Your browser is old and dusty. Try Google Chrome!

Details for slr1090

ORF slr1090
Accession NP_440268.1
Symbol
Category GTP-binding protein
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -105 -119 4.12949 0.155
NP_441061.1_2 Forward -101 -87 -1.47537 0.262
NP_440795.1_7 Reverse -100 -107 7.31561 0.259
NP_441418.1_6 Reverse -254 -273 -20.2567 0.108
NP_440815.1_5 Reverse -344 -363 3.93269 0.286
NP_441453.1_4 Forward -279 -271 3.85433 0.284
NP_441453.1_4 Forward -172 -164 3.36267 0.293
NP_441453.1_7 Forward -256 -249 12.9205 0.23
NP_442151.1_6 Reverse -110 -124 12.1926 0.0792
NP_441818.1_9 Reverse -276 -295 -10.6203 0.296
NP_440150.1_2 Reverse -106 -125 10.815 0.201
NP_442752.1_4 Reverse -318 -325 10.8555 0.0846
NP_442909.1_7 Reverse -319 -333 6.48882 0.252
NP_440061.1_9 Forward -109 -95 6.19383 0.255
NP_440631.1_9 Reverse -207 -226 13.4344 0.262
NP_440878.1_9 Reverse -100 -119 -2.16383 0.258
NP_442062.1_8 Forward -251 -241 3.91327 0.243
NP_442062.1_8 Forward -397 -387 3.42162 0.272
NP_442062.1_8 Reverse -110 -120 2.83163 0.293
NP_440304.1_4 Reverse -147 -157 3.71661 0.293
NP_441581.1_9 Reverse -195 -214 5.96782 0.296
NP_441210.1_3 Forward -128 -109 14.0608 0.259
NP_440307.1_10 Forward -40 -21 12.3892 0.266
NP_440518.1_9 Reverse -351 -370 10.9142 0.293
NP_441925.1_4 Forward -106 -87 -9.24438 0.216
NP_440769.1_8 Forward -51 -32 9.3409 0.214
NP_441083.1_5 Forward -327 -317 8.23984 0.0429
NP_441083.1_5 Reverse -318 -328 5.78156 0.104
NP_441083.1_5 Reverse -110 -120 -0.609952 0.272
NP_441434.1_1 Reverse -35 -49 10.0383 0.233
NP_441434.1_6 Reverse -252 -262 17.4829 0.243
NP_441738.1_2 Reverse -244 -251 8.29857 0.176
NP_442889.1_1 Reverse -368 -387 -14.6519 0.279
NP_441327.1_1 Reverse -209 -228 10.6527 0.191
NP_441327.1_1 Forward -228 -209 3.34839 0.277
NP_441163.1_1 Reverse -262 -279 7.60959 0.241
NP_440438.2_8 Forward -193 -174 5.01433 0.206
NP_440747.1_10 Forward -122 -110 -4.48425 0.101
NP_440747.1_10 Reverse -107 -119 -4.77924 0.117
NP_441486.1_1 Forward -356 -342 -4.22864 0.192
NP_441486.1_1 Forward -330 -316 -4.81863 0.209
NP_441486.1_1 Reverse -267 -281 -5.90027 0.266
NP_441486.1_1 Reverse -107 -121 -6.29359 0.288
NP_440944.1_2 Forward -170 -151 4.81767 0.199
NP_440057.1_6 Reverse -198 -217 15.0091 0.261
NP_441012.1_4 Reverse -229 -242 12.114 0.249
NP_443018.1_3 Reverse -111 -118 10.7572 0.0907
NP_443018.1_3 Forward -396 -389 6.62729 0.168
NP_443018.1_3 Forward -118 -111 4.56234 0.241
NP_443018.1_3 Reverse -271 -278 4.26735 0.267
NP_443018.1_3 Forward -278 -271 4.07068 0.299
NP_441588.1_4 Forward -325 -315 6.17489 0.206
NP_441588.1_4 Forward -351 -341 6.07655 0.214
NP_442687.1_7 Forward -280 -270 5.87989 0.183
