Your browser is old and dusty. Try Google Chrome!

Details for slr1083

ORF slr1083
Accession NP_440257.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -72 -65 14.6904 0.0123
NP_440795.1_7 Reverse -65 -72 14.6904 0.0123
NP_441418.1_6 Reverse -64 -83 -29.1065 0.216
NP_440815.1_5 Reverse -347 -366 3.04771 0.289
NP_441453.1_4 Reverse -64 -72 16.539 0.00633
NP_441453.1_4 Forward -73 -65 16.539 0.00633
NP_442151.1_6 Reverse -64 -78 6.58777 0.228
NP_442151.1_6 Forward -347 -333 6.3911 0.236
NP_442151.1_6 Forward -73 -59 5.89945 0.256
NP_441818.1_9 Reverse -374 -393 -4.13045 0.234
NP_440226.1_1 Reverse -64 -83 10.4225 0.0622
NP_440226.1_1 Reverse -201 -220 5.40766 0.157
NP_440150.1_6 Reverse -371 -390 3.34271 0.251
NP_442655.1_2 Reverse -54 -73 -0.000545616 0.295
NP_442173.1_1 Forward -72 -64 15.4574 0.00633
NP_442173.1_1 Reverse -65 -73 15.4574 0.00633
NP_442752.1_4 Forward -73 -66 13.8055 0.0199
NP_442752.1_4 Reverse -64 -71 13.8055 0.0199
NP_442752.1_4 Reverse -196 -203 8.20058 0.127
NP_442752.1_4 Reverse -368 -375 7.90559 0.144
NP_443027.1_4 Forward -75 -65 7.25653 0.24
NP_441812.1_3 Forward -197 -183 8.65272 0.251
NP_442975.1_10 Forward -77 -63 10.5204 0.0541
NP_442975.1_10 Reverse -60 -74 1.5723 0.296
NP_440784.1_7 Forward -72 -65 15.9687 0.0123
NP_440784.1_7 Reverse -65 -72 15.9687 0.0123
NP_442909.1_7 Forward -72 -58 7.57046 0.21
NP_440061.1_9 Forward -75 -61 9.34041 0.148
NP_442062.1_3 Reverse -23 -42 -2.16383 0.269
NP_442062.1_8 Forward -73 -63 17.6796 0.00193
NP_442062.1_8 Reverse -64 -74 10.3048 0.0493
NP_440761.1_4 Forward -352 -333 -14.0619 0.257
NP_441859.1_3 Forward -290 -271 2.16195 0.266
NP_441802.1_1 Reverse -49 -68 4.22769 0.296
NP_440304.1_4 Forward -75 -65 10.8948 0.051
NP_440304.1_4 Reverse -62 -72 9.91146 0.051
NP_442242.1_4 Forward -72 -65 14.3954 0.0124
NP_442242.1_4 Reverse -65 -72 14.3954 0.0124
NP_440044.1_8 Reverse -65 -84 17.2074 0.0217
NP_440908.1_5 Forward -71 -54 8.10198 0.28
NP_441200.1_4 Forward -89 -70 12.3892 0.172
NP_441619.1_8 Reverse -58 -72 13.372 0.115
NP_441619.1_8 Forward -79 -65 6.78381 0.295
NP_441208.1_9 Forward -208 -194 7.86607 0.219
NP_442276.1_2 Reverse -118 -137 14.9458 0.264
NP_442110.1_7 Forward -347 -333 8.75105 0.083
NP_441082.1_10 Reverse -265 -278 8.77074 0.262
NP_440300.1_1 Forward -149 -130 6.98015 0.281
NP_441925.1_4 Forward -136 -117 -17.4058 0.294
NP_440856.1_4 Forward -212 -193 0.294447 0.167
NP_440856.1_4 Forward -80 -61 -1.67217 0.202
NP_441083.1_5 Forward -73 -63 19.3512 0.000718
NP_441083.1_5 Reverse -64 -74 11.2881 0.0159
NP_441083.1_5 Forward -268 -258 1.35667 0.209
NP_441083.1_5 Forward -226 -216 1.35667 0.209
NP_441083.1_5 Reverse -338 -348 -0.0199663 0.251
NP_441083.1_5 Forward -129 -119 -0.609952 0.272
NP_441434.1_7 Forward -71 -57 4.22782 0.225
NP_441738.1_2 Forward -71 -64 15.28 0.0102
NP_441738.1_2 Reverse -66 -73 15.28 0.0102
NP_441558.1_5 Forward -75 -56 14.0608 0.0523
NP_441558.1_5 Reverse -62 -81 4.03102 0.293
NP_441942.1_6 Reverse -90 -109 18.1709 0.23
NP_440209.1_1 Reverse -64 -72 18.1123 0.00295
NP_440209.1_1 Forward -73 -65 18.1123 0.00295
NP_442889.1_8 Reverse -61 -75 9.04542 0.105
NP_442889.1_8 Forward -76 -62 8.94708 0.107
NP_441713.1_1 Forward -353 -334 -15.6352 0.268
NP_441713.1_1 Reverse -58 -77 -16.8151 0.286
NP_440178.1_7 Reverse -63 -82 -11.6036 0.0968
NP_442111.1_4 Forward -74 -60 14.7492 0.0275
NP_441624.1_1 Forward -370 -351 16.0274 0.271
NP_441163.1_1 Reverse -188 -205 4.75801 0.285
NP_440906.1_5 Forward -72 -65 15.8704 0.0124
NP_440906.1_5 Reverse -65 -72 15.8704 0.0124
NP_440747.1_10 Forward -76 -64 5.54551 0.0128
NP_440747.1_10 Reverse -61 -73 5.44718 0.0137
NP_440747.1_10 Forward -350 -338 -2.4193 0.0434
NP_441130.1_10 Forward -198 -184 5.99778 0.207
NP_441486.1_1 Forward -76 -62 15.2409 0.0061
NP_441486.1_1 Reverse -61 -75 -2.16369 0.175
NP_440944.1_2 Reverse -52 -71 6.29264 0.194
NP_442634.1_4 Reverse -62 -76 -3.24533 0.161
NP_441012.1_4 Forward -129 -116 11.9173 0.252
NP_443018.1_3 Forward -72 -65 14.8871 0.0123
