NP_441557.1_5 Forward -209 -200 8.94785 0.0289
NP_441557.1_5 Reverse -200 -209 0.688044 0.128
NP_441445.1_1 Forward -296 -277 -0.688862 0.3
NP_442066.2_4 Reverse -265 -284 -2.45882 0.211
NP_441433.1_8 Forward -265 -246 -0.590531 0.248
NP_442777.1_1 Forward -328 -309 6.1935 0.268
NP_442419.1_2 Reverse -195 -214 3.73603 0.195
NP_441458.1_8 Reverse -15 -34 22.4752 0.0189
NP_442830.1_1 Forward -315 -296 14.1591 0.267
NP_442830.1_5 Forward -330 -316 -1.67261 0.299
NP_442183.1_1 Reverse -200 -214 5.50613 0.215
NP_442183.1_1 Forward -209 -195 4.91614 0.239
NP_441574.1_1 Forward -209 -190 5.89931 0.12
NP_441549.1_9 Forward -244 -226 -7.15901 0.206
NP_442347.1_2 Reverse -201 -210 10.9145 0.0571
NP_442645.1_2 Forward -97 -78 -22.125 0.29
NP_440547.1_1 Forward -334 -315 8.75009 0.256
NP_442508.1_2 Reverse -336 -355 3.04771 0.145
NP_442317.1_6 Reverse -324 -343 9.24257 0.211
NP_441633.1_3 Forward -211 -198 -6.17557 0.238
NP_440136.1_2 Forward -208 -201 6.23397 0.171
NP_440136.1_2 Reverse -201 -208 6.13563 0.193
NP_442998.1_10 Reverse -202 -209 15.5754 0.0102
NP_440899.1_1 Reverse -326 -345 8.01708 0.243
NP_440299.1_1 Forward -213 -200 16.4399 0.0101
NP_441799.1_1 Reverse -196 -210 4.71887 0.238
NP_442334.1_2 Reverse -274 -291 -5.27103 0.2
NP_442333.2_5 Reverse -378 -397 -15.6352 0.299
NP_440256.1_1 Reverse -52 -71 -7.67036 0.243
NP_440709.1_1 Reverse -34 -53 16.9115 0.0302
NP_442007.1_8 Reverse -178 -196 10.7364 0.258
NP_440456.1_7 Forward -256 -242 12.3893 0.281
NP_441559.1_8 Reverse -226 -240 10.521 0.059
NP_441559.1_8 Reverse -110 -124 7.27608 0.0737
NP_441559.1_8 Forward -245 -231 1.96621 0.151
NP_441559.1_8 Forward -380 -366 -0.295402 0.175
NP_441559.1_8 Reverse -111 -125 -3.24533 0.199
NP_441559.1_8 Forward -333 -319 -3.44199 0.203
NP_441559.1_8 Forward -244 -230 -5.90027 0.271
NP_440915.1_6 Forward -264 -250 1.67122 0.132
NP_441866.1_4 Reverse -20 -33 12.8558 0.28
NP_442866.1_1 Reverse -195 -214 -8.55534 0.282
NP_441464.1_8 Reverse -329 -343 6.09611 0.247
NP_441199.1_7 Forward -56 -37 17.2074 0.11
NP_442386.1_9 Reverse -199 -208 6.9808 0.219
NP_442386.1_9 Forward -210 -201 5.9975 0.23
NP_441750.1_7 Forward -260 -250 14.3364 0.254
NP_441340.1_5 Forward -208 -201 6.23397 0.132
NP_441340.1_5 Reverse -201 -208 5.84064 0.208
NP_442240.1_2 Reverse -201 -220 -16.8151 0.249
NP_440586.1_8 Forward -208 -201 14.69 0.026
NP_442251.1_6 Reverse -201 -208 12.0355 0.0627
NP_441262.1_3 Forward -209 -202 14.7888 0.0223
NP_443051.1_1 Forward -210 -201 0.884706 0.125
NP_439937.1_8 Forward -211 -192 -2.85214 0.262
NP_439937.1_9 Forward -241 -224 -10.1882 0.224
NP_439937.1_9 Forward -287 -270 -11.1715 0.245
NP_441167.1_1 Forward -56 -37 12.5858 0.109
NP_440408.1_7 Reverse -179 -198 10.9142 0.239