NP_441846.1_10 Reverse -86 -105 -23.2067 0.279
NP_441013.1_2 Forward -364 -346 4.44404 0.226
NP_442658.1_1 Reverse -268 -278 10.5993 0.114
NP_440141.1_8 Forward -353 -334 5.11266 0.278
NP_442782.1_2 Reverse -295 -309 1.17956 0.282
NP_441414.1_9 Reverse -318 -337 -10.0303 0.275
NP_440184.1_1 Forward -192 -173 2.30194 0.258
NP_440184.1_1 Reverse -206 -225 1.2492 0.28
NP_442937.1_5 Forward -124 -105 6.88262 0.268
NP_441958.1_5 Reverse -269 -279 -0.216628 0.186
NP_440950.1_3 Forward -191 -172 15.4385 0.267
NP_440203.1_5 Reverse -113 -123 14.2375 0.0886
NP_440203.1_5 Reverse -245 -255 11.1893 0.202
NP_443001.1_7 Forward -396 -377 2.55606 0.279
NP_440984.1_7 Forward -332 -318 7.76774 0.163
NP_439990.1_5 Forward -256 -243 7.19745 0.207
NP_442690.1_1 Forward -230 -211 -7.27704 0.174
NP_442690.1_1 Reverse -20 -39 -8.94866 0.19
NP_442690.1_1 Forward -218 -199 -13.9635 0.268
NP_440153.1_8 Forward -279 -266 2.87088 0.21
NP_442064.1_4 Forward -273 -254 5.99684 0.258
NP_440602.1_4 Forward -250 -231 10.1275 0.165
NP_440138.1_6 Forward -319 -300 2.45694 0.267
NP_441129.1_6 Forward -109 -90 -2.26216 0.251
NP_441646.1_1 Reverse -97 -116 9.0459 0.137
NP_442438.1_10 Reverse -87 -101 0.687908 0.218
NP_440147.1_4 Reverse -386 -399 3.36254 0.188
NP_441125.1_9 Reverse -154 -173 19.0748 0.124
NP_441175.1_2 Reverse -312 -331 8.35759 0.226
NP_441916.1_7 Reverse -270 -280 2.53664 0.25
NP_441041.1_4 Forward -384 -365 -12.4886 0.266
NP_441041.1_9 Forward -47 -33 19.2718 0.164
NP_442004.1_6 Reverse -306 -320 2.16287 0.273
NP_441725.1_5 Forward -278 -268 -0.609952 0.265
NP_442941.1_3 Forward -326 -316 -1.00328 0.282
NP_441079.1_7 Reverse -209 -228 -5.40949 0.266
NP_442575.1_8 Reverse -283 -302 -0.000545616 0.232
NP_001035871.2_2 Forward -143 -124 17.5506 0.268
NP_442500.1_8 Reverse -208 -222 19.2406 0.103
NP_442012.1_5 Reverse -92 -111 -0.197208 0.288
NP_441644.1_6 Reverse -110 -120 9.02601 0.0872
NP_441644.1_6 Forward -279 -269 7.25606 0.132
NP_441644.1_6 Forward -327 -317 4.69947 0.228
NP_442215.1_2 Reverse -108 -124 4.58176 0.0832
NP_442215.1_2 Reverse -303 -319 0.156866 0.156
NP_442029.1_1 Reverse -258 -277 -2.75381 0.188
NP_442029.1_6 Reverse -105 -124 13.5691 0.137
NP_442029.1_6 Reverse -313 -332 5.80098 0.248
NP_440780.1_1 Reverse -207 -226 7.78217 0.274
NP_442933.1_10 Reverse -270 -279 4.81794 0.212
NP_442933.1_10 Forward -279 -270 4.12963 0.28
NP_440576.1_2 Forward -228 -209 5.89931 0.299
NP_440382.1_2 Reverse -35 -54 8.4551 0.214
NP_441751.2_8 Reverse -376 -390 -4.32697 0.17
NP_442554.1_8 Reverse -111 -121 4.99491 0.163
NP_442554.1_8 Forward -278 -268 3.61828 0.218
NP_442554.1_8 Reverse -105 -115 2.63497 0.265
NP_442554.1_8 Reverse -93 -103 1.74999 0.298
