Your browser is old and dusty. Try Google Chrome!

Details for slr1053

ORF slr1053
Accession NP_440358.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -378 -364 7.27608 0.104
NP_441061.1_2 Reverse -132 -146 4.22782 0.153
NP_441061.1_2 Forward -139 -125 0.294584 0.213
NP_441061.1_2 Forward -231 -217 -0.0987402 0.221
NP_440795.1_7 Forward -139 -132 14.6904 0.0123
NP_440795.1_7 Reverse -132 -139 14.6904 0.0123
NP_440795.1_7 Reverse -371 -378 8.00392 0.218
NP_441418.1_6 Forward -140 -121 -9.53865 0.0288
NP_441418.1_6 Forward -232 -213 -12.2919 0.0631
NP_441418.1_6 Reverse -131 -150 -20.1584 0.106
NP_441418.1_6 Forward -87 -68 -30.6798 0.291
NP_441480.1_2 Forward -134 -115 8.55425 0.299
NP_442291.1_5 Forward -141 -125 3.69678 0.107
NP_440897.1_6 Reverse -131 -150 0.195343 0.18
NP_441453.1_1 Forward -147 -129 5.42659 0.246
NP_441453.1_4 Reverse -131 -139 16.539 0.00633
NP_441453.1_4 Forward -140 -132 16.539 0.00633
NP_441453.1_7 Reverse -297 -304 12.9205 0.23
NP_442151.1_6 Forward -75 -61 9.83269 0.139
NP_442151.1_6 Reverse -131 -145 8.65272 0.167
NP_442151.1_6 Forward -140 -126 5.89945 0.256
NP_441818.1_1 Forward -139 -128 9.59626 0.232
NP_440226.1_1 Forward -140 -121 9.93088 0.0679
NP_440226.1_1 Reverse -131 -150 4.32602 0.196
NP_442169.1_1 Forward -126 -107 -3.54046 0.295
NP_442287.1_1 Forward -380 -370 13.7459 0.277
NP_442173.1_1 Forward -139 -131 15.4574 0.00633
NP_442173.1_1 Reverse -132 -140 15.4574 0.00633
NP_442173.1_1 Forward -9 -1 5.13263 0.226
NP_442173.1_6 Forward -120 -106 12.0943 0.19
NP_442752.1_4 Forward -140 -133 13.8055 0.0199
NP_442752.1_4 Reverse -131 -138 13.8055 0.0199
NP_442752.1_4 Reverse -370 -377 12.1338 0.0546
NP_442752.1_4 Reverse -278 -285 5.25066 0.256
NP_443027.1_4 Reverse -129 -139 16.2046 0.0437
NP_443027.1_4 Forward -142 -132 13.943 0.0452
NP_443027.1_4 Reverse -368 -378 8.4365 0.202
NP_441812.1_3 Forward -141 -127 17.8958 0.0479
NP_442975.1_10 Reverse -127 -141 12.8803 0.0459
NP_442975.1_10 Forward -144 -130 11.7987 0.0482
NP_440784.1_7 Forward -139 -132 15.9687 0.0123
NP_440784.1_7 Reverse -132 -139 15.9687 0.0123
NP_440061.1_9 Reverse -64 -78 10.717 0.123
NP_440061.1_9 Reverse -129 -143 8.55376 0.17
NP_440061.1_9 Forward -330 -316 5.70218 0.275
NP_440878.1_9 Forward -236 -217 6.4893 0.174
NP_442062.1_8 Reverse -131 -141 19.4496 0.000558
NP_442062.1_8 Forward -140 -130 10.3048 0.0493
NP_440761.1_4 Forward -145 -126 -13.1769 0.257
NP_441859.1_3 Reverse -130 -149 13.2733 0.0819
NP_441802.1_1 Reverse -374 -393 5.11266 0.286
NP_440304.1_4 Reverse -129 -139 19.9412 0.00364
NP_440304.1_4 Forward -142 -132 9.91146 0.051