NP_440439.1_1 Forward -212 -199 6.80412 0.0722
NP_440439.1_1 Forward -243 -230 0.805932 0.175
NP_440439.1_1 Reverse -197 -210 -0.177378 0.209
NP_440372.1_2 Forward -208 -201 6.82395 0.0854
NP_440372.1_2 Reverse -201 -208 6.52896 0.188
NP_441138.1_5 Reverse -11 -24 3.02202 0.297
NP_440316.1_10 Forward -261 -251 16.598 0.153
NP_441803.1_2 Forward -214 -195 7.57094 0.134
NP_440139.1_1 Reverse -194 -213 1.86696 0.245
NP_442384.1_10 Reverse -200 -213 5.72248 0.121
NP_441877.1_7 Reverse -195 -214 4.62021 0.218
NP_441877.1_9 Forward -55 -38 4.3654 0.284
NP_440476.1_2 Reverse -23 -42 20.3531 0.217
NP_442572.1_3 Forward -244 -226 20.942 0.191
NP_441018.1_3 Forward -142 -123 9.83173 0.291
NP_442790.1_4 Reverse -275 -294 -5.60541 0.144
NP_442262.1_10 Forward -208 -201 12.9205 0.0422
NP_441689.1_5 Reverse -53 -63 5.48612 0.251
NP_440163.1_10 Forward -212 -202 16.303 0.0762
NP_440344.1_10 Forward -216 -199 -8.51595 0.129
NP_440282.1_10 Forward -198 -179 -2.65548 0.232
NP_442123.1_3 Forward -209 -190 10.8159 0.269
NP_442123.1_3 Forward -205 -186 10.1275 0.294
NP_441335.1_8 Reverse -355 -374 6.29264 0.287
NP_442693.1_8 Reverse -190 -209 17.4032 0.167
NP_440297.1_9 Reverse -201 -211 -0.511621 0.289
NP_440298.1_5 Reverse -339 -358 13.5691 0.287
NP_441592.1_4 Reverse -293 -312 0.491109 0.23
NP_440888.1_2 Reverse -116 -130 13.6669 0.026
NP_440888.1_2 Forward -397 -383 13.077 0.0339
NP_440792.1_5 Forward -208 -189 6.39097 0.237
NP_442948.1_2 Forward -210 -191 12.4875 0.121
NP_442033.1_10 Forward -286 -267 -9.047 0.211
NP_441543.1_2 Forward -208 -199 13.5694 0.0248
NP_441543.1_2 Reverse -201 -210 8.65285 0.0968
NP_441551.1_5 Reverse -196 -212 9.98926 0.2
NP_441319.1_8 Forward -215 -197 6.70565 0.27
NP_441469.1_8 Forward -210 -201 6.39124 0.227
NP_442578.1_5 Forward -330 -311 2.0644 0.257
NP_442578.1_7 Forward -208 -201 14.6904 0.026
NP_442286.1_1 Forward -338 -319 12.8808 0.139
NP_441462.1_2 Forward -209 -199 1.25834 0.0964
NP_441621.1_7 Reverse -198 -212 -1.77037 0.187
NP_441621.1_7 Reverse -282 -296 -5.70361 0.26
NP_443062.1_1 Reverse -200 -218 14.8839 0.0427
NP_442204.1_1 Forward -213 -202 9.69511 0.0736
NP_442204.1_1 Reverse -129 -140 2.32028 0.266
NP_442204.1_1 Forward -264 -253 0.353664 0.281
NP_442780.1_3 Reverse -13 -32 8.92807 0.249
NP_440516.1_6 Forward -329 -315 7.96378 0.258
NP_440516.1_8 Forward -209 -200 0.983037 0.13
NP_440516.1_8 Forward -260 -251 -0.196935 0.185
NP_442428.1_5 Forward -208 -201 6.13563 0.209
NP_442428.1_5 Reverse -201 -208 6.0373 0.212
NP_441443.1_7 Reverse -317 -336 -2.95047 0.281
NP_442120.1_10 Reverse -140 -159 1.17943 0.156
NP_442120.1_10 Reverse -329 -348 -0.4922 0.167
NP_440673.1_3 Reverse -202 -209 12.4288 0.0426