NP_443018.1_3 Reverse -65 -72 14.8871 0.0123
NP_441634.1_8 Forward -291 -277 3.93283 0.14
NP_440376.1_1 Forward -73 -64 19.4693 0.000692
NP_440376.1_1 Reverse -64 -73 19.4693 0.000692
NP_441588.1_4 Reverse -66 -76 16.2046 0.0369
NP_441588.1_4 Forward -71 -61 6.96153 0.178
NP_442687.1_7 Reverse -63 -73 18.5646 0.0028
NP_442687.1_7 Forward -74 -64 9.02648 0.0994
NP_442485.1_3 Reverse -194 -213 -5.11376 0.287
NP_441846.1_10 Reverse -373 -392 -12.0953 0.19
NP_441846.1_10 Reverse -358 -377 -12.1936 0.19
NP_441846.1_10 Reverse -367 -386 -12.7836 0.194
NP_441846.1_10 Reverse -374 -393 -20.2567 0.256
NP_441846.1_10 Reverse -378 -397 -23.2067 0.279
NP_440642.1_10 Reverse -250 -264 3.14559 0.277
NP_441013.1_2 Forward -352 -334 -4.30741 0.298
NP_442770.1_1 Reverse -256 -270 19.0751 0.271
NP_442770.1_1 Reverse -214 -228 19.0751 0.271
NP_442770.1_1 Reverse -235 -249 16.3219 0.271
NP_440533.1_9 Reverse -338 -357 13.2741 0.0859
NP_441763.1_10 Forward -197 -178 7.66846 0.23
NP_442658.1_1 Reverse -62 -72 14.8275 0.0188
NP_442658.1_1 Forward -75 -65 13.0576 0.04
NP_440141.1_8 Reverse -37 -56 14.3558 0.155
NP_442782.1_2 Reverse -53 -67 7.86607 0.202
NP_442782.1_2 Reverse -52 -66 6.78443 0.218
NP_442782.1_2 Reverse -320 -334 0.491246 0.289
NP_442205.1_9 Reverse -58 -74 -0.924775 0.264
NP_442205.1_9 Reverse -368 -384 -3.28472 0.282
NP_440656.1_8 Forward -84 -65 -7.76869 0.264
NP_441414.1_9 Forward -73 -54 -4.32711 0.152
NP_441487.1_9 Reverse -63 -82 8.45592 0.102
NP_442937.1_5 Reverse -327 -346 8.45592 0.22
NP_442937.1_5 Forward -78 -59 6.78429 0.27
NP_441958.1_5 Forward -74 -64 21.2195 0.000805
NP_441958.1_5 Reverse -63 -73 20.5312 0.000966
NP_440318.1_1 Forward -354 -335 0.884433 0.292
NP_442486.1_4 Forward -71 -52 6.88262 0.274
NP_440203.1_5 Forward -380 -370 12.3692 0.154
NP_440984.1_7 Forward -78 -64 5.70279 0.245
NP_442911.1_2 Reverse -54 -73 14.7491 0.0112
NP_442064.1_4 Forward -351 -332 11.3067 0.186
NP_440200.1_4 Reverse -278 -297 15.4374 0.272
NP_443055.1_6 Reverse -324 -342 -1.9482 0.285
NP_440993.1_2 Forward -78 -62 1.33684 0.284
NP_442210.1_9 Reverse -124 -142 11.4255 0.225
NP_442210.1_9 Forward -351 -333 10.6389 0.237
NP_439975.1_3 Reverse -365 -378 16.4406 0.205
NP_441099.1_5 Reverse -54 -73 -10.3253 0.25
NP_442002.1_9 Reverse -63 -70 14.1004 0.074
NP_440809.1_9 Forward -82 -64 -7.749 0.225
NP_442013.1_10 Reverse -364 -383 6.29264 0.241
NP_441294.1_7 Forward -77 -63 14.722 0.0371
NP_441294.1_7 Reverse -60 -74 9.05865 0.263
NP_441646.1_1 Reverse -57 -76 11.7992 0.098
NP_442431.1_10 Reverse -119 -137 1.49411 0.253
NP_441000.1_6 Reverse -63 -77 4.52282 0.0953
NP_442771.1_1 Forward -75 -57 -5.97904 0.166
NP_440147.1_4 Forward -75 -62 13.294 0.0326
NP_440147.1_4 Reverse -62 -75 12.704 0.0326
NP_441550.1_8 Reverse -62 -72 17.6791 0.00754
NP_441550.1_8 Forward -75 -65 15.3192 0.0132
NP_441550.1_8 Forward -349 -339 5.28945 0.255
NP_441550.1_8 Reverse -262 -272 4.99446 0.274
NP_441550.1_8 Reverse -220 -230 4.99446 0.274
NP_441916.1_7 Reverse -64 -74 18.9579 0.00144
NP_441916.1_7 Forward -73 -63 16.893 0.00407
NP_441916.1_10 Reverse -13 -32 5.40766 0.213
NP_441041.1_4 Reverse -64 -83 -5.40875 0.152
NP_441041.1_7 Forward -76 -64 17.7184 0.00706
NP_441041.1_7 Reverse -61 -73 11.8878 0.0689
NP_442396.1_5 Reverse -60 -73 10.934 0.106
NP_441547.1_1 Forward -339 -320 2.3594 0.28
NP_442004.1_6 Forward -73 -59 8.84938 0.14
NP_440703.1_9 Forward -279 -266 6.50855 0.285
NP_441725.1_4 Forward -294 -280 4.12889 0.278
NP_441725.1_5 Forward -72 -62 11.7798 0.0247
NP_441725.1_5 Reverse -65 -75 1.94665 0.115
NP_439966.1_7 Forward -75 -65 6.27276 0.185
NP_439966.1_9 Forward -198 -189 0.491382 0.288
NP_442941.1_3 Reverse -65 -75 11.0914 0.0116
NP_442941.1_3 Forward -72 -62 2.53664 0.14
NP_442941.1_3 Reverse -339 -349 0.275027 0.222
NP_440289.1_2 Forward -76 -63 7.49244 0.0557
NP_440289.1_2 Reverse -61 -74 -2.43899 0.255
NP_440983.1_5 Reverse -327 -346 -8.06369 0.294
NP_440260.1_8 Reverse -55 -73 -6.96235 0.295
NP_441678.1_9 Reverse -52 -71 -1.08219 0.238
NP_442281.1_1 Forward -78 -64 18.5835 0.00414