NP_442970.1_3 Forward -227 -209 12.2074 0.251
NP_442142.1_4 Reverse -107 -120 11.1301 0.062
NP_442292.1_1 Reverse -111 -120 5.70292 0.135
NP_442292.1_1 Reverse -105 -114 3.93297 0.189
NP_442292.1_1 Forward -326 -317 -0.68859 0.268
NP_440919.1_7 Reverse -152 -170 6.3186 0.261
NP_441024.1_5 Forward -175 -156 14.6499 0.286
NP_442016.1_10 Forward -360 -341 11.8975 0.259
NP_443009.1_5 Reverse -269 -280 4.38475 0.249
NP_441726.1_2 Reverse -303 -322 16.9124 0.182
NP_441715.1_4 Forward -381 -371 4.60159 0.261
NP_441198.1_5 Forward -325 -312 11.3267 0.288
NP_441468.1_1 Reverse -271 -278 4.07068 0.263
NP_441468.1_1 Forward -118 -111 4.07068 0.263
NP_441096.1_5 Reverse -368 -386 14.8663 0.297
NP_441172.1_8 Forward -385 -371 20.7474 0.131
NP_443004.2_2 Reverse -18 -37 19.453 0.132
NP_441251.1_7 Forward -223 -210 12.6056 0.266
NP_441056.1_1 Reverse -104 -123 -9.44032 0.3
NP_441612.1_2 Forward -143 -133 11.5505 0.21
NP_442227.1_2 Forward -106 -87 -3.24547 0.29
NP_441911.1_7 Reverse -209 -228 -10.031 0.201
NP_442808.1_1 Forward -328 -318 7.0594 0.0892
NP_442718.1_8 Reverse -204 -223 14.728 0.278
NP_442542.1_2 Reverse -268 -281 5.82081 0.247
NP_442903.1_2 Forward -185 -166 5.68135 0.195
NP_441114.1_3 Reverse -112 -121 7.37455 0.239
NP_440558.1_2 Reverse -95 -114 4.12936 0.152
NP_440558.1_2 Reverse -107 -126 -3.93378 0.239
NP_441878.1_6 Reverse -269 -279 1.65166 0.0795
NP_441878.1_6 Forward -280 -270 -0.314959 0.174
NP_441878.1_6 Forward -120 -110 -7.49312 0.231
NP_441557.1_5 Reverse -270 -279 -0.786921 0.239
NP_441445.1_1 Reverse -261 -280 1.47442 0.255
NP_441590.1_4 Forward -319 -300 3.53858 0.29
NP_442777.1_3 Forward -306 -288 1.98502 0.289
NP_440101.1_3 Reverse -99 -118 0.392778 0.299
NP_441116.1_9 Reverse -253 -267 15.2409 0.194
NP_441819.1_5 Forward -229 -210 9.40553 0.27
NP_442347.1_2 Forward -326 -317 3.34298 0.284
NP_442645.1_2 Reverse -102 -121 -18.4868 0.274
NP_441037.1_4 Reverse -268 -278 6.44058 0.263
NP_442998.1_5 Forward -348 -338 7.55152 0.289
NP_442998.1_10 Forward -325 -318 6.0373 0.205
NP_440899.1_8 Reverse -12 -31 -10.1286 0.277
NP_440299.1_6 Reverse -307 -326 6.29264 0.268
NP_440256.1_1 Forward -161 -142 -1.37718 0.103
NP_440709.1_1 Forward -205 -186 4.03023 0.205
NP_441559.1_8 Reverse -369 -383 -5.40861 0.261
NP_441559.1_8 Reverse -228 -242 -7.76856 0.299
NP_440915.1_6 Reverse -314 -328 -0.885388 0.212
NP_442158.1_4 Forward -260 -250 11.1898 0.28
NP_440748.1_5 Forward -105 -86 -1.37718 0.267
NP_440702.1_2 Reverse -258 -277 -7.37537 0.272
NP_440026.1_4 Reverse -267 -286 10.0292 0.24
NP_440787.1_5 Reverse -162 -176 11.6026 0.256
NP_442386.1_9 Forward -328 -319 10.4224 0.129
NP_442386.1_9 Forward -120 -111 8.06244 0.209