NP_440673.1_7 Forward -393 -374 1.96607 0.235
NP_442219.1_9 Reverse -117 -126 2.35967 0.28
NP_440436.1_4 Reverse -201 -210 8.55409 0.0997
NP_440436.1_4 Forward -208 -199 7.37413 0.132
NP_441884.1_8 Forward -210 -191 -7.96535 0.255
NP_441884.1_9 Reverse -281 -300 -21.24 0.235
NP_441719.1_4 Forward -208 -201 13.5105 0.026
NP_441719.1_4 Reverse -201 -208 6.52896 0.188
NP_441733.1_7 Forward -390 -377 19.3905 0.285
NP_441733.1_10 Forward -212 -199 6.21414 0.199
NP_441004.1_1 Forward -130 -111 -13.8652 0.262
NP_441004.1_1 Forward -315 -296 -14.5535 0.268
NP_441004.1_1 Forward -258 -239 -15.4385 0.275
NP_441004.1_2 Forward -263 -244 -4.81876 0.297
NP_442366.1_3 Reverse -199 -217 13.4905 0.0257
NP_442366.1_3 Forward -65 -47 -4.99573 0.28
NP_439949.1_7 Reverse -135 -149 10.1277 0.293
NP_441115.1_4 Reverse -283 -301 7.49153 0.286
NP_442694.1_3 Forward -259 -241 -3.81576 0.265
NP_443054.1_2 Reverse -229 -243 0.196253 0.274
NP_441851.1_10 Forward -210 -200 13.2547 0.0333
NP_442622.1_1 Forward -210 -191 -2.55715 0.177
NP_441542.1_4 Reverse -237 -251 5.21113 0.264
NP_442515.1_1 Reverse -328 -342 -0.590395 0.228
NP_441046.1_2 Reverse -318 -337 -1.27885 0.288
NP_442689.1_8 Reverse -10 -27 -3.99273 0.26
NP_440940.1_7 Forward -219 -201 4.34495 0.256
NP_441349.1_10 Forward -135 -116 -9.63698 0.297
NP_441062.1_10 Reverse -257 -276 7.66927 0.245
NP_440474.1_8 Reverse -330 -344 6.19383 0.23
NP_440726.1_8 Reverse -191 -210 11.8975 0.214
NP_440431.1_4 Forward -29 -10 -2.53096 0.224
NP_442450.1_5 Forward -211 -201 6.07655 0.204
NP_440588.1_2 Forward -269 -250 -3.14714 0.179
NP_440588.1_2 Forward -218 -199 -3.83545 0.197
NP_440040.1_8 Forward -43 -24 8.83258 0.203
NP_442335.1_7 Forward -285 -271 14.7486 0.204
NP_442006.1_2 Forward -187 -170 -17.7591 0.282
NP_442006.1_2 Reverse -347 -364 -17.9557 0.285
NP_441003.1_9 Reverse -248 -267 4.62101 0.277
NP_440078.1_2 Forward -314 -295 16.3224 0.185
NP_440078.1_3 Forward -224 -205 26.5488 0.00293
NP_440078.1_4 Forward -271 -252 24.4839 0.0167
NP_440078.1_6 Forward -394 -375 32.1537 0.00014
NP_440078.1_7 Forward -163 -144 32.7437 0.000054
NP_440078.1_8 Forward -250 -231 33.3337 0.00005
NP_440078.1_10 Forward -124 -105 24.6805 0.0152
NP_441078.1_4 Reverse -200 -209 0.0980582 0.205
NP_441078.1_4 Forward -209 -200 0.0980582 0.205
NP_441078.1_4 Reverse -231 -240 -1.47524 0.266
NP_441078.1_4 Reverse -116 -125 -1.96689 0.282
NP_442729.1_5 Forward -261 -251 13.2547 0.231
NP_442388.1_3 Reverse -228 -247 11.7008 0.209
NP_441663.1_7 Forward -212 -193 6.19431 0.228
NP_442443.1_1 Reverse -236 -255 -6.1954 0.293
NP_440526.1_3 Forward -328 -317 5.36805 0.249
NP_441432.1_8 Reverse -328 -337 5.21127 0.185
NP_441432.1_9 Reverse -13 -26 14.9006 0.14
