Your browser is old and dusty. Try Google Chrome!

Details for slr1085

ORF slr1085
Accession NP_440259.1
Symbol
Category Other
Definition probable glycosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -240 -226 -0.000409212 0.219
NP_441061.1_2 Reverse -220 -234 -0.787057 0.239
NP_440795.1_7 Forward -123 -116 8.39725 0.213
NP_441453.1_4 Reverse -199 -207 4.93597 0.224
NP_441623.1_1 Reverse -336 -354 -4.20908 0.274
NP_442151.1_6 Reverse -226 -240 5.40779 0.278
NP_441818.1_1 Reverse -97 -108 10.8746 0.215
NP_441818.1_9 Forward -210 -191 -0.0988766 0.195
NP_441519.1_3 Reverse -275 -294 16.8141 0.103
NP_441816.1_6 Reverse -283 -295 17.3452 0.218
NP_441250.1_3 Forward -138 -119 14.5524 0.131
NP_440061.1_9 Forward -399 -385 14.5519 0.0631
NP_440061.1_9 Reverse -94 -108 8.45543 0.174
NP_440110.1_4 Forward -276 -257 1.17943 0.294
NP_441054.1_2 Reverse -335 -354 10.3242 0.284
NP_442062.1_8 Reverse -96 -106 9.91146 0.0554
NP_442062.1_8 Reverse -321 -331 6.27322 0.132
NP_442268.1_3 Forward -396 -377 12.6833 0.295
NP_442602.1_3 Forward -321 -302 0.491109 0.2
NP_439918.1_2 Forward -163 -144 -4.91709 0.291
NP_442742.1_9 Reverse -347 -366 -6.1954 0.222
NP_442276.1_2 Forward -220 -201 5.11266 0.295
NP_442110.1_7 Reverse -226 -240 3.63784 0.21
NP_441083.1_5 Forward -397 -387 -0.511621 0.269
NP_441738.1_2 Forward -103 -96 6.52862 0.261
NP_441713.1_5 Reverse -210 -229 6.58763 0.265
NP_441770.1_5 Reverse -101 -120 -1.96717 0.281
NP_442570.1_8 Forward -201 -183 16.1454 0.112
NP_441792.1_5 Reverse -208 -224 14.7098 0.176
NP_441792.1_5 Reverse -143 -159 8.41667 0.274
NP_441716.1_1 Forward -124 -110 9.63603 0.111
NP_441716.1_1 Forward -210 -196 5.89945 0.211
NP_441716.1_1 Forward -397 -383 4.22782 0.256
NP_440851.1_5 Forward -361 -342 10.0284 0.281
NP_440747.1_10 Reverse -385 -397 -2.71429 0.0639
NP_440747.1_10 Forward -400 -388 -12.5474 0.297
NP_441130.1_10 Forward -387 -373 4.91614 0.258
NP_441486.1_1 Reverse -216 -230 -2.75368 0.175
NP_440403.1_4 Reverse -190 -209 -1.67217 0.174
NP_440403.1_10 Reverse -217 -236 7.27595 0.208
NP_440057.1_1 Forward -397 -378 13.2741 0.149
NP_443018.1_3 Forward -396 -389 9.38056 0.128
NP_441316.1_7 Reverse -197 -212 4.79811 0.121
NP_441634.1_8 Reverse -113 -127 2.94952 0.158
NP_441634.1_8 Forward -307 -293 0.392915 0.231
NP_441634.1_8 Forward -237 -223 -0.492064 0.259
NP_441634.1_8 Forward -107 -93 -4.4253 0.295
NP_440376.1_1 Reverse -96 -105 3.7363 0.195
NP_440376.1_1 Reverse -287 -296 3.44131 0.203