NP_442281.1_1 Reverse -59 -73 3.04726 0.246
NP_442256.1_2 Reverse -62 -80 -8.24065 0.218
NP_440437.1_1 Reverse -332 -351 -2.55715 0.219
NP_441457.1_7 Reverse -62 -81 -0.688862 0.293
NP_440498.1_1 Forward -82 -64 -3.12744 0.256
NP_441644.1_6 Reverse -64 -74 19.0557 0.000803
NP_441644.1_6 Forward -73 -63 15.7125 0.0048
NP_441644.1_6 Forward -22 -12 7.74772 0.117
NP_442215.1_2 Forward -75 -59 -1.51476 0.186
NP_442029.1_6 Reverse -271 -290 4.81767 0.261
NP_442247.1_8 Forward -75 -61 12.1926 0.247
NP_440253.1_2 Reverse -64 -82 -2.93078 0.28
NP_440929.1_8 Forward -73 -64 19.2726 0.000701
NP_440929.1_8 Reverse -64 -73 19.2726 0.000701
NP_440929.1_8 Forward -205 -196 5.50626 0.132
NP_442933.1_10 Forward -73 -64 17.601 0.00325
NP_442933.1_10 Reverse -64 -73 17.601 0.00325
NP_441751.2_8 Forward -72 -58 6.78443 0.0348
NP_441751.2_8 Reverse -65 -79 -3.147 0.134
NP_442554.1_8 Reverse -65 -75 16.4013 0.0065
NP_442554.1_8 Forward -72 -62 14.238 0.0144
NP_441762.1_7 Reverse -63 -75 8.88877 0.0143
NP_441762.1_7 Forward -74 -62 0.432302 0.0747
NP_442142.1_4 Forward -76 -63 3.65697 0.248
NP_442142.1_4 Reverse -61 -74 3.26365 0.262
NP_442292.1_1 Reverse -65 -74 17.5026 0.00435
NP_442292.1_1 Forward -72 -63 9.53783 0.0183
NP_442292.1_1 Reverse -339 -348 -0.393597 0.245
NP_442476.1_6 Forward -72 -58 -0.295402 0.294
NP_440895.1_6 Forward -353 -340 16.2439 0.127
NP_441523.1_6 Reverse -334 -353 10.6192 0.161
NP_443009.1_5 Forward -74 -63 17.0694 0.00659
NP_443009.1_5 Reverse -63 -74 16.7744 0.00677
NP_441715.1_4 Reverse -65 -75 7.35486 0.108
NP_440015.1_8 Forward -302 -284 19.9803 0.184
NP_440015.1_9 Forward -73 -55 7.29564 0.112
NP_441198.1_8 Forward -75 -65 12.783 0.116
NP_441198.1_8 Reverse -62 -72 12.5877 0.12
NP_441468.1_1 Forward -72 -65 15.8704 0.0124
NP_441468.1_1 Reverse -65 -72 15.8704 0.0124
NP_441020.2_6 Forward -75 -58 7.80699 0.218
NP_441015.1_10 Reverse -363 -382 -11.2103 0.292
NP_441673.1_1 Forward -73 -64 20.8459 0.000698
NP_441673.1_1 Reverse -64 -73 20.8459 0.000698
NP_441826.1_2 Reverse -332 -346 3.34284 0.111
NP_441826.1_2 Reverse -58 -72 -4.13031 0.292
NP_441330.1_1 Forward -78 -59 -11.8986 0.183
NP_442490.1_9 Reverse -52 -71 -5.11376 0.273
NP_442868.1_6 Reverse -62 -72 9.12481 0.0539
NP_442868.1_6 Forward -75 -65 0.963343 0.205
NP_442868.1_6 Forward -349 -339 0.176696 0.247
NP_442719.1_2 Forward -61 -43 -10.6996 0.28
NP_442227.1_2 Forward -375 -356 0.58944 0.252
NP_442227.1_6 Forward -109 -90 16.4199 0.253
NP_442808.1_1 Reverse -63 -73 8.73102 0.0481
NP_442808.1_1 Forward -74 -64 8.73102 0.0481
NP_442808.1_1 Reverse -316 -326 4.50281 0.197
NP_442808.1_1 Forward -67 -57 2.83119 0.254
NP_441101.1_10 Forward -209 -190 -7.08038 0.29
NP_440918.1_8 Forward -127 -109 22.3394 0.0944
NP_440145.1_3 Forward -83 -64 8.65258 0.0446
NP_442050.1_5 Forward -75 -65 9.22267 0.193
NP_442050.1_5 Reverse -62 -72 6.96107 0.27
NP_440558.1_2 Reverse -329 -348 -5.40875 0.258
NP_441878.1_6 Reverse -63 -73 20.2362 0.0046
NP_441878.1_6 Forward -74 -64 10.5014 0.0176
NP_441036.1_8 Forward -74 -64 15.713 0.00724
NP_441036.1_8 Forward -211 -201 12.9597 0.0606
NP_441036.1_8 Reverse -63 -73 8.4365 0.174
NP_441557.1_5 Forward -73 -64 19.9609 0.000699
NP_441557.1_5 Reverse -64 -73 19.9609 0.000699
NP_441445.1_1 Forward -82 -63 1.57275 0.252
NP_442066.2_4 Reverse -106 -125 -9.14533 0.296
NP_442419.1_2 Forward -170 -151 -3.54046 0.265
NP_442183.1_1 Reverse -64 -78 9.73436 0.094
NP_442183.1_1 Reverse -196 -210 6.98109 0.153
NP_442397.1_9 Forward -73 -54 12.7825 0.226
NP_442170.1_5 Reverse -64 -83 -2.0655 0.254
NP_442347.1_2 Reverse -339 -348 10.5211 0.058
NP_442347.1_2 Forward -72 -63 3.34298 0.284
NP_442347.1_2 Reverse -65 -74 3.34298 0.284
NP_442645.1_2 Reverse -56 -75 4.42435 0.0238
NP_442645.1_2 Forward -207 -188 -17.0118 0.246
NP_442645.1_2 Forward -81 -62 -22.125 0.29
NP_441037.1_4 Reverse -62 -72 17.3558 0.0127
NP_441037.1_4 Forward -75 -65 15.0168 0.028
NP_442594.1_8 Reverse -374 -393 14.7491 0.146
NP_441633.1_3 Forward -75 -62 3.46087 0.0699