NP_442320.1_8 Forward -215 -201 6.6861 0.0257
NP_442320.1_8 Reverse -194 -208 -4.4253 0.168
NP_441732.1_2 Forward -213 -197 -7.51295 0.0859
NP_442003.1_4 Reverse -372 -391 10.9142 0.288
NP_442815.1_2 Reverse -318 -336 2.77242 0.291
NP_442797.1_7 Forward -133 -115 3.55906 0.234
NP_440913.1_1 Reverse -194 -212 3.85406 0.288
NP_442400.1_10 Forward -24 -11 15.054 0.173
NP_442400.1_10 Forward -25 -12 9.32449 0.271
NP_442489.1_7 Reverse -200 -209 7.57121 0.057
NP_442489.1_7 Forward -209 -200 0.589713 0.17
NP_442489.1_7 Forward -240 -231 -1.86856 0.259
NP_442489.1_7 Reverse -231 -240 -1.96689 0.28
NP_441452.1_9 Forward -209 -190 15.2408 0.236
NP_440559.1_1 Forward -208 -199 5.80125 0.136
NP_441659.2_8 Reverse -251 -261 1.65166 0.233
NP_441659.2_8 Reverse -200 -210 0.0783647 0.277
NP_442913.1_10 Forward -347 -328 2.85105 0.12
NP_441040.1_9 Forward -173 -154 25.2705 0.00118
NP_439956.1_7 Forward -245 -226 7.7676 0.257
NP_440708.1_6 Reverse -202 -221 -9.93197 0.275
NP_442776.1_1 Reverse -293 -312 8.35759 0.197
NP_442776.1_1 Forward -220 -201 5.50599 0.241
NP_440545.1_3 Forward -128 -111 -3.8944 0.214
NP_440545.1_3 Reverse -196 -213 -4.87771 0.235
NP_440025.1_4 Forward -231 -212 10.8159 0.234
NP_440831.1_3 Forward -260 -241 5.02806 0.29
NP_441923.1_6 Forward -265 -251 10.7177 0.254
NP_440010.1_4 Reverse -196 -215 0.0970122 0.25
NP_440847.1_8 Forward -69 -50 11.7008 0.281
NP_441888.1_7 Forward -245 -231 8.35772 0.194
NP_440449.1_6 Reverse -152 -170 4.55984 0.296
NP_441833.1_4 Reverse -201 -208 6.52896 0.0924
NP_441833.1_4 Forward -208 -201 6.23397 0.163
NP_441329.1_1 Forward -32 -13 9.88299 0.194
NP_442699.1_8 Reverse -204 -223 -13.2752 0.297
NP_442162.1_8 Reverse -194 -213 4.12936 0.187
NP_442162.1_9 Forward -208 -201 6.62729 0.142
NP_442162.1_9 Reverse -201 -208 6.52896 0.178
NP_442796.1_10 Forward -188 -169 8.94757 0.267
NP_440671.1_4 Forward -215 -201 18.0925 0.0156
NP_440671.1_4 Forward -266 -252 6.58777 0.243
NP_442045.1_5 Forward -218 -199 -0.885524 0.276
NP_442140.1_3 Forward -208 -198 7.94484 0.124
NP_440875.1_9 Forward -395 -385 11.7788 0.152
NP_440875.1_9 Reverse -202 -212 9.05339 0.233
NP_440875.1_9 Forward -291 -281 7.78801 0.255
NP_440875.1_9 Forward -207 -197 7.59334 0.255
NP_441813.1_5 Forward -211 -201 7.45319 0.0746
NP_441813.1_5 Reverse -198 -208 -0.41329 0.242
NP_442028.1_1 Reverse -16 -29 9.99293 0.251
NP_440590.1_4 Reverse -201 -214 -4.79893 0.267
NP_440567.1_1 Reverse -201 -215 13.5693 0.0212
NP_440567.1_1 Forward -208 -194 1.17956 0.214
NP_442497.1_10 Reverse -201 -210 0.589713 0.153
NP_442497.1_10 Forward -208 -199 -1.18024 0.256
NP_440821.1_4 Forward -211 -201 9.32148 0.03
NP_440821.1_4 Reverse -198 -208 0.176696 0.198