NP_440376.1_1 Reverse -388 -397 2.65466 0.216
NP_441077.1_6 Reverse -34 -50 9.16472 0.18
NP_442485.1_3 Reverse -188 -207 -1.47551 0.259
NP_440642.1_10 Forward -307 -293 5.1122 0.242
NP_440042.1_2 Forward -263 -244 1.0811 0.213
NP_440667.1_2 Forward -210 -191 -7.76869 0.285
NP_441950.1_7 Forward -154 -135 -0.983855 0.191
NP_440360.1_9 Forward -49 -30 8.16093 0.243
NP_442782.1_2 Forward -296 -282 0.687908 0.286
NP_442937.1_5 Forward -132 -113 6.88262 0.268
NP_441127.1_1 Forward -127 -113 9.93102 0.267
NP_440203.1_2 Reverse -378 -397 12.6841 0.295
NP_440203.1_5 Reverse -279 -289 11.4843 0.19
NP_440203.1_5 Forward -308 -298 9.91099 0.245
NP_439905.1_1 Reverse -116 -129 7.19745 0.264
NP_439905.1_2 Reverse -377 -391 9.83269 0.228
NP_443001.1_7 Reverse -304 -323 1.17943 0.286
NP_441162.1_3 Forward -303 -284 13.2741 0.181
NP_442690.1_1 Reverse -331 -350 -6.58872 0.168
NP_442690.1_1 Forward -46 -27 -16.8151 0.291
NP_442911.1_2 Forward -134 -115 -9.34199 0.254
NP_440153.1_8 Reverse -139 -152 -3.12731 0.285
NP_441591.1_10 Reverse -285 -304 10.8159 0.188
NP_442064.1_4 Reverse -378 -397 8.16011 0.235
NP_442236.1_3 Forward -154 -135 6.19431 0.298
NP_440993.1_4 Forward -397 -380 11.2486 0.21
NP_440615.1_7 Forward -330 -311 17.8247 0.113
NP_441099.1_5 Reverse -191 -210 0.786102 0.073
NP_442002.1_9 Forward -286 -279 11.3472 0.185
NP_440411.1_10 Forward -166 -147 9.48095 0.286
NP_441646.1_1 Reverse -381 -400 9.73422 0.125
NP_442431.1_10 Forward -213 -195 -0.964162 0.298
NP_441000.1_6 Reverse -200 -214 -5.60527 0.285
NP_440147.1_1 Reverse -90 -109 6.39097 0.254
NP_440147.1_4 Reverse -386 -399 2.57589 0.207
NP_441175.1_2 Reverse -373 -392 7.86593 0.226
NP_440383.1_3 Forward -50 -32 17.0304 0.0919
NP_440465.1_4 Forward -369 -350 16.8141 0.184
NP_441041.1_4 Forward -228 -209 7.07928 0.041
NP_441725.1_5 Reverse -200 -210 -1.29827 0.299
NP_439966.1_7 Forward -107 -97 8.92768 0.125
NP_439966.1_7 Reverse -197 -207 5.28945 0.232
NP_442941.1_3 Reverse -97 -107 7.15819 0.0855
NP_440289.1_2 Reverse -196 -209 9.85238 0.0312
NP_440289.1_2 Forward -213 -200 -0.570702 0.202
NP_442281.1_1 Reverse -203 -217 6.48882 0.124
NP_442281.1_1 Forward -233 -219 5.1122 0.169
NP_442281.1_1 Reverse -221 -235 1.86729 0.285
NP_440437.1_1 Reverse -281 -300 -5.50708 0.286
NP_441556.1_7 Forward -307 -288 5.70185 0.198
NP_443030.1_4 Reverse -207 -226 -6.88371 0.291
NP_441644.1_6 Forward -397 -387 13.6475 0.0181
NP_441644.1_6 Reverse -388 -398 4.30615 0.242
NP_440867.1_6 Forward -232 -213 22.6147 0.0578