NP_440304.1_4 Reverse -316 -326 3.42162 0.299
NP_442242.1_4 Forward -139 -132 14.3954 0.0124
NP_442242.1_4 Reverse -132 -139 14.3954 0.0124
NP_440044.1_8 Forward -139 -120 11.1109 0.0513
NP_440044.1_9 Reverse -125 -144 9.43841 0.246
NP_439918.1_2 Reverse -198 -217 6.98095 0.154
NP_441935.1_2 Reverse -119 -138 -2.36049 0.253
NP_441208.1_9 Reverse -128 -142 5.40779 0.267
NP_441594.1_6 Forward -215 -196 7.96426 0.166
NP_441594.1_6 Reverse -63 -82 3.73603 0.225
NP_440132.1_1 Forward -142 -124 11.3272 0.207
NP_440132.1_1 Reverse -221 -239 11.2289 0.207
NP_442110.1_7 Forward -140 -126 1.96621 0.222
NP_442726.1_7 Forward -239 -221 8.37728 0.187
NP_440856.1_4 Reverse -124 -143 -1.86883 0.205
NP_441083.1_3 Forward -214 -204 15.5158 0.138
NP_441083.1_5 Reverse -131 -141 11.3864 0.0159
NP_441083.1_5 Forward -140 -130 11.2881 0.0159
NP_441083.1_5 Forward -379 -369 6.96153 0.0717
NP_442827.1_8 Forward -148 -129 9.43841 0.07
NP_441738.1_2 Forward -138 -131 15.28 0.0102
NP_441738.1_2 Reverse -133 -140 15.28 0.0102
NP_441558.1_5 Reverse -129 -148 13.8641 0.0544
NP_441558.1_5 Reverse -368 -387 3.73603 0.299
NP_440209.1_1 Reverse -131 -139 18.1123 0.00295
NP_440209.1_1 Forward -140 -132 18.1123 0.00295
NP_442889.1_8 Forward -143 -129 9.93039 0.0933
NP_440447.1_6 Forward -148 -130 16.0471 0.0445
NP_442398.1_4 Reverse -323 -342 6.68515 0.274
NP_441713.1_1 Forward -146 -127 -3.83545 0.113
NP_441713.1_4 Forward -378 -359 12.3892 0.173
NP_440178.1_7 Forward -141 -122 -13.6686 0.141
NP_440659.1_9 Reverse -122 -141 8.35759 0.297
NP_442570.1_3 Reverse -362 -381 2.45773 0.187
NP_442570.1_3 Forward -241 -222 -7.27704 0.269
NP_442570.1_3 Reverse -246 -265 -8.35868 0.285
NP_441716.1_1 Forward -379 -365 7.47274 0.169
NP_442111.1_4 Reverse -130 -144 8.45605 0.0744
NP_441163.1_1 Forward -295 -278 8.78956 0.226
NP_441163.1_1 Reverse -209 -226 7.3146 0.245
NP_440906.1_5 Forward -139 -132 15.8704 0.0124
NP_440906.1_5 Reverse -132 -139 15.8704 0.0124
NP_440747.1_10 Reverse -128 -140 -1.92764 0.0192
NP_440747.1_10 Forward -143 -131 -2.1243 0.0225
NP_441130.1_10 Forward -142 -128 9.34103 0.126
NP_441486.1_1 Reverse -128 -142 3.93283 0.0522
NP_441486.1_1 Reverse -367 -381 -3.73699 0.181
NP_441486.1_1 Forward -143 -129 -5.40861 0.237
NP_441486.1_1 Reverse -220 -234 -6.29359 0.288
NP_442330.1_4 Forward -350 -331 12.6039 0.286
NP_442330.1_4 Forward -353 -334 12.2135 0.289
NP_442634.1_3 Reverse -120 -139 9.43841 0.254
NP_442634.1_4 Forward -142 -128 5.80112 0.051
NP_442634.1_4 Reverse -129 -143 -3.44199 0.161
NP_440403.1_4 Reverse -214 -233 -5.40875 0.22
NP_440403.1_10 Reverse -122 -141 1.37609 0.291