NP_441239.1_9 Reverse -198 -210 7.70879 0.15
NP_441239.1_9 Reverse -249 -261 3.77555 0.276
NP_441239.1_9 Forward -295 -283 3.2839 0.289
NP_441009.1_4 Reverse -200 -219 19.3707 0.131
NP_441009.1_4 Forward -220 -201 9.73422 0.296
NP_440400.1_1 Reverse -242 -261 -0.29631 0.285
NP_442044.1_1 Forward -343 -324 -14.2585 0.284
NP_441017.1_8 Reverse -227 -242 10.698 0.188
NP_440354.1_7 Forward -138 -120 7.68896 0.26
NP_442809.1_6 Forward -221 -202 0.294447 0.295
NP_440546.1_4 Reverse -284 -294 7.42815 0.241
NP_439974.1_2 Forward -202 -183 27.8271 0.000349
NP_441230.1_5 Reverse -195 -214 13.6675 0.0635
NP_440675.1_3 Forward -209 -190 12.8808 0.17
NP_441656.1_6 Reverse -199 -218 9.43923 0.193
NP_440462.1_6 Forward -211 -201 12.1731 0.0371
NP_440462.1_6 Reverse -198 -208 7.64985 0.0705
NP_440462.1_6 Reverse -194 -204 3.22496 0.255
NP_442340.1_3 Forward -204 -185 -9.53865 0.275
NP_440868.1_4 Reverse -196 -208 9.77374 0.043
NP_440868.1_4 Forward -213 -201 -0.846001 0.282
NP_441474.1_1 Reverse -190 -209 5.2102 0.212
NP_441474.1_1 Reverse -283 -302 1.27698 0.247
NP_440653.1_10 Forward -220 -201 4.12936 0.252
NP_442460.1_7 Forward -221 -202 9.83255 0.112
NP_440696.1_3 Reverse -196 -214 12.2122 0.113
NP_441811.1_8 Reverse -317 -331 6.48943 0.272
NP_442837.1_3 Reverse -201 -208 12.1338 0.0702
NP_442837.1_3 Forward -208 -201 6.0373 0.25
NP_440160.1_1 Forward -57 -38 13.8831 0.169
NP_442053.1_1 Forward -397 -388 12.1928 0.0312
NP_442053.1_1 Reverse -200 -209 6.8829 0.111
NP_440505.1_3 Forward -242 -232 10.4031 0.108
NP_440505.1_3 Reverse -229 -239 7.05986 0.165
NP_440505.1_3 Forward -127 -117 5.09324 0.246
NP_440505.1_3 Forward -211 -201 4.99491 0.252
NP_441959.1_8 Forward -33 -20 8.42007 0.295
NP_441252.1_6 Forward -255 -248 11.9372 0.25
NP_441203.1_1 Reverse -201 -220 -11.8986 0.139
NP_442532.1_7 Forward -209 -195 3.53951 0.195
NP_441011.1_8 Forward -208 -199 8.55452 0.144
NP_441011.1_8 Reverse -201 -210 7.07956 0.179
NP_442533.1_1 Forward -302 -283 -16.4218 0.268
NP_442533.1_6 Forward -209 -200 5.40793 0.14
NP_442533.1_6 Reverse -115 -124 4.42462 0.179
NP_442533.1_6 Forward -397 -388 2.26134 0.266
NP_442541.1_10 Reverse -80 -94 1.76896 0.279
NP_440854.1_2 Reverse -319 -338 8.25926 0.278
NP_441482.1_7 Forward -215 -201 0.294584 0.0586
NP_441697.1_5 Forward -34 -15 -9.97933 0.278
NP_441028.1_6 Forward -326 -316 5.78111 0.243
NP_441527.1_4 Forward -42 -23 -6.54162 0.221
NP_441527.1_4 Forward -49 -30 -10.6478 0.272
NP_441527.1_4 Forward -34 -15 -12.1756 0.285
NP_440007.1_9 Forward -158 -144 5.50613 0.254
NP_440007.1_10 Reverse -249 -268 14.5516 0.248
NP_439965.1_1 Forward -218 -199 -5.21209 0.205
NP_441972.1_5 Forward -396 -377 -7.76869 0.252
NP_441106.1_1 Forward -210 -201 8.45619 0.0548