NP_442386.1_9 Reverse -109 -118 4.81753 0.282
NP_440570.1_5 Forward -129 -110 2.26107 0.234
NP_441340.1_5 Forward -278 -271 3.97235 0.274
NP_441340.1_5 Reverse -111 -118 3.97235 0.274
NP_442327.1_3 Reverse -32 -51 4.53544 0.283
NP_442484.1_2 Reverse -307 -326 -1.08219 0.284
NP_440327.1_6 Reverse -99 -118 8.25926 0.222
NP_442714.1_7 Forward -278 -259 0.884433 0.226
NP_440586.1_4 Reverse -291 -309 12.8022 0.25
NP_440586.1_8 Forward -278 -271 9.57686 0.146
NP_440586.1_8 Reverse -345 -352 5.93863 0.283
NP_442959.1_5 Reverse -363 -382 7.57094 0.231
NP_440027.1_3 Forward -279 -261 7.3932 0.211
NP_439937.1_9 Forward -280 -263 -16.4814 0.287
NP_441595.1_2 Reverse -214 -227 9.03802 0.278
NP_441167.1_1 Reverse -183 -202 5.70265 0.237
NP_439943.1_1 Reverse -122 -141 -8.45701 0.28
NP_439943.1_7 Reverse -105 -124 2.85105 0.292
NP_441138.1_5 Reverse -125 -138 10.0884 0.238
NP_440316.1_10 Forward -120 -110 7.55152 0.246
NP_440267.1_1 Reverse -42 -58 22.4474 0.0334
NP_442384.1_10 Reverse -270 -283 2.37923 0.228
NP_442339.1_3 Reverse -32 -50 22.4386 0.0594
NP_442114.1_8 Forward -140 -126 9.34041 0.234
NP_441877.1_9 Reverse -204 -221 2.00546 0.292
NP_441018.1_7 Forward -246 -227 7.96426 0.259
NP_442262.1_10 Forward -396 -389 10.1672 0.162
NP_442262.1_10 Reverse -111 -118 9.87221 0.164
NP_440282.1_10 Forward -289 -270 8.55425 0.11
NP_442123.1_3 Reverse -270 -289 14.6508 0.135
NP_440297.1_9 Reverse -271 -281 0.471689 0.282
NP_440297.1_9 Forward -278 -268 0.0783647 0.282
NP_442187.1_3 Reverse -317 -327 14.3364 0.199
NP_441592.1_4 Forward -102 -83 -3.04881 0.274
NP_441896.1_5 Forward -204 -197 15.3787 0.268
NP_440888.1_2 Forward -327 -313 6.78381 0.22
NP_441748.1_3 Reverse -15 -34 11.8401 0.273
NP_441543.1_2 Reverse -111 -120 5.01461 0.209
NP_442845.1_2 Forward -333 -319 5.89945 0.22
NP_442845.1_2 Reverse -312 -326 4.12949 0.267
NP_441918.1_7 Reverse -109 -128 3.83436 0.265
NP_441469.1_8 Reverse -241 -250 11.8978 0.141
NP_442315.1_1 Reverse -88 -106 10.4422 0.181
NP_442315.1_3 Reverse -306 -325 7.47261 0.233
NP_442637.1_1 Forward -127 -108 -1.08219 0.16
NP_441462.1_2 Reverse -270 -280 -0.314959 0.206
NP_443062.1_1 Forward -209 -191 11.7637 0.0936
NP_443062.1_6 Reverse -262 -281 19.2723 0.0432
NP_441410.1_3 Forward -393 -374 4.03102 0.293
NP_442204.1_1 Forward -123 -112 -0.0396598 0.285
NP_440544.1_5 Reverse -125 -132 13.8024 0.28
NP_442487.1_2 Forward -277 -258 11.3067 0.101
NP_440516.1_8 Reverse -318 -327 9.14451 0.0354
NP_440516.1_8 Forward -119 -110 -0.491928 0.262
NP_442428.1_5 Reverse -271 -278 4.46401 0.267
NP_442428.1_5 Forward -118 -111 4.46401 0.267
NP_441267.1_1 Reverse -338 -357 0.884433 0.281
