Your browser is old and dusty. Try Google Chrome!

Details for slr1071

ORF slr1071
Accession NP_440243.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -76 -62 -1.8687 0.274
NP_442655.1_2 Reverse -335 -354 5.211 0.227
NP_442972.1_1 Reverse -96 -114 9.69237 0.271
NP_441581.1_9 Forward -271 -252 3.96249 0.296
NP_439957.1_9 Forward -329 -310 12.4613 0.187
NP_441434.1_1 Reverse -81 -95 16.1498 0.186
NP_441077.1_6 Forward -270 -254 1.8378 0.294
NP_441317.1_4 Forward -114 -100 14.0475 0.161
NP_442816.1_7 Reverse -188 -207 7.20922 0.238
NP_442690.1_1 Forward -238 -219 -5.99873 0.164
NP_442690.1_1 Forward -185 -166 -6.78538 0.169
NP_442690.1_1 Forward -150 -131 -8.45701 0.189
NP_441913.1_1 Reverse -235 -251 13.2389 0.27
NP_441712.1_3 Reverse -61 -74 12.999 0.288
NP_440106.1_3 Forward -121 -104 14.7885 0.287
NP_440345.1_3 Reverse -97 -111 15.3858 0.209
NP_441079.1_7 Forward -257 -238 -1.37794 0.202
NP_441079.1_7 Reverse -242 -261 -2.36125 0.217
NP_442172.1_1 Forward -57 -38 9.8848 0.29
NP_442256.1_10 Forward -158 -139 9.24257 0.241
NP_442288.1_3 Forward -37 -20 6.33202 0.275
NP_442933.1_1 Forward -116 -97 5.87233 0.289
NP_442933.1_2 Reverse -98 -116 12.225 0.227
NP_442933.1_6 Reverse -255 -274 13.8937 0.287
NP_440382.1_2 Forward -258 -239 11.0117 0.175
NP_442970.1_3 Forward -54 -36 11.3603 0.29
NP_442292.1_1 Reverse -292 -301 3.14632 0.205
NP_441468.1_9 Forward -46 -32 16.3225 0.282
NP_442718.1_1 Reverse -68 -87 4.32602 0.22
NP_440558.1_2 Reverse -64 -83 -4.6221 0.247
NP_442724.1_1 Reverse -166 -176 16.893 0.259
NP_442166.1_1 Forward -41 -22 1.37609 0.228
NP_440977.1_5 Reverse -37 -50 14.965 0.298
NP_441866.1_4 Forward -170 -157 13.5367 0.273
NP_440215.1_6 Forward -318 -299 16.1249 0.228
NP_440243.1_1 Forward -122 -103 20.8646 0.1
NP_440243.1_4 Forward -377 -358 19.2591 0.264
NP_440306.1_8 Forward -230 -211 -3.24622 0.281
NP_440695.1_6 Forward -236 -222 9.92656 0.276
NP_440188.1_6 Reverse -142 -153 20.7076 0.232
NP_441340.1_3 Forward -92 -73 20.1961 0.122
NP_441340.1_9 Reverse -110 -120 7.19474 0.29
NP_442488.1_7 Reverse -215 -234 9.14423 0.28
NP_441877.1_9 Reverse -32 -49 2.30045 0.292
NP_441018.1_7 Forward -156 -137 8.06259 0.256
NP_440350.1_5 Forward -159 -140 -2.16383 0.221
NP_440722.1_2 Forward -41 -22 1.17943 0.201
NP_442710.1_7 Forward -260 -241 -4.91611 0.274
NP_443062.1_1 Forward -300 -282 3.96308 0.279
NP_443062.1_6 Reverse -302 -321 6.58763 0.18
NP_442780.1_3 Reverse -199 -218 6.73176 0.269
NP_442823.1_8 Reverse -298 -317 9.83255 0.299
NP_441086.1_3 Reverse -216 -235 5.75208 0.289
NP_441086.1_7 Forward -81 -62 12.9791 0.209
NP_441115.1_4 Reverse -66 -84 8.76983 0.237
NP_442694.1_4 Forward -151 -142 13.9627 0.217
NP_442689.1_8 Forward -146 -129 5.64371 0.155
NP_440933.1_9 Forward -158 -139 14.8466 0.273
NP_441124.1_5 Forward -141 -131 11.0028 0.268
NP_441432.1_9 Forward -274 -261 10.5375 0.247
NP_441333.1_1 Reverse -197 -207 13.0198 0.217
NP_442400.1_10 Reverse -131 -144 16.7729 0.135
NP_442400.1_10 Reverse -230 -243 15.054 0.173
NP_442400.1_10 Reverse -166 -179 7.60564 0.284
NP_441329.1_6 Reverse -353 -372 7.20922 0.179
NP_442943.1_1 Reverse -219 -234 15.4514 0.0725
NP_441609.1_1 Reverse -334 -353 5.30933 0.189
NP_442254.1_1 Forward -355 -336 1.96607 0.249
NP_440227.1_2 Reverse -130 -146 8.22001 0.29
NP_440227.1_6 Reverse -217 -231 17.2002 0.212
NP_441508.1_4 Reverse -297 -311 15.2903 0.244
NP_441541.1_1 Forward -112 -94 -2.95826 0.264
NP_440833.1_6 Forward -210 -196 10.6187 0.242
NP_441617.1_6 Forward -307 -288 -4.81876 0.272
NP_441617.1_6 Forward -235 -216 -7.57203 0.292
NP_440412.1_2 Reverse -195 -214 6.78429 0.281
NP_442899.1_4 Forward -278 -262 7.13767 0.232
NP_442402.1_4 Forward -367 -348 -7.76943 0.278
NP_442923.1_6 Reverse -260 -274 11.7571 0.234
NP_442679.1_1 Forward -334 -315 -2.75381 0.242
NP_442679.1_3 Reverse -138 -156 2.0841 0.239
NP_442829.1_2 Reverse -290 -306 8.91416 0.287
NP_440263.1_5 Forward -112 -98 6.88276 0.297
NP_440854.1_7 Forward -370 -356 15.3844 0.246
NP_441697.1_5 Reverse -71 -90 -9.40638 0.268
NP_441697.1_5 Reverse -144 -163 -10.4568 0.279
NP_441527.1_4 Reverse -141 -160 0.333799 0.137
NP_441527.1_4 Reverse -98 -117 -11.2207 0.278
NP_441527.1_4 Reverse -142 -161 -12.7486 0.293
NP_441869.1_4 Forward -319 -300 14.6508 0.189
NP_440083.1_9 Reverse -150 -169 13.3863 0.278
NP_442264.1_2 Reverse -58 -75 7.11867 0.247
NP_441463.1_6 Forward -79 -65 6.12603 0.283
NP_442893.1_4 Forward -238 -219 2.55527 0.192
NP_442893.1_4 Forward -174 -155 -0.492971 0.252
NP_442238.1_7 Reverse -219 -238 15.7316 0.139
NP_441401.1_8 Reverse -159 -178 13.9214 0.194
NP_441431.1_1 Forward -195 -177 6.11347 0.245
NP_442020.1_1 Reverse -291 -310 1.57197 0.255
NP_440358.1_8 Reverse -222 -241 14.3558 0.101
NP_441425.1_2 Reverse -240 -259 13.9873 0.243
NP_440422.1_10 Forward -57 -38 7.69352 0.221
NP_440278.1_1 Forward -188 -169 11.4058 0.155
NP_441489.1_3 Reverse -220 -234 7.74647 0.249
NP_442862.1_3 Reverse -167 -184 5.34871 0.277
NP_442862.1_3 Forward -53 -36 4.26707 0.29
NP_440022.1_1 Forward -145 -131 21.2108 0.136
NP_442703.1_9 Reverse -129 -147 4.34571 0.259
NP_442703.1_9 Reverse -343 -361 4.24738 0.26
NP_440552.1_8 Forward -273 -256 12.4661 0.226
NP_441635.1_1 Reverse -240 -259 7.87766 0.236
NP_442418.1_4 Forward -271 -253 12.4159 0.224
NP_442116.1_6 Forward -267 -250 9.60133 0.227
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCGCATACGTCATTTAGATTCTACCTATATTATTCATCATTTTAATCCTAAAGCTCGGTCATTTTCTGACCAAGAAATGGATCAATCATCCAGATTTTTTGCGATGTTATGTCATTCGTTTCTATATCAATCAACTTTTAAAAATAAATGTCTATTTTCCTATGAAATTTTGAAGCAATTTATTCTTGACCCAAAATTAACCATTAAATGCATAATAAATTCATGGTCAAATTTCGAATTATTTTCTAGGTCTTTTTGTGCTTAAATTTTAAAGGCTCAAAGTTTTTATTTTGAGCTATATTTAAAATCGAATAAATTTGATATGCATTGGCATGATCATAACACTTATTTTGTAAAGACTTTGCTTTACCACTTGGATAGTATAACCACTTAAAAACC