NP_441106.1_1 Reverse -199 -208 7.66954 0.0776
NP_440429.1_4 Forward -243 -224 14.0608 0.25
NP_442674.1_2 Forward -370 -351 17.8957 0.126
NP_440886.1_7 Reverse -283 -293 10.4026 0.0805
NP_440886.1_7 Reverse -250 -260 5.48612 0.181
NP_442614.1_2 Forward -125 -111 7.27608 0.275
NP_440404.1_9 Forward -37 -18 9.11906 0.239
NP_442072.1_9 Forward -398 -380 -22.2037 0.225
NP_439899.1_1 Forward -56 -38 3.6033 0.295
NP_441427.1_6 Forward -290 -272 8.86894 0.277
NP_441753.1_10 Reverse -191 -210 16.3224 0.0654
NP_441808.1_8 Forward -194 -175 8.55425 0.26
NP_440907.2_8 Forward -208 -198 11.3859 0.0902
NP_442264.1_9 Reverse -288 -302 17.5018 0.254
NP_441021.1_8 Forward -214 -196 6.50899 0.205
NP_440176.1_9 Reverse -160 -179 19.469 0.0675
NP_441463.1_2 Forward -58 -40 8.44388 0.14
NP_441463.1_3 Reverse -190 -209 2.75272 0.112
NP_441463.1_3 Forward -348 -329 -7.08038 0.254
NP_441626.1_2 Forward -208 -201 6.13563 0.177
NP_441626.1_2 Reverse -201 -208 5.93897 0.231
NP_442211.1_10 Reverse -22 -41 12.29 0.231
NP_441962.1_4 Reverse -207 -226 -11.7019 0.244
NP_441962.1_4 Forward -298 -279 -14.6519 0.291
NP_441962.1_5 Reverse -247 -266 8.16093 0.234
NP_440387.1_1 Forward -209 -193 5.36841 0.0325
NP_440387.1_1 Reverse -200 -216 -5.64466 0.243
NP_441431.1_1 Reverse -14 -32 4.29912 0.265
NP_441174.1_2 Forward -212 -198 12.4876 0.248
NP_441174.1_6 Reverse -224 -236 19.1152 0.236
NP_440114.1_10 Forward -240 -226 6.88276 0.253
NP_440293.1_3 Forward -131 -112 -6.29373 0.288
NP_440766.1_4 Forward -213 -199 12.0943 0.0573
NP_440766.1_4 Reverse -384 -398 0.294584 0.291
NP_440422.1_10 Forward -62 -43 8.08077 0.215
NP_442743.1_5 Reverse -201 -220 9.53756 0.148
NP_442930.1_1 Forward -27 -17 11.7793 0.257
NP_442930.1_1 Reverse -26 -36 10.501 0.276
NP_440458.1_5 Reverse -143 -162 4.71934 0.218
NP_439910.1_2 Reverse -192 -209 -21.4956 0.183
NP_440457.1_1 Forward -213 -201 8.00379 0.101
NP_440457.1_1 Forward -264 -252 6.82381 0.11
NP_440798.1_2 Reverse -248 -262 20.5501 0.111
NP_440801.1_10 Forward -213 -194 6.68596 0.288
NP_441332.1_6 Reverse -122 -132 12.034 0.236
NP_441332.1_6 Reverse -250 -260 10.8723 0.282
NP_441436.1_8 Forward -126 -107 8.25926 0.283
NP_440473.1_9 Reverse -189 -208 1.0811 0.114
NP_442509.1_9 Forward -125 -115 5.97777 0.298
NP_440524.1_2 Reverse -372 -391 -3.93378 0.271
NP_440554.1_4 Forward -208 -198 6.27322 0.123
NP_440554.1_4 Reverse -201 -211 4.99491 0.167
NP_441885.1_5 Forward -209 -199 0.766681 0.123
NP_441885.1_5 Reverse -116 -126 -0.41329 0.197
NP_442341.1_7 Reverse -199 -213 9.73436 0.0722
NP_442341.1_9 Reverse -113 -127 7.47213 0.198
NP_441756.1_5 Reverse -112 -131 10.0292 0.117
NP_441756.1_5 Forward -399 -380 -1.57384 0.258
NP_441756.1_5 Reverse -111 -130 -4.72043 0.295