NP_442120.1_10 Forward -269 -250 -6.39206 0.21
NP_440673.1_3 Reverse -112 -119 8.98723 0.203
NP_441052.1_2 Reverse -110 -120 7.84651 0.0605
NP_441052.1_2 Forward -327 -317 1.25834 0.249
NP_442219.1_9 Reverse -319 -328 5.70292 0.135
NP_440436.1_4 Reverse -111 -120 11.0124 0.0655
NP_440436.1_4 Forward -278 -269 9.73406 0.0871
NP_442813.1_4 Reverse -380 -399 -7.57203 0.299
NP_442813.1_5 Reverse -99 -118 9.83255 0.148
NP_442366.1_3 Reverse -103 -121 -2.0458 0.219
NP_442366.1_5 Reverse -315 -325 15.1225 0.0375
NP_441851.1_10 Reverse -269 -279 7.45319 0.14
NP_442011.1_1 Reverse -317 -336 6.09597 0.186
NP_441668.1_4 Forward -129 -110 7.96426 0.151
NP_441668.1_4 Reverse -308 -327 1.27776 0.218
NP_441540.1_8 Forward -146 -127 20.354 0.0662
NP_441982.1_6 Reverse -214 -223 12.9628 0.274
NP_442689.1_8 Forward -226 -209 -5.36936 0.271
NP_441349.1_10 Reverse -100 -119 -4.91709 0.186
NP_441394.1_10 Forward -306 -288 10.1465 0.263
NP_442314.1_3 Forward -123 -109 11.996 0.277
NP_441124.1_5 Forward -221 -211 13.3901 0.215
NP_440431.1_3 Reverse -109 -128 -6.1954 0.188
NP_440431.1_3 Reverse -208 -227 -8.06369 0.224
NP_442450.1_3 Forward -138 -120 16.1446 0.107
NP_442168.1_5 Forward -118 -99 -1.96717 0.264
NP_440588.1_2 Reverse -101 -120 -6.09707 0.269
NP_440588.1_3 Reverse -259 -278 9.83255 0.263
NP_441975.1_5 Reverse -203 -222 15.5543 0.184
NP_440078.1_8 Reverse -353 -372 0.392778 0.296
NP_441078.1_4 Forward -119 -110 -1.57357 0.266
NP_442729.1_7 Forward -253 -235 9.55725 0.276
NP_441432.1_8 Forward -120 -111 15.0444 0.0182
NP_441432.1_8 Reverse -317 -326 4.42462 0.213
NP_441432.1_9 Forward -222 -209 8.79228 0.287
NP_441432.1_9 Forward -46 -33 8.40445 0.289
NP_442320.1_5 Reverse -385 -399 18.9775 0.291
NP_441732.1_2 Reverse -250 -266 -17.2477 0.247
NP_441072.1_2 Reverse -259 -278 6.39097 0.28
NP_442400.1_10 Forward -28 -15 14.3856 0.173
NP_442400.1_10 Reverse -210 -223 7.89211 0.281
NP_442489.1_2 Forward -124 -105 3.73603 0.234
NP_442489.1_7 Reverse -270 -279 -1.47524 0.203
NP_442489.1_7 Forward -119 -110 -1.57357 0.213
NP_442489.1_7 Reverse -110 -119 -2.06522 0.288
NP_440559.1_1 Reverse -271 -280 4.42462 0.277
NP_441659.2_8 Forward -279 -269 11.6814 0.016
NP_441659.2_8 Reverse -344 -354 1.16001 0.248
NP_441800.1_3 Forward -124 -106 6.214 0.286
NP_442346.1_5 Forward -280 -270 13.2547 0.0278
NP_442346.1_5 Reverse -269 -279 6.96153 0.187
NP_442346.1_5 Forward -120 -110 4.69992 0.276
NP_440545.1_3 Reverse -266 -283 -6.746 0.287
NP_441629.1_3 Forward -321 -302 -1.37794 0.263
NP_440459.1_2 Forward -329 -312 11.1502 0.181
NP_441653.1_2 Reverse -271 -290 3.43298 0.264
NP_442551.1_4 Reverse -96 -111 -3.46169 0.29
NP_440847.1_3 Forward -306 -292 11.897 0.254