NP_441633.1_3 Reverse -62 -75 -6.07724 0.236
NP_440136.1_2 Forward -72 -65 15.9687 0.0123
NP_440136.1_2 Reverse -65 -72 15.9687 0.0123
NP_442998.1_2 Reverse -287 -306 6.68515 0.257
NP_442998.1_10 Forward -71 -64 15.5754 0.0102
NP_442998.1_10 Reverse -66 -73 15.5754 0.0102
NP_440299.1_1 Reverse -60 -73 15.7516 0.0142
NP_441799.1_1 Reverse -60 -74 16.8135 0.0129
NP_441799.1_1 Forward -77 -63 8.16044 0.122
NP_441799.1_1 Forward -351 -337 6.68548 0.165
NP_441007.1_10 Forward -78 -65 2.37923 0.19
NP_441007.1_10 Reverse -59 -72 1.39592 0.203
NP_442334.1_2 Reverse -96 -113 -14.4158 0.3
NP_442201.1_10 Reverse -53 -72 -4.03212 0.152
NP_442201.1_10 Forward -84 -65 -12.4886 0.268
NP_440256.1_1 Forward -76 -57 -10.3253 0.299
NP_440456.1_8 Reverse -188 -202 14.0609 0.264
NP_440915.1_6 Reverse -60 -74 11.6026 0.0254
NP_440915.1_6 Forward -77 -63 2.65453 0.113
NP_440915.1_6 Reverse -192 -206 -0.197071 0.186
NP_440997.1_4 Forward -139 -120 11.8975 0.276
NP_441296.1_9 Reverse -276 -289 14.7683 0.18
NP_441296.1_9 Forward -65 -52 9.65513 0.277
NP_441296.1_9 Forward -382 -369 9.26181 0.282
NP_440717.1_3 Forward -380 -366 7.76712 0.28
NP_440657.1_5 Forward -282 -263 9.0459 0.275
NP_441464.1_8 Forward -73 -59 14.2576 0.127
NP_441464.1_8 Reverse -64 -78 4.81781 0.263
NP_440787.1_5 Forward -81 -67 9.83269 0.256
NP_441939.1_3 Forward -72 -53 6.4893 0.235
NP_441199.1_6 Forward -77 -58 7.07928 0.12
NP_442993.1_1 Reverse -64 -80 -9.67623 0.19
NP_440677.1_6 Reverse -187 -206 7.37428 0.298
NP_442386.1_9 Forward -74 -65 6.39082 0.219
NP_442386.1_9 Reverse -63 -72 6.39082 0.219
NP_442386.1_9 Forward -67 -58 5.60418 0.245
NP_441340.1_5 Forward -72 -65 15.6737 0.0124
NP_441340.1_5 Reverse -65 -72 15.6737 0.0124
NP_441947.1_3 Reverse -345 -363 17.2271 0.172
NP_440251.1_6 Reverse -35 -53 18.9076 0.0957
NP_442240.1_2 Reverse -107 -126 -18.8801 0.295
NP_440586.1_1 Reverse -140 -159 -5.60541 0.286
NP_440586.1_8 Forward -72 -65 13.2151 0.026
NP_440586.1_8 Reverse -65 -72 13.2151 0.026
NP_442251.1_6 Forward -72 -65 15.2804 0.0124
NP_442251.1_6 Reverse -65 -72 15.2804 0.0124
NP_440192.1_5 Reverse -367 -386 5.50599 0.234
NP_440684.1_3 Reverse -362 -381 15.4374 0.238
NP_440684.1_9 Reverse -58 -72 14.3559 0.131
NP_441262.1_3 Reverse -64 -71 14.7888 0.0223
NP_441262.1_3 Forward -73 -66 14.7888 0.0223
NP_443051.1_1 Forward -74 -65 19.5676 0.00335
NP_443051.1_1 Reverse -63 -72 18.0926 0.00402
NP_439996.1_6 Reverse -264 -283 7.81612 0.257
NP_439984.1_3 Reverse -57 -71 15.8302 0.139
NP_439937.1_9 Forward -23 -6 -14.6131 0.287
NP_440439.1_1 Forward -208 -195 6.70579 0.0743
NP_440439.1_1 Forward -76 -63 4.05085 0.107
NP_440439.1_1 Reverse -193 -206 2.47756 0.133
NP_440372.1_2 Forward -72 -65 16.3621 0.0124
NP_440372.1_2 Reverse -65 -72 16.3621 0.0124
NP_442511.1_6 Reverse -64 -83 4.03102 0.229
NP_441789.1_7 Forward -392 -373 5.40686 0.193
NP_440316.1_10 Reverse -12 -22 5.97822 0.275
NP_441572.1_1 Reverse -134 -153 -4.6221 0.235
NP_441572.1_7 Reverse -332 -351 5.11266 0.0892
NP_440267.1_2 Forward -78 -64 11.9953 0.125
NP_442384.1_10 Forward -73 -60 17.3255 0.00599
NP_442384.1_10 Reverse -338 -351 5.62415 0.124
NP_442384.1_10 Forward -383 -370 1.19926 0.267
NP_441018.1_7 Forward -351 -332 11.3075 0.188
NP_442790.1_4 Reverse -55 -74 -14.0619 0.271
NP_442262.1_10 Forward -72 -65 14.1988 0.0123
NP_442262.1_10 Reverse -65 -72 14.1988 0.0123
NP_441689.1_5 Forward -75 -65 8.3377 0.132
NP_440344.1_10 Forward -80 -63 -8.90928 0.135
NP_442910.1_1 Forward -80 -61 3.44104 0.118
NP_442832.1_3 Reverse -64 -83 16.1257 0.248
NP_442832.1_3 Forward -73 -54 15.8307 0.248
NP_441965.1_3 Reverse -54 -73 2.26107 0.212
NP_442529.1_4 Reverse -55 -74 14.9458 0.167
NP_440297.1_9 Forward -72 -62 9.61647 0.0917
NP_440297.1_9 Reverse -65 -75 -0.216628 0.282
NP_439926.1_7 Forward -229 -211 13.0972 0.128
NP_442280.1_10 Forward -148 -130 5.45442 0.284
NP_441592.1_4 Forward -73 -54 -4.22878 0.297
NP_440999.1_9 Reverse -344 -358 -1.5737 0.242
NP_440999.1_9 Reverse -276 -290 -2.26202 0.264
NP_440888.1_2 Reverse -64 -78 5.80051 0.262