NP_442215.1_2 Forward -301 -285 -7.0213 0.284
NP_442029.1_6 Forward -110 -91 4.12936 0.273
NP_440929.1_8 Reverse -199 -208 6.39124 0.0992
NP_440929.1_8 Forward -228 -219 3.63797 0.214
NP_441751.2_8 Reverse -200 -214 -6.29359 0.259
NP_440096.1_5 Reverse -98 -117 16.8141 0.109
NP_442554.1_8 Reverse -389 -399 11.6814 0.033
NP_442554.1_8 Forward -396 -386 4.20827 0.193
NP_442554.1_8 Forward -234 -224 2.43831 0.272
NP_441762.1_7 Reverse -286 -298 -5.66422 0.228
NP_442142.1_4 Reverse -198 -211 4.24695 0.227
NP_442142.1_4 Reverse -385 -398 2.37867 0.294
NP_442142.1_4 Forward -400 -387 2.18201 0.299
NP_442292.1_1 Reverse -97 -106 -0.68859 0.268
NP_443009.1_5 Forward -106 -95 14.9061 0.0183
NP_443009.1_5 Reverse -358 -369 7.92465 0.118
NP_441715.1_4 Reverse -97 -107 5.68323 0.189
NP_441715.1_4 Forward -207 -197 4.50326 0.27
NP_440881.1_5 Reverse -107 -126 12.8808 0.299
NP_440183.1_9 Forward -395 -376 -20.945 0.294
NP_440379.1_5 Forward -142 -123 -10.817 0.285
NP_442868.1_6 Forward -107 -97 13.0581 0.038
NP_442719.1_2 Forward -261 -243 -6.27474 0.225
NP_441056.1_1 Forward -241 -222 -9.14533 0.291
NP_440031.1_10 Reverse -377 -396 1.76941 0.269
NP_442692.1_1 Reverse -191 -210 -5.31042 0.274
NP_442542.1_2 Forward -126 -113 7.78743 0.17
NP_442542.1_9 Reverse -219 -233 9.24208 0.138
NP_442050.1_5 Forward -107 -97 8.92768 0.206
NP_442789.1_4 Forward -144 -125 -3.3438 0.25
NP_441518.1_3 Reverse -189 -208 -15.8318 0.299
NP_441878.1_6 Reverse -387 -397 0.668351 0.139
NP_441878.1_6 Forward -398 -388 0.57002 0.14
NP_441878.1_6 Forward -125 -115 -7.59145 0.245
NP_441036.1_8 Reverse -95 -105 6.8632 0.213
NP_441557.1_5 Forward -105 -96 -0.885252 0.26
NP_441445.1_1 Reverse -106 -125 4.62101 0.191
NP_442183.1_1 Forward -208 -194 5.99778 0.193
NP_442645.1_2 Reverse -107 -126 -17.6018 0.259
NP_442645.1_2 Reverse -67 -86 -19.4701 0.288
NP_441037.1_4 Forward -298 -288 8.77956 0.237
NP_441633.1_1 Reverse -210 -227 11.0519 0.248
NP_440136.1_2 Reverse -97 -104 11.1505 0.0519
NP_442590.1_10 Reverse -90 -109 3.83436 0.283
NP_442998.1_5 Forward -356 -346 10.9931 0.199
NP_442998.1_10 Forward -206 -199 4.07068 0.276
NP_440299.1_1 Forward -122 -109 11.9167 0.0427
NP_442007.1_8 Reverse -191 -209 11.4247 0.258
NP_441559.1_8 Reverse -92 -106 1.47456 0.155
NP_441559.1_8 Reverse -282 -296 1.37622 0.156
NP_440915.1_6 Reverse -65 -79 -0.983719 0.217
NP_440915.1_6 Reverse -384 -398 -2.65535 0.278
NP_442866.1_1 Forward -204 -185 -8.35868 0.279
NP_440748.1_5 Forward -328 -309 -0.787193 0.26