NP_440403.1_10 Reverse -214 -233 0.58944 0.3
NP_441014.1_10 Forward -141 -122 -0.0996487 0.246
NP_441014.1_10 Forward -76 -57 -3.44288 0.3
NP_442848.1_1 Reverse -125 -139 -2.85201 0.263
NP_442848.1_1 Reverse -364 -378 -3.83532 0.273
NP_442848.1_9 Forward -238 -219 4.32602 0.206
NP_441012.1_4 Forward -230 -217 8.67241 0.272
NP_443018.1_3 Forward -139 -132 14.8871 0.0123
NP_443018.1_3 Reverse -132 -139 14.8871 0.0123
NP_443018.1_3 Reverse -371 -378 4.07068 0.299
NP_441316.1_7 Reverse -129 -144 4.99478 0.121
NP_441634.1_8 Reverse -129 -143 4.03116 0.138
NP_441634.1_8 Reverse -368 -382 0.687908 0.219
NP_440376.1_1 Forward -140 -131 19.4693 0.000692
NP_440376.1_1 Reverse -131 -140 19.4693 0.000692
NP_440376.1_1 Reverse -223 -232 10.2261 0.0314
NP_440376.1_1 Reverse -370 -379 3.93297 0.188
NP_440376.1_1 Reverse -197 -206 2.16301 0.233
NP_440376.1_1 Forward -219 -210 2.06468 0.236
NP_440376.1_1 Forward -113 -104 1.86802 0.238
NP_441588.1_4 Forward -138 -128 6.66654 0.185
NP_442687.1_7 Forward -141 -131 15.8113 0.0125
NP_442687.1_7 Forward -349 -339 10.1081 0.0994
NP_442687.1_7 Reverse -130 -140 9.02648 0.0994
NP_442687.1_7 Forward -380 -370 4.40493 0.249
NP_441797.1_7 Forward -72 -54 10.0489 0.292
NP_442485.1_3 Reverse -120 -139 0.982764 0.234
NP_441846.1_10 Reverse -231 -250 -22.3217 0.259
NP_440642.1_10 Forward -70 -56 1.86729 0.287
NP_440042.1_2 Forward -150 -131 8.45592 0.184
NP_442296.1_5 Forward -388 -369 3.24438 0.251
NP_442296.1_9 Forward -378 -359 -0.0988766 0.197
NP_440360.1_5 Reverse -104 -123 -4.22878 0.297
NP_440360.1_10 Reverse -133 -147 3.8345 0.227
NP_440360.1_10 Reverse -62 -76 2.5562 0.262
NP_442658.1_1 Forward -142 -132 18.7607 0.00222
NP_442658.1_1 Reverse -129 -139 13.0576 0.04
NP_442658.1_1 Reverse -115 -125 5.58445 0.262
NP_440656.1_8 Reverse -120 -139 20.5506 0.0161
NP_442544.1_2 Forward -133 -119 -1.67204 0.287
NP_441414.1_9 Reverse -131 -150 20.649 0.00643
NP_441487.1_9 Forward -217 -198 -2.85214 0.296
NP_441487.1_9 Forward -141 -122 -3.04881 0.298
NP_442937.1_5 Forward -86 -67 6.98095 0.265
NP_441958.1_5 Reverse -130 -140 21.2195 0.000805
NP_441958.1_5 Forward -141 -131 12.2714 0.00183
NP_440651.1_1 Forward -87 -68 6.68596 0.282
NP_442486.1_2 Forward -273 -254 12.5858 0.11
NP_442486.1_6 Forward -385 -366 -5.40875 0.279
NP_442836.1_5 Forward -81 -62 13.7658 0.0598
NP_442836.1_5 Forward -212 -193 1.86774 0.271
NP_440203.1_5 Forward -17 -7 13.2542 0.122
NP_440203.1_5 Forward -376 -366 10.9926 0.206
NP_439905.1_1 Reverse -132 -145 16.6372 0.0578
NP_440984.1_7 Forward -145 -131 12.4876 0.122
NP_440984.1_7 Reverse -212 -226 4.71948 0.292