NP_442892.1_6 Forward -365 -346 2.75272 0.253
NP_441123.1_6 Forward -153 -135 9.26226 0.279
NP_441917.1_4 Reverse -264 -283 16.2241 0.116
NP_441543.1_2 Reverse -65 -74 15.9293 0.00518
NP_441543.1_2 Forward -72 -63 9.34117 0.0818
NP_442845.1_2 Reverse -58 -72 9.34103 0.177
NP_442845.1_2 Forward -79 -65 7.9644 0.195
NP_442845.1_2 Reverse -51 -65 7.57108 0.195
NP_441551.1_5 Reverse -201 -217 8.31764 0.238
NP_441469.1_8 Reverse -63 -72 13.3727 0.073
NP_441469.1_8 Forward -74 -65 6.5879 0.227
NP_442315.1_1 Reverse -363 -381 8.57394 0.212
NP_442315.1_1 Reverse -378 -396 4.34571 0.272
NP_442315.1_1 Forward -207 -189 3.46073 0.288
NP_443064.1_6 Forward -73 -63 13.8273 0.0796
NP_443064.1_6 Reverse -64 -74 10.8217 0.13
NP_440257.1_1 Forward -272 -255 19.1151 0.16
NP_440257.1_1 Forward -230 -213 19.1151 0.16
NP_440257.1_3 Forward -84 -70 21.4357 0.17
NP_440257.1_5 Forward -399 -380 31.0711 0.0000495
NP_440257.1_6 Forward -274 -255 21.828 0.0601
NP_440257.1_6 Forward -232 -213 19.8614 0.118
NP_440257.1_7 Forward -353 -334 20.3909 0.0858
NP_442578.1_7 Forward -72 -65 14.5921 0.026
NP_442578.1_7 Reverse -65 -72 14.5921 0.026
NP_441462.1_2 Reverse -64 -74 20.2362 0.000805
NP_441462.1_2 Forward -73 -63 20.1379 0.000967
NP_441462.1_2 Reverse -196 -206 -0.41329 0.225
NP_441462.1_2 Forward -347 -337 -1.29827 0.299
NP_441462.1_5 Reverse -379 -398 7.17762 0.213
NP_443062.1_1 Reverse -64 -82 17.5166 0.0251
NP_441601.1_4 Forward -375 -356 -0.39387 0.275
NP_440516.1_8 Forward -73 -64 16.9127 0.00442
NP_440516.1_8 Reverse -64 -73 16.9127 0.00442
NP_440516.1_8 Forward -347 -338 -0.295266 0.232
NP_442080.1_7 Forward -321 -302 1.86774 0.205
NP_442428.1_5 Forward -72 -65 15.8704 0.0124
NP_442428.1_5 Reverse -65 -72 15.8704 0.0124
NP_442428.1_5 Reverse -339 -346 3.67736 0.298
NP_440673.1_3 Forward -71 -64 12.4288 0.0426
NP_440673.1_3 Reverse -66 -73 12.4288 0.0426
NP_440673.1_3 Forward -20 -13 6.23397 0.283
NP_441052.1_2 Forward -73 -63 10.4031 0.0285
NP_441052.1_2 Reverse -64 -74 10.4031 0.0285
NP_441052.1_2 Reverse -338 -348 8.82982 0.038
NP_441052.1_2 Reverse -326 -336 2.83163 0.19
NP_442219.1_8 Reverse -228 -247 6.62097 0.292
NP_442219.1_9 Forward -72 -63 8.25953 0.0681
NP_442219.1_9 Reverse -65 -74 8.25953 0.0681
NP_442219.1_9 Reverse -339 -348 5.11294 0.186
NP_440436.1_4 Forward -72 -63 15.9289 0.00508
NP_440436.1_4 Reverse -65 -74 9.24241 0.0871
NP_440436.1_4 Forward -370 -361 5.80084 0.182
NP_440314.1_9 Reverse -65 -84 7.86593 0.0427
NP_440314.1_9 Forward -72 -53 -8.55534 0.249
NP_440314.1_9 Forward -114 -95 -9.24366 0.262
NP_441719.1_4 Forward -72 -65 16.3621 0.0124
NP_441719.1_4 Reverse -65 -72 16.3621 0.0124
NP_441733.1_10 Forward -76 -63 6.50913 0.184
NP_442366.1_3 Reverse -63 -81 1.00246 0.16
NP_442366.1_5 Reverse -61 -71 15.4175 0.0374
NP_442366.1_5 Forward -76 -66 14.8275 0.0375
NP_441115.1_4 Reverse -186 -204 7.58986 0.279
NP_442206.1_10 Reverse -196 -211 0.176559 0.269
NP_443054.1_2 Reverse -62 -76 3.53951 0.24
NP_443054.1_2 Forward -75 -61 -0.492064 0.295
NP_441851.1_10 Reverse -63 -73 17.4829 0.0027
NP_441851.1_10 Forward -74 -64 8.53483 0.114
NP_441668.1_4 Reverse -54 -73 5.50599 0.167
NP_441668.1_4 Reverse -96 -115 -2.45882 0.288
NP_442515.1_1 Forward -74 -60 -1.47537 0.255
NP_442515.1_1 Reverse -63 -77 -4.13031 0.298
NP_441683.1_7 Reverse -364 -383 -8.06369 0.284
NP_441683.1_7 Reverse -373 -392 -8.65367 0.284
NP_440593.1_3 Forward -346 -327 3.14605 0.162
NP_441349.1_10 Forward -83 -64 7.17762 0.0326
NP_440432.1_9 Reverse -65 -80 14.0412 0.0164
NP_442944.1_10 Forward -399 -380 8.55425 0.269
NP_440474.1_8 Reverse -65 -79 4.71887 0.268
NP_440396.1_10 Forward -114 -98 11.9559 0.181
NP_440431.1_3 Forward -74 -55 -12.3902 0.299
NP_442450.1_5 Reverse -62 -72 17.3846 0.0267
NP_442450.1_5 Forward -75 -65 7.64985 0.13
NP_440588.1_2 Reverse -329 -348 -6.68705 0.289
NP_440195.1_5 Forward -79 -60 2.85105 0.276
NP_442006.1_2 Reverse -135 -152 -8.0243 0.192
NP_440483.1_1 Forward -98 -79 -7.76869 0.267
NP_441570.1_1 Reverse -64 -82 -10.4039 0.17