NP_441464.1_1 Reverse -191 -210 6.98095 0.273
NP_441464.1_10 Forward -159 -145 8.65272 0.275
NP_440188.1_4 Reverse -208 -227 9.24257 0.252
NP_442993.1_1 Forward -105 -89 -8.10294 0.153
NP_440677.1_6 Reverse -379 -398 16.2241 0.131
NP_442386.1_9 Forward -106 -97 7.37413 0.219
NP_442386.1_9 Forward -398 -389 6.48915 0.219
NP_442386.1_9 Reverse -95 -104 5.60418 0.245
NP_442484.1_2 Forward -116 -97 6.19431 0.156
NP_442791.1_9 Forward -126 -107 11.5033 0.284
NP_440327.1_6 Reverse -377 -396 7.86593 0.224
NP_440327.1_6 Reverse -304 -323 3.93269 0.276
NP_440327.1_6 Forward -163 -144 3.93269 0.276
NP_442959.1_7 Reverse -147 -166 2.45773 0.222
NP_440027.1_3 Reverse -189 -207 2.87 0.284
NP_439937.1_9 Forward -79 -62 -13.2365 0.283
NP_439937.1_9 Reverse -114 -131 -17.268 0.296
NP_443039.1_7 Reverse -208 -222 14.3553 0.127
NP_442511.1_5 Reverse -128 -147 12.672 0.265
NP_441803.1_2 Forward -304 -285 6.09597 0.159
NP_441572.1_7 Reverse -220 -239 0.0977854 0.174
NP_441572.1_7 Reverse -270 -289 -6.09707 0.281
NP_442384.1_10 Forward -397 -384 6.1158 0.11
NP_442384.1_10 Reverse -96 -109 2.47756 0.224
NP_441604.1_4 Forward -293 -274 4.81767 0.189
NP_442262.1_10 Forward -396 -389 9.47889 0.187
NP_442262.1_10 Forward -234 -227 7.11894 0.287
NP_441689.1_5 Reverse -230 -240 5.09279 0.285
NP_440344.1_10 Forward -235 -218 -13.7275 0.293
NP_440531.1_6 Forward -304 -285 0.0977854 0.199
NP_440531.1_6 Reverse -191 -210 -3.93378 0.273
NP_440531.1_6 Reverse -88 -107 -4.91709 0.29
NP_440189.1_2 Reverse -381 -400 1.57275 0.268
NP_440562.1_1 Reverse -280 -299 11.2084 0.276
NP_441965.1_10 Forward -108 -92 3.69678 0.256
NP_442280.1_10 Reverse -378 -396 6.81803 0.268
NP_441592.1_4 Reverse -135 -154 6.58763 0.124
NP_441592.1_4 Reverse -283 -302 -3.3438 0.28
NP_440894.1_10 Reverse -285 -304 5.80098 0.227
NP_442067.1_4 Reverse -85 -104 5.50599 0.236
NP_440888.1_2 Reverse -96 -110 11.012 0.0783
NP_440888.1_2 Forward -235 -221 5.40719 0.28
NP_441949.1_4 Forward -215 -196 4.62101 0.281
NP_441543.1_2 Forward -207 -198 7.47288 0.117
NP_441543.1_2 Reverse -202 -211 4.42462 0.246
NP_440071.1_1 Reverse -212 -229 9.77286 0.259
NP_441621.1_7 Reverse -188 -202 -4.4253 0.223
NP_441929.1_3 Forward -313 -294 1.76941 0.278
NP_443062.1_1 Forward -228 -210 4.15809 0.272
NP_443062.1_1 Forward -397 -379 3.86557 0.282
NP_440673.1_7 Reverse -85 -104 2.55606 0.224
NP_441052.1_2 Forward -124 -114 10.5014 0.0285
NP_441052.1_2 Reverse -388 -398 4.20827 0.163
NP_441052.1_2 Forward -397 -387 3.91327 0.17