NP_441162.1_3 Reverse -354 -373 7.86593 0.275
NP_439990.1_5 Forward -145 -132 9.45906 0.142
NP_441338.2_5 Reverse -231 -250 5.211 0.275
NP_442911.1_2 Forward -150 -131 17.3057 0.00785
NP_440153.1_8 Reverse -66 -79 -3.02898 0.276
NP_442064.1_1 Forward -145 -126 -12.6852 0.279
NP_443055.1_6 Reverse -123 -141 4.63995 0.181
NP_442236.1_3 Forward -84 -65 9.0459 0.238
NP_440993.1_2 Reverse -126 -142 17.4631 0.0466
NP_440993.1_3 Forward -85 -66 13.47 0.066
NP_440993.1_3 Forward -377 -358 -1.37794 0.28
NP_440993.1_4 Forward -379 -362 3.87375 0.28
NP_440602.1_8 Forward -140 -126 13.3726 0.174
NP_441099.1_5 Forward -249 -230 -1.18052 0.105
NP_441099.1_5 Reverse -121 -140 -5.40875 0.151
NP_441099.1_5 Forward -150 -131 -11.6036 0.287
NP_442002.1_9 Forward -141 -134 10.7572 0.185
NP_440809.1_9 Forward -149 -131 -7.94566 0.225
NP_441294.1_7 Forward -383 -369 15.6819 0.0213
NP_441294.1_7 Reverse -100 -114 9.4426 0.244
NP_441294.1_7 Reverse -62 -76 9.34661 0.249
NP_441646.1_1 Forward -147 -128 -0.39387 0.264
NP_441646.1_1 Reverse -344 -363 -1.67217 0.293
NP_441000.1_6 Forward -141 -127 3.44117 0.111
NP_442771.1_1 Reverse -129 -147 -8.63398 0.2
NP_440147.1_4 Reverse -129 -142 11.819 0.0326
NP_440147.1_4 Forward -142 -129 2.77255 0.202
NP_441550.1_8 Reverse -129 -139 13.0576 0.0273
NP_441550.1_8 Forward -142 -132 10.501 0.066
NP_441916.1_7 Forward -140 -130 18.9579 0.00144
NP_441916.1_7 Reverse -131 -141 18.4663 0.00144
NP_441916.1_7 Reverse -223 -233 2.92996 0.235
NP_441041.1_4 Reverse -131 -150 -8.06369 0.196
NP_441041.1_4 Reverse -223 -242 -10.9153 0.238
NP_441041.1_4 Reverse -152 -171 -11.2103 0.242
NP_441041.1_4 Forward -140 -121 -12.4886 0.266
NP_441041.1_4 Reverse -370 -389 -13.1769 0.282
NP_441041.1_7 Forward -143 -131 10.1386 0.102
NP_441041.1_7 Reverse -128 -140 9.65268 0.108
NP_442396.1_5 Forward -144 -131 9.65572 0.129
NP_441547.1_2 Reverse -186 -204 2.96908 0.292
NP_441547.1_2 Reverse -359 -377 2.87075 0.294
NP_442004.1_6 Forward -379 -365 2.45787 0.264
NP_441725.1_5 Forward -139 -129 11.1898 0.0247
NP_441725.1_5 Reverse -132 -142 9.02648 0.0553
NP_441725.1_5 Forward -378 -368 -1.10161 0.288
NP_439966.1_7 Forward -142 -132 17.4824 0.00636
NP_439966.1_7 Reverse -129 -139 14.8275 0.0177
NP_439966.1_7 Forward -289 -279 12.3692 0.043
NP_439966.1_9 Forward -142 -133 10.7178 0.0863
NP_439966.1_9 Reverse -276 -285 7.27622 0.253
NP_440202.1_8 Reverse -123 -142 11.9461 0.272
NP_442941.1_3 Forward -139 -129 19.9412 0.00262
NP_442941.1_3 Reverse -132 -142 2.53664 0.14
NP_442941.1_3 Forward -378 -368 0.57002 0.199
NP_440289.1_2 Reverse -128 -141 6.70579 0.0591