NP_441078.1_4 Forward -73 -64 19.6659 0.0007
NP_441078.1_4 Reverse -64 -73 19.6659 0.0007
NP_441078.1_4 Reverse -196 -205 -2.06522 0.295
NP_440539.1_9 Forward -137 -118 -5.9004 0.286
NP_441539.1_1 Forward -40 -26 10.8154 0.294
NP_441663.1_8 Reverse -332 -351 6.19431 0.127
NP_440526.1_3 Reverse -65 -76 1.92649 0.267
NP_440526.1_3 Forward -72 -61 1.72983 0.267
NP_441432.1_8 Forward -74 -65 16.8143 0.00595
NP_441432.1_8 Forward -348 -339 11.0128 0.0629
NP_441432.1_8 Reverse -63 -72 8.35786 0.0755
NP_441432.1_8 Reverse -12 -21 2.75299 0.287
NP_442320.1_8 Forward -79 -65 5.30946 0.0394
NP_441732.1_2 Forward -77 -61 -16.4611 0.167
NP_441732.1_2 Reverse -334 -350 -16.5594 0.174
NP_440760.1_1 Forward -73 -54 -1.37718 0.0297
NP_441057.1_4 Forward -31 -13 -3.6191 0.295
NP_441072.1_2 Reverse -53 -72 12.8808 0.173
NP_441072.1_2 Forward -84 -65 8.06259 0.24
NP_440713.1_4 Reverse -130 -149 2.3594 0.264
NP_442489.1_7 Forward -73 -64 20.1576 0.000695
NP_442489.1_7 Reverse -64 -73 20.1576 0.000695
NP_440559.1_1 Forward -72 -63 17.306 0.00658
NP_440559.1_1 Reverse -65 -74 8.65285 0.0586
NP_441659.2_8 Reverse -64 -74 20.9245 0.000805
NP_441659.2_8 Forward -73 -63 19.3512 0.000966
NP_442008.1_2 Forward -208 -189 2.3594 0.289
NP_442346.1_5 Reverse -63 -73 17.9746 0.00128
NP_442346.1_5 Forward -74 -64 16.303 0.00248
NP_440545.1_3 Forward -77 -60 -4.58271 0.229
NP_440545.1_5 Forward -339 -322 10.3636 0.21
NP_440743.1_8 Reverse -65 -84 15.1416 0.215
NP_440847.1_3 Forward -152 -138 12.0937 0.254
NP_441888.1_7 Reverse -343 -357 7.57108 0.225
NP_441050.1_5 Reverse -48 -66 -2.73412 0.284
NP_440449.1_6 Reverse -56 -74 9.1312 0.187
NP_441833.1_4 Forward -72 -65 15.9687 0.0124
NP_441833.1_4 Reverse -65 -72 15.9687 0.0124
NP_442162.1_9 Forward -72 -65 16.2637 0.0124
NP_442162.1_9 Reverse -65 -72 16.2637 0.0124
NP_442796.1_10 Reverse -88 -107 6.88262 0.281
NP_442073.1_6 Reverse -329 -348 -2.75381 0.291
NP_442140.1_3 Forward -72 -62 13.5497 0.0542
NP_442140.1_3 Reverse -65 -75 6.66654 0.159
NP_440875.1_9 Reverse -66 -76 7.69067 0.255
NP_441813.1_5 Reverse -62 -72 8.82982 0.0367
NP_441813.1_5 Forward -75 -65 8.63316 0.0367
NP_440590.1_4 Forward -72 -59 -0.570702 0.192
NP_440590.1_4 Forward -340 -327 -3.02898 0.252
NP_440590.1_4 Reverse -65 -78 -6.07724 0.299
NP_440567.1_1 Forward -72 -58 15.1426 0.0179
NP_440567.1_1 Reverse -65 -79 6.09611 0.0894
NP_440567.1_1 Forward -346 -332 0.491246 0.244
NP_442497.1_10 Forward -72 -63 19.8626 0.00532
NP_442497.1_10 Reverse -65 -74 17.601 0.00813
NP_440821.1_4 Reverse -62 -72 10.9931 0.0146
NP_440821.1_4 Forward -75 -65 2.24165 0.131
NP_441239.1_9 Forward -75 -63 14.6903 0.0258
NP_441239.1_9 Forward -207 -195 11.347 0.0627
NP_441239.1_9 Reverse -62 -74 10.7571 0.0723
NP_440833.1_6 Forward -64 -50 7.76712 0.278
NP_442216.1_4 Reverse -77 -85 8.27883 0.255
NP_441526.1_6 Reverse -359 -378 1.76941 0.297
NP_442138.1_10 Reverse -64 -83 -5.21209 0.268
NP_442052.1_8 Reverse -62 -72 12.7631 0.253
NP_440546.1_4 Reverse -64 -74 13.5365 0.0459
NP_440546.1_4 Forward -73 -63 12.8578 0.0572
NP_439974.1_4 Reverse -95 -114 8.84924 0.262
NP_440462.1_4 Reverse -361 -375 8.35772 0.265
NP_440462.1_6 Forward -75 -65 10.5014 0.0396
NP_440462.1_6 Forward -207 -197 5.19158 0.164
NP_440462.1_6 Reverse -62 -72 1.455 0.294
NP_440705.1_4 Reverse -48 -67 6.39097 0.296
NP_440868.1_4 Forward -77 -65 5.93884 0.0879
NP_440868.1_4 Reverse -60 -72 -0.551008 0.274
NP_442499.1_3 Reverse -270 -288 10.5406 0.234
NP_441249.1_8 Reverse -129 -148 10.2259 0.177
NP_441249.1_8 Reverse -374 -393 9.14423 0.177
NP_441474.1_1 Forward -393 -374 11.995 0.18
NP_441474.1_1 Forward -378 -359 5.40686 0.212
NP_442402.1_2 Reverse -279 -293 13.5686 0.263
NP_442402.1_4 Reverse -68 -87 -9.83437 0.293
NP_442402.1_10 Forward -103 -93 10.206 0.299
NP_441848.1_9 Forward -378 -367 11.8579 0.268
NP_440843.1_3 Reverse -46 -65 12.1925 0.199
NP_442039.1_4 Forward -72 -65 15.1821 0.0124
NP_442039.1_4 Reverse -65 -72 15.1821 0.0124
NP_441811.1_8 Reverse -58 -72 15.6342 0.162
NP_442679.1_1 Forward -254 -235 0.294447 0.204