NP_442219.1_8 Forward -128 -109 11.2594 0.187
NP_440436.1_2 Reverse -185 -204 16.3229 0.224
NP_440436.1_4 Forward -104 -95 4.42421 0.265
NP_440436.1_4 Reverse -97 -106 4.22755 0.277
NP_441884.1_9 Reverse -223 -242 -21.1417 0.229
NP_442086.1_6 Reverse -96 -115 6.39097 0.289
NP_441004.1_1 Reverse -51 -70 -7.86702 0.2
NP_441004.1_1 Forward -157 -138 -16.7168 0.287
NP_441004.1_2 Reverse -242 -261 -4.03212 0.288
NP_442366.1_3 Reverse -218 -236 13.1955 0.0272
NP_442694.1_4 Forward -166 -157 11.4061 0.277
NP_443054.1_2 Reverse -66 -80 -0.197071 0.288
NP_441851.1_10 Forward -106 -96 5.38824 0.214
NP_442011.1_1 Forward -106 -87 1.86774 0.258
NP_441668.1_4 Forward -295 -276 7.66927 0.151
NP_442515.1_1 Reverse -198 -212 -4.32697 0.298
NP_440463.1_8 Forward -263 -244 5.17639 0.292
NP_439960.1_4 Forward -398 -379 15.8299 0.153
NP_439960.1_10 Reverse -210 -228 -3.42244 0.273
NP_442168.1_5 Reverse -209 -228 2.26107 0.232
NP_440954.1_1 Forward -228 -209 -3.54046 0.257
NP_441003.1_9 Reverse -379 -398 3.14605 0.298
NP_441078.1_4 Forward -124 -115 6.29291 0.079
NP_441078.1_4 Forward -208 -199 -1.18024 0.237
NP_441078.1_4 Reverse -388 -397 -1.6719 0.266
NP_441078.1_4 Forward -397 -388 -1.77023 0.266
NP_441078.1_4 Forward -105 -96 -1.96689 0.282
NP_441078.1_4 Reverse -115 -124 -2.06522 0.295
NP_442443.1_1 Forward -141 -122 -3.63879 0.267
NP_441432.1_8 Forward -106 -97 8.1612 0.0815
NP_441432.1_8 Reverse -387 -396 3.44131 0.245
NP_442320.1_8 Forward -111 -97 -6.09693 0.265
NP_441732.1_2 Reverse -111 -127 -16.6577 0.186
NP_440503.1_10 Forward -395 -376 17.699 0.236
NP_442797.1_1 Reverse -191 -210 -0.000545616 0.223
NP_440578.1_10 Reverse -374 -393 9.63589 0.282
NP_440913.1_1 Forward -399 -381 4.6407 0.26
NP_442407.1_8 Reverse -244 -263 18.9773 0.138
NP_442489.1_7 Forward -397 -388 -1.57357 0.213
NP_442489.1_7 Forward -124 -115 -1.6719 0.235
NP_442489.1_7 Reverse -388 -397 -1.6719 0.235
NP_442489.1_7 Reverse -96 -105 -1.86856 0.259
NP_441452.1_9 Forward -385 -366 14.4541 0.258
NP_440386.1_3 Reverse -58 -77 5.211 0.112
NP_440386.1_6 Reverse -77 -96 2.26028 0.258
NP_441659.2_8 Forward -397 -387 3.22496 0.169
NP_440426.1_7 Reverse -119 -138 -0.39387 0.297
NP_441022.1_1 Forward -136 -127 12.3136 0.238
NP_441040.1_2 Forward -230 -211 -1.27885 0.133
NP_441800.1_3 Reverse -377 -395 4.14905 0.289
NP_442346.1_5 Reverse -387 -397 5.5849 0.238
NP_442346.1_5 Forward -398 -388 4.89658 0.269
NP_440545.1_3 Reverse -111 -128 -1.53445 0.17
NP_441856.1_3 Reverse -112 -131 -2.75381 0.27