NP_442395.2_4 Reverse -122 -141 10.2251 0.101
NP_442395.2_4 Reverse -199 -218 1.96529 0.229
NP_440552.1_8 Reverse -38 -55 21.7288 0.0101
NP_440275.1_3 Forward -123 -113 3.61828 0.219
NP_440091.1_1 Reverse -196 -208 10.5604 0.0458
NP_442275.1_1 Reverse -231 -250 10.3242 0.229
NP_442275.1_1 Reverse -356 -375 -0.197208 0.295
NP_440616.1_2 Forward -37 -18 19.2723 0.185
NP_441207.1_7 Forward -36 -22 11.5789 0.241
NP_440258.1_7 Reverse -14 -33 12.9387 0.287
NP_439962.1_4 Reverse -115 -134 -1.7705 0.22
NP_439962.1_4 Forward -140 -121 -5.60541 0.28
NP_442495.1_4 Reverse -108 -118 11.9764 0.251
NP_440216.1_1 Reverse -116 -130 -9.83351 0.145
NP_440216.1_1 Forward -125 -111 -11.2101 0.169
NP_441844.1_2 Reverse -181 -200 13.0775 0.211
NP_442015.1_10 Forward -213 -200 -0.177378 0.255
NP_440198.1_3 Reverse -246 -265 13.6666 0.277
NP_441111.1_7 Reverse -201 -209 8.86921 0.0589
NP_441766.1_2 Forward -209 -200 8.1612 0.0645
NP_442507.1_4 Forward -396 -377 18.3873 0.114
NP_442417.1_5 Reverse -123 -137 5.70279 0.252
NP_440416.1_9 Forward -216 -197 -6.68705 0.0929
NP_440416.1_9 Forward -132 -113 -20.1584 0.282
NP_443052.1_8 Reverse -190 -209 -0.39387 0.0693
NP_443052.1_9 Reverse -118 -137 -7.08038 0.293
NP_440591.1_9 Reverse -277 -295 4.44404 0.279
NP_442154.1_1 Forward -208 -190 -17.2871 0.251
NP_440261.1_5 Forward -124 -111 -12.0754 0.27
NP_440988.1_10 Reverse -204 -218 9.54584 0.202
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCGCCGTGCGCCTCTGGAGTGCCAGCAGTTTGCCTAACATTGCCAAATTGGCCTACGAAGATGTTATTGCCACCATTCCCCCGTTGATTGAGGGACTGAGGCGGGACAAGATGGCCGCTGTCCGCAGTAATTGTGCCTGGGCGGTGGGGCAACTATGCCGGGAATTGCCTTCCAATGTGGTCTATGCCACGGCGATCGATGCCTTGCTGGAAGCCCTAGTGGAAGATGAAGATTTTGGCGTCAAGGAAGATGCCAAATCCGCCCTACTGCGACTGGGGGACGCCCGGGGACTACAGATGATTGAAGACCTGGAAATGGACGGACTGATCTAATACGTCGATTGGTTTGTAAAGATATGTAAAGGGAAATAATTAAAAATTAACTAAAAATCAACACACC

CDS

ATGGCACAACCTTTGATTTTGGGGGTCAGCGGTGCCTCTGGGCTAATTTATGCCGTCAGAGCCATCAAGCATTTACTGGCGGCGGATTACACCATCGAACTGGTGGCTTCCCGAGCCAGCTACCAAGTTTGGCAAGCGGAACAAAATATTCAAATGCCAGGGGAACCCTCCGCCCAGGCAGAATTTTGGCGCTCTCAGGCTGGGGTAGAAAAGGGTGGCAAATTGATTTGTCACCGTTGGGGAGATGTGGGGGCCACCATTGCCAGTGGTTCCTACCGTTGCGCCGGCATGGTGGTGCTGCCCTGTAGCATGAGCACCGTGGCTAAATTGGCGGTGGGCATGAGTTCCGATCTATTGGAGCGGGCGGCGGATGTGCAAATCAAAGAAGGTAAACCCTTGGTGGTGGTGCCCAGGGAAACGCCCTTAAGTTTGATCCATCTGCGCAATCTCACTAGTTTGGCCGAGGCTGGAGTCCGCATTGTGCCCGCCATTCCCGCTTGGTATCATCAGCCCCAATCGGTGGAAGATTTAGTGGATTTTGTGGTGGCTAGGGCCTTGGATCAATTGGCGATCGACTGTGTGCCCCTCCAGCGTTGGCAAGGGGGTATGGAAGGGGAGTGA

Protein

MAQPLILGVSGASGLIYAVRAIKHLLAADYTIELVASRASYQVWQAEQNIQMPGEPSAQAEFWRSQAGVEKGGKLICHRWGDVGATIASGSYRCAGMVVLPCSMSTVAKLAVGMSSDLLERAADVQIKEGKPLVVVPRETPLSLIHLRNLTSLAEAGVRIVPAIPAWYHQPQSVEDLVDFVVARALDQLAIDCVPLQRWQGGMEGE