NP_442603.1_7 Reverse -318 -332 10.422 0.126
NP_441888.1_1 Reverse -192 -211 10.1275 0.198
NP_442799.1_8 Reverse -209 -228 10.2306 0.189
NP_441895.1_2 Reverse -248 -267 -17.7001 0.234
NP_441973.1_6 Reverse -201 -219 16.8068 0.27
NP_442943.1_1 Reverse -211 -226 10.4748 0.184
NP_442199.1_7 Reverse -213 -232 13.2733 0.11
NP_442140.1_3 Forward -278 -268 8.23984 0.122
NP_442140.1_3 Forward -118 -108 3.42162 0.297
NP_442723.1_1 Forward -109 -90 1.17865 0.298
NP_442778.1_10 Reverse -122 -140 9.55725 0.259
NP_440875.1_9 Reverse -292 -302 9.44274 0.233
NP_440594.1_10 Forward -266 -252 16.2235 0.286
NP_440590.1_4 Forward -326 -313 6.70579 0.0568
NP_442497.1_10 Forward -278 -269 0.196389 0.208
NP_441239.1_9 Forward -281 -269 4.46387 0.253
NP_441727.1_3 Reverse -103 -122 2.65439 0.299
NP_440354.1_7 Forward -285 -267 15.1621 0.167
NP_441617.1_6 Reverse -45 -64 -5.11376 0.274
NP_441617.1_8 Reverse -196 -215 15.3382 0.124
NP_442052.1_8 Reverse -268 -278 12.1731 0.285
NP_440546.1_4 Forward -279 -269 9.94905 0.112
NP_440675.1_1 Reverse -302 -321 3.53937 0.251
NP_440462.1_6 Forward -399 -389 1.25834 0.297
NP_440868.1_4 Forward -331 -319 -0.0593532 0.242
NP_442499.1_1 Reverse -201 -220 2.0644 0.294
NP_441474.1_1 Forward -309 -290 7.4718 0.212
NP_442402.1_4 Forward -323 -304 10.815 0.0895
NP_441848.1_4 Forward -137 -121 7.07321 0.297
NP_441848.1_4 Reverse -211 -227 6.97771 0.3
NP_441848.1_7 Reverse -370 -389 2.9486 0.217
NP_441848.1_10 Forward -229 -216 18.9678 0.0736
NP_440653.1_10 Forward -326 -307 6.09597 0.218
NP_442358.1_9 Forward -126 -107 16.4207 0.253
NP_442039.1_4 Reverse -319 -326 8.10225 0.221
NP_442039.1_7 Forward -351 -341 6.96153 0.286
NP_441811.1_8 Reverse -264 -278 13.6676 0.178
NP_442829.1_2 Reverse -209 -225 12.4896 0.287
NP_442053.1_1 Forward -327 -318 11.1111 0.0437
NP_440505.1_3 Reverse -316 -326 4.3066 0.3
NP_441959.1_1 Reverse -198 -216 15.653 0.26
NP_442255.1_3 Forward -323 -304 7.86593 0.299
NP_440914.1_1 Forward -119 -109 13.2019 0.0378
NP_440914.1_1 Reverse -318 -328 11.5428 0.0887
NP_440914.1_1 Forward -327 -317 8.90788 0.186
NP_442533.1_6 Reverse -270 -279 4.62128 0.179
NP_441482.1_7 Reverse -143 -157 -7.57189 0.193
NP_441697.1_5 Reverse -209 -228 -2.81744 0.217
NP_441697.1_5 Reverse -120 -139 -10.7433 0.284
NP_441028.1_5 Reverse -11 -23 19.3118 0.216
NP_441028.1_6 Reverse -377 -387 3.42118 0.296
NP_442202.1_6 Reverse -210 -229 -0.885524 0.268
NP_440116.1_8 Forward -326 -307 -4.91709 0.182
NP_441527.1_4 Forward -142 -123 -5.01375 0.194
NP_441527.1_4 Forward -143 -124 -6.7326 0.224
NP_441527.1_4 Reverse -209 -228 -8.54695 0.247
NP_441527.1_4 Forward -31 -12 -9.02441 0.254
NP_441527.1_4 Reverse -207 -226 -9.2154 0.255