NP_441856.1_3 Forward -80 -61 -3.63879 0.299
NP_440459.1_2 Reverse -274 -291 9.28195 0.23
NP_440010.1_4 Reverse -108 -127 -0.984623 0.267
NP_441888.1_7 Forward -110 -96 4.32615 0.225
NP_440751.1_9 Forward -210 -191 4.62101 0.245
NP_442799.1_1 Reverse -10 -29 12.0942 0.0591
NP_441329.1_6 Reverse -21 -40 1.86167 0.231
NP_440671.1_2 Forward -232 -218 17.5025 0.135
NP_442943.1_1 Forward -350 -335 11.049 0.18
NP_442045.1_5 Reverse -210 -229 6.19431 0.202
NP_442140.1_3 Forward -396 -386 3.42162 0.297
NP_440590.1_4 Reverse -97 -110 1.29759 0.127
NP_440821.1_4 Reverse -197 -207 -0.216628 0.244
NP_440821.1_4 Forward -210 -200 -0.314959 0.251
NP_440821.1_5 Forward -134 -115 22.8122 0.0261
NP_441239.1_9 Forward -230 -218 8.00379 0.145
NP_441239.1_9 Forward -399 -387 4.07055 0.264
NP_440219.1_4 Reverse -300 -313 14.4699 0.282
NP_442809.1_6 Forward -297 -278 3.93269 0.256
NP_442809.1_6 Reverse -96 -115 0.0977854 0.295
NP_440546.1_4 Reverse -388 -398 8.78555 0.171
NP_440462.1_6 Reverse -94 -104 3.12662 0.26
NP_440462.1_6 Reverse -206 -216 1.25834 0.297
NP_442499.1_3 Reverse -198 -216 3.95239 0.289
NP_441868.1_2 Forward -363 -344 13.9625 0.224
NP_442402.1_4 Reverse -281 -300 -8.85106 0.284
NP_442402.1_9 Reverse -75 -94 8.55425 0.291
NP_442039.1_4 Reverse -200 -207 9.97054 0.131
NP_442380.1_10 Forward -158 -140 10.6389 0.242
NP_440825.1_6 Forward -166 -147 9.3409 0.285
NP_442696.1_6 Reverse -135 -154 -12.5869 0.253
NP_440505.1_3 Forward -107 -97 13.353 0.0331
NP_440505.1_3 Forward -224 -214 9.02648 0.128
NP_440505.1_4 Reverse -52 -71 17.4369 0.261
NP_440505.1_7 Reverse -283 -302 10.9142 0.146
NP_440505.1_7 Reverse -75 -94 3.24438 0.216
NP_442360.1_5 Forward -291 -281 13.943 0.251
NP_441203.1_1 Reverse -277 -296 -20.4534 0.297
NP_440914.1_1 Reverse -226 -236 7.5416 0.232
NP_441011.1_8 Forward -295 -286 8.35786 0.144
NP_441011.1_8 Forward -104 -95 5.11294 0.283
NP_442533.1_6 Forward -397 -388 13.5694 0.021
NP_442533.1_6 Reverse -388 -397 6.78456 0.103
NP_442533.1_6 Forward -105 -96 5.89959 0.125
NP_442533.1_6 Forward -124 -115 5.01461 0.16
NP_442541.1_10 Forward -397 -383 8.55376 0.218
NP_440263.1_9 Forward -91 -72 13.8641 0.193
NP_441697.1_5 Reverse -35 -54 -7.974 0.252
NP_440115.1_6 Forward -379 -369 5.68323 0.227
NP_440007.1_9 Reverse -65 -79 0.687908 0.292
NP_442890.1_10 Forward -133 -114 13.5691 0.188
NP_441825.1_4 Forward -21 -11 13.8447 0.249
NP_439903.1_6 Reverse -273 -292 -0.591301 0.283
NP_440670.1_8 Reverse -226 -235 3.24465 0.29