NP_441926.1_3 Reverse -64 -80 7.72835 0.17
NP_441926.1_3 Forward -73 -57 4.3851 0.191
NP_440825.1_6 Reverse -375 -394 7.47261 0.285
NP_440825.1_7 Forward -72 -62 11.8361 0.2
NP_442837.1_3 Forward -72 -65 15.7721 0.0124
NP_442837.1_3 Reverse -65 -72 15.7721 0.0124
NP_442053.1_1 Forward -73 -64 18.3876 0.0007
NP_442053.1_1 Reverse -64 -73 18.3876 0.0007
NP_442053.1_1 Forward -198 -189 7.76787 0.0895
NP_442053.1_1 Forward -347 -338 4.62128 0.235
NP_442053.1_1 Forward -205 -196 3.83464 0.285
NP_440505.1_3 Forward -75 -65 8.04317 0.147
NP_441102.1_1 Forward -346 -327 6.78429 0.239
NP_441203.1_1 Forward -72 -53 -13.1769 0.156
NP_440914.1_1 Reverse -64 -74 16.3248 0.00196
NP_440914.1_1 Forward -73 -63 8.51751 0.186
NP_441699.1_5 Forward -136 -117 11.8975 0.173
NP_441011.1_8 Reverse -65 -74 16.6177 0.00602
NP_441011.1_8 Forward -72 -63 14.356 0.0249
NP_442101.1_10 Forward -81 -62 -6.98204 0.209
NP_442533.1_1 Reverse -365 -384 -4.13045 0.14
NP_442533.1_1 Reverse -380 -399 -7.57203 0.195
NP_442533.1_1 Reverse -362 -381 -15.7335 0.257
NP_442533.1_1 Reverse -377 -396 -16.1268 0.263
NP_442533.1_1 Reverse -371 -390 -17.8968 0.297
NP_442533.1_6 Forward -73 -64 17.2076 0.00137
NP_442533.1_6 Reverse -64 -73 17.2076 0.00137
NP_442533.1_6 Reverse -196 -205 4.12963 0.191
NP_442533.1_6 Forward -66 -57 2.55633 0.25
NP_442322.1_4 Forward -69 -52 -7.04165 0.279
NP_442322.1_4 Forward -391 -374 -8.02495 0.286
NP_442322.1_9 Forward -65 -47 11.1298 0.251
NP_442229.1_1 Forward -75 -61 7.57046 0.196
NP_443016.1_1 Forward -151 -132 3.73603 0.143
NP_441482.1_7 Reverse -58 -72 -1.18038 0.0637
NP_439944.1_9 Reverse -65 -75 9.12481 0.1
NP_439944.1_9 Forward -72 -62 8.82982 0.101
NP_442269.1_10 Reverse -123 -142 2.94938 0.262
NP_441028.1_6 Forward -148 -138 10.6976 0.197
NP_441028.1_6 Forward -27 -17 5.78111 0.243
NP_441028.1_6 Forward -102 -92 5.48612 0.255
NP_441028.1_6 Reverse -77 -87 5.48612 0.255
NP_442202.1_6 Forward -91 -72 0.196116 0.265
NP_441527.1_4 Forward -249 -230 -8.73794 0.25
NP_441527.1_4 Forward -266 -247 -13.1306 0.298
NP_441527.1_8 Forward -78 -59 1.67108 0.279
NP_440007.1_9 Forward -351 -337 1.47456 0.285
NP_441680.1_4 Reverse -334 -353 11.7008 0.153
NP_441680.1_4 Reverse -333 -352 -2.75381 0.272
NP_441972.1_5 Reverse -8 -27 -9.83364 0.293
NP_441106.1_1 Forward -74 -65 18.486 0.0028
NP_441106.1_1 Reverse -63 -72 9.73449 0.0311
NP_439903.1_6 Forward -386 -367 5.80018 0.176
NP_439903.1_6 Forward -76 -57 4.12856 0.202
NP_442306.1_10 Forward -78 -59 -20.2567 0.202
NP_441286.1_1 Forward -74 -62 6.03717 0.0258
NP_441286.1_1 Reverse -63 -75 -3.50094 0.145
NP_441286.1_1 Forward -348 -336 -5.86088 0.229
NP_440670.1_8 Forward -73 -64 18.3876 0.000699
NP_440670.1_8 Reverse -64 -73 18.3876 0.000699
NP_440886.1_7 Forward -74 -64 8.04271 0.0805
NP_440886.1_7 Reverse -63 -73 8.04271 0.0805
NP_442614.1_2 Forward -73 -59 6.29277 0.291
NP_442382.1_9 Forward -119 -100 8.06178 0.29
NP_442072.1_9 Reverse -63 -81 -1.94747 0.0316
NP_442072.1_9 Forward -74 -56 -11.6822 0.0794
NP_440907.2_8 Forward -72 -62 16.2041 0.0161
NP_440907.2_8 Reverse -65 -75 15.9091 0.0161
NP_441021.1_1 Forward -72 -53 3.53937 0.083
NP_441021.1_8 Reverse -59 -77 3.95239 0.226
NP_441463.1_3 Forward -83 -64 -1.67217 0.145
NP_441626.1_2 Forward -72 -65 15.7721 0.0124
NP_441626.1_2 Reverse -65 -72 15.7721 0.0124
NP_442365.1_7 Forward -381 -362 3.53937 0.156
NP_442794.1_1 Forward -293 -281 3.57889 0.286
NP_442615.1_1 Reverse -55 -73 9.45892 0.0254
NP_442615.1_1 Forward -82 -64 7.4923 0.0317
NP_441962.1_4 Reverse -59 -78 -13.3736 0.272
NP_440387.1_1 Forward -73 -57 16.4798 0.0047
NP_440387.1_1 Reverse -64 -80 -0.138127 0.135
NP_441431.1_2 Forward -76 -62 11.897 0.131
NP_441431.1_2 Reverse -61 -75 6.58715 0.266
NP_441993.1_1 Forward -347 -328 3.70092 0.23
NP_441993.1_1 Reverse -58 -77 2.62889 0.256
NP_440814.1_4 Forward -82 -63 -11.7019 0.228
NP_440814.1_4 Reverse -55 -74 -12.7836 0.244
NP_440114.1_10 Reverse -64 -78 18.4858 0.006
NP_440114.1_10 Forward -73 -59 14.2576 0.0429