NP_440289.1_2 Forward -143 -130 3.36254 0.0799
NP_440983.1_5 Reverse -211 -230 -9.14533 0.3
NP_442281.1_1 Reverse -126 -140 17.8952 0.00513
NP_442281.1_1 Forward -237 -223 5.89884 0.142
NP_441334.1_7 Forward -142 -123 -19.6667 0.275
NP_440018.1_3 Reverse -67 -86 5.211 0.28
NP_440018.1_9 Reverse -207 -226 18.9773 0.1
NP_440177.1_1 Forward -230 -212 4.44404 0.272
NP_442256.1_2 Forward -381 -363 -8.14232 0.217
NP_442256.1_2 Forward -142 -124 -8.92897 0.241
NP_440437.1_1 Reverse -125 -144 -1.67217 0.205
NP_442982.1_5 Reverse -121 -140 1.0811 0.233
NP_441644.1_6 Forward -140 -130 19.0557 0.000803
NP_441644.1_6 Reverse -131 -141 10.1076 0.0628
NP_441644.1_6 Forward -232 -222 5.38779 0.194
NP_441644.1_6 Forward -379 -369 3.32285 0.288
NP_443049.1_5 Reverse -105 -124 16.4207 0.185
NP_443049.1_6 Reverse -369 -379 13.6904 0.149
NP_442215.1_2 Forward -77 -61 0.0585348 0.157
NP_442215.1_2 Forward -142 -126 -4.75968 0.239
NP_442029.1_10 Reverse -341 -360 7.47261 0.264
NP_440253.1_2 Forward -140 -122 18.3087 0.00894
NP_440253.1_2 Reverse -131 -149 5.32902 0.0936
NP_440253.1_2 Reverse -239 -257 0.510803 0.184
NP_440929.1_8 Forward -140 -131 19.2726 0.000701
NP_440929.1_8 Reverse -131 -140 19.2726 0.000701
NP_440929.1_8 Forward -360 -351 0.884706 0.293
NP_442933.1_10 Forward -140 -131 17.601 0.00325
NP_442933.1_10 Reverse -131 -140 17.601 0.00325
NP_441751.2_8 Forward -139 -125 5.60446 0.0419
NP_441751.2_8 Reverse -132 -146 -5.40861 0.206
NP_442554.1_8 Forward -139 -129 16.9913 0.0065
NP_442554.1_8 Reverse -132 -142 16.008 0.0065
NP_442554.1_8 Forward -378 -368 4.99491 0.163
NP_441762.1_7 Reverse -130 -142 12.527 0.0142
NP_441762.1_7 Forward -141 -129 2.20226 0.0676
NP_441762.1_7 Forward -288 -276 -5.76255 0.238
NP_442313.1_5 Reverse -292 -311 4.52268 0.272
NP_442142.1_4 Reverse -128 -141 16.1449 0.0264
NP_442142.1_4 Forward -143 -130 6.50855 0.163
NP_442142.1_4 Reverse -72 -85 5.82024 0.182
NP_442142.1_4 Reverse -69 -82 2.37867 0.294
NP_442292.1_1 Forward -139 -130 17.5026 0.00435
NP_442292.1_1 Reverse -132 -141 9.63616 0.0183
NP_442292.1_1 Forward -378 -369 5.70292 0.135
NP_442476.1_6 Reverse -132 -146 6.09611 0.13
NP_439989.1_6 Reverse -214 -233 5.11266 0.296
NP_442381.1_8 Forward -143 -124 -12.8819 0.267
NP_443009.1_5 Reverse -130 -141 19.626 0.00102
NP_443009.1_5 Forward -141 -130 7.82632 0.118
NP_442408.2_1 Forward -140 -121 -1.47551 0.239
NP_442092.1_4 Forward -313 -294 15.4366 0.227
NP_441715.1_4 Forward -139 -129 14.238 0.0295
NP_441715.1_4 Reverse -132 -142 9.32148 0.097
NP_441198.1_8 Reverse -129 -139 13.2713 0.108
NP_440379.1_5 Reverse -220 -239 -0.590531 0.184