NP_440886.1_7 Forward -125 -115 6.86274 0.113
NP_440767.1_2 Reverse -107 -126 0.982764 0.262
NP_441808.1_8 Forward -237 -218 12.1925 0.213
NP_441808.1_8 Forward -397 -378 5.89931 0.294
NP_442022.1_4 Forward -151 -132 9.83255 0.242
NP_442264.1_4 Forward -299 -285 19.8624 0.197
NP_441021.1_1 Reverse -97 -116 -10.817 0.248
NP_441626.1_2 Reverse -200 -207 4.759 0.258
NP_442794.1_1 Forward -109 -97 4.75886 0.249
NP_440387.1_1 Reverse -199 -215 -5.15301 0.217
NP_440855.1_3 Reverse -62 -81 6.58682 0.269
NP_441993.1_1 Forward -235 -216 2.53143 0.257
NP_442352.1_1 Reverse -290 -303 16.8253 0.166
NP_442698.1_10 Reverse -111 -130 7.66927 0.233
NP_442323.1_7 Forward -240 -221 7.57013 0.178
NP_442323.1_7 Reverse -270 -289 2.16195 0.271
NP_441510.2_7 Forward -83 -69 12.6836 0.28
NP_441272.1_8 Forward -392 -374 16.4404 0.187
NP_440293.1_3 Reverse -381 -400 0.0977854 0.226
NP_440766.1_4 Reverse -215 -229 3.34284 0.15
NP_440766.1_4 Forward -221 -207 1.76955 0.214
NP_439988.1_3 Reverse -384 -398 6.48943 0.278
NP_442743.1_4 Reverse -277 -296 -1.27885 0.195
NP_439910.1_2 Reverse -279 -296 -22.479 0.25
NP_440457.1_1 Forward -221 -209 7.70879 0.101
NP_440457.1_1 Reverse -384 -396 0.0389777 0.25
NP_442680.1_5 Forward -179 -160 0.3653 0.268
NP_440660.1_6 Forward -393 -374 10.8159 0.28
NP_442514.1_5 Reverse -380 -399 5.89851 0.134
NP_441159.1_8 Forward -42 -23 2.9486 0.236
NP_440554.1_4 Forward -234 -224 4.79825 0.175
NP_442862.1_3 Reverse -305 -322 4.75873 0.287
NP_441885.1_5 Forward -124 -114 0.471689 0.145
NP_441885.1_5 Reverse -388 -398 -0.314959 0.195
NP_441885.1_5 Forward -105 -95 -1.19994 0.255
NP_442341.1_7 Reverse -114 -128 4.42448 0.191
NP_442341.1_7 Forward -236 -222 2.5562 0.252
NP_440423.1_10 Forward -112 -93 8.94757 0.265
NP_443000.1_7 Forward -107 -97 0.57002 0.294
NP_441842.1_10 Reverse -219 -233 6.6861 0.278
NP_441397.1_8 Forward -358 -345 12.6667 0.256
NP_441359.1_5 Forward -238 -219 1.17943 0.29
NP_441207.1_7 Reverse -1 -15 7.80321 0.295
NP_439962.1_4 Reverse -351 -370 -6.98204 0.286
NP_439962.1_4 Forward -230 -211 -7.17871 0.288
NP_442495.1_4 Reverse -280 -290 11.4848 0.271
NP_441105.1_3 Reverse -215 -234 -4.91709 0.209
NP_441105.1_3 Forward -239 -220 -9.63698 0.292
NP_440216.1_6 Reverse -212 -228 7.53169 0.189
NP_440216.1_6 Reverse -219 -235 6.35172 0.189
NP_440216.1_9 Forward -395 -386 5.89959 0.289
NP_440172.1_1 Forward -285 -275 9.41981 0.0586
NP_442015.1_10 Forward -239 -226 -0.0790467 0.25
NP_440198.1_10 Reverse -320 -339 13.6675 0.22