NP_441527.1_4 Forward -146 -127 -11.1252 0.278
NP_441527.1_4 Reverse -208 -227 -11.6027 0.284
NP_441527.1_4 Forward -140 -121 -11.7937 0.284
NP_441972.1_5 Forward -326 -307 -9.73531 0.293
NP_441106.1_1 Reverse -269 -278 3.24465 0.241
NP_440429.1_9 Reverse -344 -363 0.196116 0.297
NP_441930.1_3 Reverse -221 -240 3.92599 0.278
NP_440268.1_8 Forward -74 -55 18.289 0.179
NP_442614.1_2 Forward -384 -370 8.55439 0.255
NP_442614.1_2 Reverse -318 -332 6.58777 0.291
NP_440907.2_8 Forward -314 -304 5.78111 0.188
NP_440841.1_4 Forward -121 -102 -1.37718 0.153
NP_441463.1_2 Forward -227 -209 4.59949 0.18
NP_441463.1_6 Reverse -252 -266 15.4029 0.152
NP_442842.1_4 Forward -262 -243 4.32602 0.249
NP_442842.1_4 Reverse -121 -140 3.24438 0.265
NP_442209.1_8 Forward -321 -302 15.8307 0.172
NP_442794.1_1 Forward -123 -111 16.8536 0.0276
NP_442615.1_1 Reverse -309 -327 -5.29072 0.209
NP_441488.1_8 Reverse -313 -327 9.93039 0.146
NP_441993.1_1 Reverse -104 -123 2.1416 0.262
NP_440143.1_8 Forward -278 -259 16.8132 0.229
NP_440814.1_4 Reverse -261 -280 -13.4719 0.29
NP_442805.1_5 Forward -105 -86 -6.3928 0.284
NP_440114.1_10 Reverse -270 -284 6.78443 0.258
NP_441237.1_9 Forward -278 -268 12.8614 0.102
NP_441237.1_9 Reverse -111 -121 11.6814 0.164
NP_442743.1_5 Reverse -105 -124 5.01433 0.209
NP_441311.1_2 Forward -363 -349 13.5686 0.23
NP_442930.1_1 Reverse -208 -218 16.9908 0.19
NP_442930.1_1 Reverse -220 -230 13.0576 0.239
NP_440502.1_3 Reverse -377 -387 15.0561 0.2
NP_440457.1_1 Reverse -266 -278 0.23564 0.25
NP_440213.1_4 Forward -162 -143 15.1558 0.251
NP_442940.1_2 Reverse -318 -337 -0.787193 0.296
NP_440801.1_9 Forward -258 -244 13.0292 0.286
NP_440473.1_1 Reverse -197 -216 11.0646 0.283
NP_441489.1_3 Reverse -213 -227 13.3805 0.198
NP_442582.1_3 Forward -138 -124 15.0039 0.208
NP_442862.1_3 Forward -214 -197 16.9518 0.137
NP_442737.1_5 Forward -264 -245 12.2972 0.264
NP_441885.1_5 Reverse -318 -328 7.25653 0.0516
NP_440628.1_1 Forward -137 -127 13.1977 0.29
NP_442341.1_7 Forward -328 -314 5.99778 0.139
NP_441173.1_9 Reverse -341 -349 12.1137 0.21
NP_440750.1_5 Reverse -210 -224 14.1593 0.126
NP_440679.1_3 Forward -119 -101 6.31233 0.296
NP_442451.1_2 Reverse -234 -253 -7.57203 0.237
NP_442638.1_3 Reverse -204 -223 12.0793 0.298
NP_442686.1_9 Forward -274 -255 18.6815 0.113
NP_439962.1_4 Reverse -380 -399 -2.16383 0.224
NP_440641.1_2 Forward -181 -162 13.4708 0.0992
NP_440149.1_8 Reverse -254 -273 -6.98204 0.268
NP_442373.1_2 Reverse -299 -318 -11.8986 0.297
NP_441730.1_2 Forward -227 -209 7.29564 0.288
NP_440216.1_9 Reverse -202 -211 13.3727 0.197
NP_440216.1_9 Reverse -250 -259 6.39124 0.289
NP_440216.1_9 Reverse -112 -121 5.50626 0.292