NP_440287.1_5 Forward -113 -94 13.3716 0.206
NP_439988.1_7 Forward -71 -57 11.7987 0.292
NP_441237.1_9 Forward -72 -62 17.188 0.00445
NP_439910.1_2 Forward -81 -64 -3.10775 0.0339
NP_440457.1_1 Reverse -60 -72 10.6587 0.092
NP_440457.1_1 Reverse -370 -382 -0.944332 0.285
NP_440798.1_6 Forward -72 -59 4.24752 0.147
NP_440798.1_6 Reverse -65 -78 2.57589 0.17
NP_440054.1_4 Reverse -299 -318 14.9458 0.135
NP_442509.1_6 Reverse -362 -381 9.43923 0.294
NP_442509.1_6 Reverse -371 -390 6.29264 0.294
NP_442509.1_9 Forward -73 -63 17.3841 0.00128
NP_442509.1_9 Reverse -64 -74 8.04271 0.192
NP_442514.1_5 Forward -379 -360 -6.68779 0.27
NP_442514.1_5 Forward -153 -134 -9.34271 0.295
NP_440554.1_4 Reverse -65 -75 8.82982 0.0646
NP_441885.1_5 Forward -73 -63 11.3864 0.00668
NP_441885.1_5 Reverse -64 -74 11.3864 0.00668
NP_442341.1_9 Forward -75 -61 11.602 0.122
NP_442341.1_9 Reverse -62 -76 6.68548 0.217
NP_440191.1_4 Reverse -285 -295 12.5664 0.291
NP_443000.1_7 Forward -349 -339 14.533 0.0208
NP_443000.1_7 Forward -75 -65 10.6981 0.0345
NP_443000.1_7 Reverse -62 -72 2.04498 0.226
NP_441842.1_10 Forward -242 -228 9.04604 0.2
NP_441842.1_10 Forward -263 -249 8.75105 0.211
NP_440275.1_3 Reverse -62 -72 9.91146 0.046
NP_440275.1_3 Forward -75 -65 9.02648 0.0563
NP_440091.1_1 Forward -77 -65 1.41561 0.197
NP_441389.1_5 Reverse -183 -202 12.1925 0.251
NP_440175.1_7 Forward -351 -333 11.6077 0.23
NP_441105.1_3 Reverse -53 -72 -1.37718 0.148
NP_442373.1_2 Reverse -367 -386 -2.75381 0.198
NP_440216.1_1 Forward -73 -59 6.6861 0.0139
NP_440216.1_1 Reverse -64 -78 6.09611 0.0162
NP_440172.1_1 Reverse -64 -74 17.5813 0.00421
NP_440172.1_1 Forward -73 -63 16.303 0.00854
NP_440172.1_1 Forward -347 -337 6.17489 0.11
NP_442015.1_3 Forward -393 -374 17.5015 0.155
NP_442015.1_10 Reverse -60 -73 2.37923 0.193
NP_442015.1_10 Reverse -334 -347 -0.964025 0.289
NP_441226.1_7 Forward -72 -65 14.4934 0.0123
NP_441226.1_7 Reverse -65 -72 14.4934 0.0123
NP_441226.1_7 Forward -65 -58 5.34865 0.289
NP_440117.1_6 Reverse -148 -166 17.8171 0.12
NP_441111.1_7 Forward -72 -64 18.7023 0.00294
NP_441111.1_7 Reverse -65 -73 18.7023 0.00294
NP_441111.1_7 Reverse -339 -347 -0.570565 0.233
NP_442379.1_10 Reverse -57 -74 -0.0594896 0.223
NP_442379.1_10 Forward -80 -63 -1.82945 0.224
NP_441766.1_2 Forward -73 -64 17.5026 0.00297
NP_441766.1_2 Reverse -64 -73 17.5026 0.00297
NP_441766.1_2 Reverse -226 -235 1.86802 0.271
NP_440416.1_1 Reverse -64 -83 -13.0786 0.28
NP_440416.1_9 Forward -378 -359 -10.4236 0.141
NP_443052.1_8 Forward -83 -64 5.70265 0.0351
NP_443052.1_9 Forward -374 -355 -6.58872 0.285
NP_443052.1_9 Forward -144 -125 -6.88371 0.289
NP_442154.1_1 Reverse -126 -144 -17.4838 0.257
NP_442154.1_1 Reverse -359 -377 -18.2704 0.279
NP_440261.1_5 Reverse -339 -352 -4.89726 0.178
NP_440261.1_5 Forward -72 -59 -10.1088 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GACACCACCCCCTTCCAACTCATCCCCCTCACCATCCTCGACTGGAGTTTCCTGGCGTTCACGTTGGGCACAGCGGCTCTCCTGGTTAATCTCGGCCTTGAGTGGAACTCTGGAAATCGAAGCCGAAACCGAGCAGATCAGGAAAGAGACAGAACAGATCAAGAAAGAGACCGAGCAGATCAGGAAAGACAACGAGCGGCTCGCCGTGCTCGAATCCAAAATCGATTCTTCCTTCGACCAACACGGTATCAACTTACCCCTAGCCCAGACACCAGAGCAGCCCTAATCGATTTCCTCAGTTTCCTCCAGGAATACGGGGAATAAATAGGCGATCGCCCAACCCTTTCCCAACATACTCATTGTTAAGATTGACTAGTCCCCCGTTGCCTGTGAAATAACC

CDS

ATGGTTACCCTGCTGAAATGGACAGTTCCAGACTATCACCACCTCATTGAACAGGGGCTATTGGACGGTAAGAAAGTGGAACTTTTAGACGGAGACCTAGTGACCATGGCTCCCGAAGGACCACTCCATAGCTACACCACCACCACCGTTGCCGACTATCTGCGCCAAAACCTGCACGGATTAGCTCTAGTGAGGGAAGCCCATCCCATTACCCTGAGTCAATCTGAACCGGAACCTGACATTGCCATTGTTCTAGCTCCCCAGGAGCGCTACAAAGAAAGGCATCCTCAGGCCGACGATATTTTTTGGTTAATTGAAATAGCTAACAGTACCCAAGCCTACGACCTCAACGACAAAAAACAAATCTACGCTCAAGAAGGCATCCCCGAATATTGGGTGGCAGACCTAAGCAAACGCCAATTATTTATTTTTCGAGCACCAGACAAAGAAGATTATCGCCTGCAACAAACCCACTCCGAAGGTATCATCCGTAGCCAAGCCTTTCCCGAAATAAAAATATCAGTACAAGAAATGTTCCATTGGTAG

Protein

MVTLLKWTVPDYHHLIEQGLLDGKKVELLDGDLVTMAPEGPLHSYTTTTVADYLRQNLHGLALVREAHPITLSQSEPEPDIAIVLAPQERYKERHPQADDIFWLIEIANSTQAYDLNDKKQIYAQEGIPEYWVADLSKRQLFIFRAPDKEDYRLQQTHSEGIIRSQAFPEIKISVQEMFHW