NP_441111.1_7 Forward -207 -199 -0.570565 0.233
NP_440416.1_9 Reverse -381 -400 -9.93197 0.135
NP_440416.1_9 Forward -159 -140 -19.1751 0.27
NP_443052.1_9 Reverse -209 -228 -0.590531 0.213
NP_442046.1_2 Forward -49 -36 15.3391 0.241
NP_440261.1_5 Reverse -200 -213 -10.5021 0.201
NP_440988.1_10 Forward -399 -385 8.38408 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTGCCCATGGCCAGGCTGAAGGTAGCTATCCTGCGATTATTCGGGGCCAAAATTGGTACAGGAGTTAATATCAAACCCCACGTCAAGATCAAATTCCCTTGGCGGCTAACCCTGGGCAATTACGTTTGGAGTAAACCCAGCTTTGACCTAATCACCAGTCCGATTCACATCGCCGCTGGCAGTTGGATCGGTGCTAGCGCCGTTATTGGACCTGGAGTACGGGTGAATGAAAAGGCAGTTTTGACTTTGGGGTCTGTGGCTGTCAAAGATTTGGCGGCTATGACCATCTACTCTGGCAATCCCTGTCAGCCGGTCAAAAAACGGCAACTCCTCTGAAATTACGCCAGGTAAAAACTAACTTTTGTTGTTAGTACCTTTAGGGATTTGATCTAATTATTG

CDS

ATGAAGCTAACCATTCTTAACCAATTTTATCCCCCTGACTATGCGGCCACGGGGCAACTGCTAGAAGAACTGTCCATCGAACTGTCCAAAAAAGAGCTTGATGTGCAAATTTTTGCTGGGCAACCGGGTTATGCATTTGATCAGGAACTTGCCCCATCCCAGGAAGTCTCTCAGGGAGTTTTGATCAGAAGAACTAGGACTTCCCGCCTCTGGCCCCAGAGATTACGGGGGCGGGCGATCGCCGGAATTTTGTATTGTTTACGCGCCATCGTCAAACTCAGATTAGGGAGCAGACTGGGGGATTTGATTCTTGTTACTACAGAGCCTCCCTACCTAATGGTGGTGGCCTATATCCTGCATTTGTTATACAAAAAACCCTATATCTGCCTGATTTATGATCTCTACCCCGATGTGGCAGTGAAGTTGGGGGTGGCGAAGGAAAAGGATGCCATTGTTAAATTGTGGCGTTGGCTAAATCGTTTAACTTGGCAAAAGGCAGAGGCTATTATTGTGCTCAGCGAGAGCATGGCTAAGGTGATCGCGGACCAACAACCAGCCCTAGCAGGGAAAATTGAGGTGGTCCATAACTGGGCGGATGGAGTGTTAATCCAACCAAGGGCCAAAGCTGATAACTGGTTTGCCCAACGCCATGGCTTGGACCGGACATTTACCGTACTGTATTCCGGTAATCTGGGACGGTGCCACGACCTGGAAACTGTTATGGAAGCGGCTCGCCTACTGCAGCAAGAAGAAGTCCAGTTTGTTTTTATTGGAGCTGGTGCTAAGGCCCCAGTCTGTCAAGAATTCGTACAACGCCACCAGTTAACTAATTGTTTATTTTTGCCCTTCCAACCCAAGCCGGTTTTGCCCTTTTCCCTCACCGCCTGCGACCTGAGCTTGGTTTCCATTTTGCCCCAGGTGGAAGGGCTGGTGGTCCCGAGCAAATTCTATGGCTGTTTGGCCGCAGGCACGGCGATCGCCGCCATTTGTCCCCCCCATTCCTATTTACGGGAAATTATTGCCGAAGCTCAATGTGGAGCAACCATTGATAACGGAGACGGGGCAGGATTGGCTCAATTTATCCTTCAACTTAAGAATAATCCCCGCCGAACAGCAACCATGGGGCGTCGAGGCCGCCAATATTTTGAAGAAAACTTTACCCTGGACACCATTGCGGACCAATACCTATCTGTCATTACTAAAGTGGGCGATGAAGAAGTCGCCAAGCTCCAAGCAAATAAATTCTGTAACCATCCTGACTCAAGCTTGCTTTAA

Protein

MKLTILNQFYPPDYAATGQLLEELSIELSKKELDVQIFAGQPGYAFDQELAPSQEVSQGVLIRRTRTSRLWPQRLRGRAIAGILYCLRAIVKLRLGSRLGDLILVTTEPPYLMVVAYILHLLYKKPYICLIYDLYPDVAVKLGVAKEKDAIVKLWRWLNRLTWQKAEAIIVLSESMAKVIADQQPALAGKIEVVHNWADGVLIQPRAKADNWFAQRHGLDRTFTVLYSGNLGRCHDLETVMEAARLLQQEEVQFVFIGAGAKAPVCQEFVQRHQLTNCLFLPFQPKPVLPFSLTACDLSLVSILPQVEGLVVPSKFYGCLAAGTAIAAICPPHSYLREIIAEAQCGATIDNGDGAGLAQFILQLKNNPRRTATMGRRGRQYFEENFTLDTIADQYLSVITKVGDEEVAKLQANKFCNHPDSSLL