NP_440172.1_1 Forward -119 -109 10.0098 0.0572
NP_440172.1_1 Reverse -270 -280 6.27322 0.107
NP_440172.1_1 Reverse -149 -159 3.91327 0.213
NP_440172.1_1 Forward -397 -387 2.83163 0.264
NP_442371.1_1 Forward -134 -124 13.1559 0.21
NP_442371.1_1 Reverse -216 -226 12.4676 0.249
NP_441226.1_7 Reverse -319 -326 9.77352 0.131
NP_442834.1_9 Reverse -258 -277 9.53756 0.176
NP_441766.1_2 Forward -327 -318 5.01461 0.148
NP_440416.1_9 Reverse -311 -330 -20.3551 0.284
NP_442116.1_6 Forward -227 -210 15.2354 0.136
NP_442116.1_6 Reverse -210 -227 7.97797 0.254
NP_442116.1_6 Forward -226 -209 6.35461 0.28
NP_440261.1_5 Reverse -271 -284 -12.3704 0.284
NP_440988.1_10 Reverse -108 -122 8.28727 0.205
NP_440988.1_10 Forward -121 -107 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCGCCGATTGATCAAGGGGAAAGCACTGGAATTTACCCGCTAAGTTGACGTTGGCTAAAACGGGATGCTGTTCCGGATCGCCAAAGGTATCCACCAACCATTCCCTCGTACCATCCTTAGAGCCATCGTCCACCATGACAATTTCCTTGGGGATTTCAGGCATTACCGTGGTAATTTTTTTGAGAATTTTTTCGATGGTTTGGATTTCGTTATAAATCGGAATGATAACCGAAAGCTTCATGGAAATTGGCTTAGTTAAGAAAAACAGAAGAAAATCCTTGGCAATGGCGAAGTCACAGCCCACCTCAGCACCCTAAGAGTTATATCATTTGGAGAGAGGCTATTCGGAAAATTGAAGTCTATTTTTAGTCAGAATTAACAGGAAGTAAGTTTTAGAGA

CDS

ATGCAATTTATTGATCAAGCGGAGATCGAAGTTCAGGGCGGCAAAGGCGGCGATGGCATGGTGTCCTTTCGGCGGGAAAAGTATGTGCCAGCAGGGGGCCCTTCCGGGGGCAATGGGGGCCGGGGTGGCTCGGTAATTTTTGAAGCGGATGCCAATCTGCAAACCCTGTTGGATTTTCGCTACGCCAGGATTTTTAAAGCGGAAGACGGCAAAAAAGGCGGCTCTAGCAATTGCACCGGGGCCAATGGCAAGGATGTGGTGGTGCAAGTTCCCTGTGGCACCATGGTGTATGACTTGGACGGGGAATGCCTCTTGGGAGATTTAGTTAGCCCTGGGCAAAGGCTTTGTGTGGCGGCGGGGGGCAAAGGTGGTTTGGGTAATCAACATTTCCTTAGCAACCGCAACCGGGCTCCGGAATACGCCCTACCGGGATTGGAGGGGGAACAGCGACAGCTACGGCTAGAGCTAAAACTGCTGGCGGAAGTGGGCATTATTGGTTTACCCAATGCCGGGAAATCCACCCTAATTGCAGCTTTGTCGGCGGCTCGTCCAAAAATTGCCGACTATCCCTTTACTACCCTGGTTCCCAACCTGGGAGTGGTGCGAAAACCCACCGGGGATGGCACCGTTTTTGCTGATATTCCCGGGCTAATCGAAGGGGCGGCAGCGGGCATTGGTTTGGGTCATGAATTTTTGCGCCACATTGAACGGACTCGTTTACTGCTCCACGTTTTAGACGTCACTGCAGGGGATCCGATCGCCAATTTTCGGGTGATTCAGCAGGAGTTGGACGCCTATGGCCGGGGGATAACGGAAAAACCCCAGATCATTGCTTTGAATAAAATTGATGCGCTGGACGGGGAAATGATTGGGGAAATTGAAACGGAATTAAAACGATTCAGTACTGCTCCCTGTTTGCACATTTCGGCGGCCACCCGGAGAGGCTTAGATGATTTGATGCAATTGGTGTGGCAATGGCTGGATGAAATGGCCGCGGCGGACGCAGAAGCCCAGAGGTTACTGGAGTTGGAATTGCAGGCCCAGGCGGCAATGAATAATCCTTTCAACTCTGACGTACCCATTGACGGGGTAACTTACTCAAGCTAA

Protein

MQFIDQAEIEVQGGKGGDGMVSFRREKYVPAGGPSGGNGGRGGSVIFEADANLQTLLDFRYARIFKAEDGKKGGSSNCTGANGKDVVVQVPCGTMVYDLDGECLLGDLVSPGQRLCVAAGGKGGLGNQHFLSNRNRAPEYALPGLEGEQRQLRLELKLLAEVGIIGLPNAGKSTLIAALSAARPKIADYPFTTLVPNLGVVRKPTGDGTVFADIPGLIEGAAAGIGLGHEFLRHIERTRLLLHVLDVTAGDPIANFRVIQQELDAYGRGITEKPQIIALNKIDALDGEMIGEIETELKRFSTAPCLHISAATRRGLDDLMQLVWQWLDEMAAADAEAQRLLELELQAQAAMNNPFNSDVPIDGVTYSS