CDS

ATGAGAAAAATTTTTTGTCAGAATGATTGGCCTGATAGCTGGAAATATAGTTATCCATACGATTTATTGGAAGTTTATGGTTCATTAAAGTTTCCTGGTTATGCTTATGCTTATGAAAGCCGAAGAAAGCATACATTAAATTTGATTAAGAGTGTCGCTAGGCCTGGAGCCAGAATTCTAGATGTAGCTGCGGCACAAGGCAATTTTACGTTAACACTAGCAGAAATGGGATACGAGGTTACTTGGAATGATTTACGCGAAGAATTAATTGATTATGTCAAACTAAAATGGGAGTCAGGTACTGTTAACTATGCACCAGGAAATATTTTTGATTTGAATTTTGACGGGCAATTTGACGTGGTTTTGATTGCGGAAGTAATCGAACATGTTGCTCATCCTGATAATTTCTTGAAAAATATTGCCAAAATGCTTAAGCCAGATGGTCATATTGTCTTAAGTACCCCTAATGGAGAGTATTTCAAAAATCATTTACCTAGATTTTCTGACTGTTCTGATCCTAGTCAATATGAAAAAATGCAATTTCAACCAAACTCAGATGGACATATTTTTTTACTTCATTTAGACGAGGTTGAACAACTAACACATCAAGCAGGATTAGTTATTAAAGAAGCTAGACTGGTGACTAATTCATTAACAAATGGCCATATTAAACTACATTATTTATTAAAGTTTTTACCCAAGTCTTGGATTTTAGTTTTTGAAAATGTAACTTGCTCTATGCCCTTATCGATAAAGCGTAAATTGCACACGACAACCCTTGTTTTGTTGTCGCATAAGAGTGAATAA

Protein

MRKIFCQNDWPDSWKYSYPYDLLEVYGSLKFPGYAYAYESRRKHTLNLIKSVARPGARILDVAAAQGNFTLTLAEMGYEVTWNDLREELIDYVKLKWESGTVNYAPGNIFDLNFDGQFDVVLIAEVIEHVAHPDNFLKNIAKMLKPDGHIVLSTPNGEYFKNHLPRFSDCSDPSQYEKMQFQPNSDGHIFLLHLDEVEQLTHQAGLVIKEARLVTNSLTNGHIKLHYLLKFLPKSWILVFENVTCSMPLSIKRKLHTTTLVLLSHKSE