NP_440379.1_6 Forward -349 -330 7.07928 0.241
NP_441468.1_1 Forward -139 -132 15.8704 0.0124
NP_441468.1_1 Reverse -132 -139 15.8704 0.0124
NP_441468.1_1 Reverse -371 -378 10.2655 0.0906
NP_441020.2_6 Forward -142 -125 18.7217 0.0111
NP_441020.2_6 Reverse -129 -146 11.3469 0.123
NP_441015.1_10 Reverse -211 -230 -7.37537 0.266
NP_441015.1_10 Reverse -214 -233 -9.53865 0.282
NP_441673.1_1 Forward -140 -131 20.8459 0.000698
NP_441673.1_1 Reverse -131 -140 20.8459 0.000698
NP_441426.1_6 Reverse -337 -356 15.6341 0.154
NP_441826.1_2 Forward -81 -67 9.34103 0.0612
NP_441826.1_2 Forward -232 -218 4.42448 0.103
NP_441826.1_5 Forward -353 -334 12.3892 0.138
NP_442490.1_9 Forward -152 -133 -3.14714 0.227
NP_442868.1_6 Forward -142 -132 8.53483 0.0555
NP_442868.1_6 Reverse -129 -139 1.06167 0.205
NP_442719.1_2 Reverse -318 -336 -10.1096 0.269
NP_441056.1_1 Forward -140 -121 -1.86883 0.193
NP_440785.1_2 Forward -49 -30 7.07928 0.223
NP_442227.1_2 Forward -377 -358 -1.37718 0.262
NP_442361.1_3 Reverse -125 -138 7.98409 0.285
NP_442808.1_1 Forward -141 -131 18.4657 0.00201
NP_442808.1_1 Reverse -130 -140 8.73102 0.0481
NP_442808.1_1 Forward -240 -230 5.09279 0.173
NP_442808.1_1 Forward -380 -370 4.01116 0.212
NP_441101.1_7 Forward -83 -64 17.7974 0.209
NP_442542.1_2 Forward -142 -129 12.3107 0.114
NP_442542.1_9 Reverse -124 -138 8.65209 0.152
NP_442542.1_9 Reverse -210 -224 5.50552 0.261
NP_442050.1_5 Reverse -129 -139 18.0724 0.00365
NP_442050.1_5 Forward -142 -132 8.23937 0.234
NP_442342.1_9 Forward -142 -126 3.89344 0.258
NP_440558.1_2 Forward -383 -364 -2.16383 0.223
NP_440558.1_2 Reverse -148 -167 -2.55715 0.229
NP_440558.1_2 Reverse -342 -361 -5.80207 0.264
NP_440558.1_2 Reverse -122 -141 -6.68705 0.279
NP_442789.1_4 Forward -142 -123 1.57275 0.185
NP_441518.1_3 Reverse -121 -140 7.57094 0.05
NP_441878.1_6 Reverse -130 -140 10.5014 0.0176
NP_441878.1_6 Forward -141 -131 10.4031 0.0176
NP_441878.1_6 Forward -233 -223 0.57002 0.14
NP_441878.1_6 Forward -380 -370 -0.41329 0.177
NP_441878.1_6 Reverse -222 -232 -7.88644 0.278
NP_441036.1_8 Forward -141 -131 17.7779 0.000554
NP_441036.1_8 Reverse -130 -140 15.713 0.00724
NP_441557.1_5 Forward -140 -131 19.9609 0.000699
NP_441557.1_5 Reverse -131 -140 19.9609 0.000699
NP_441445.1_1 Reverse -361 -380 2.16274 0.24
NP_441590.1_4 Forward -326 -307 5.70185 0.27
NP_442066.2_9 Forward -144 -131 20.0788 0.00699
NP_442419.1_2 Forward -231 -212 -1.08219 0.246
NP_441308.1_8 Reverse -129 -139 13.353 0.218
NP_441308.1_8 Forward -142 -132 9.22315 0.226
NP_441308.1_8 Forward -289 -279 8.73149 0.248
NP_440101.1_6 Reverse -215 -234 10.6192 0.284
NP_442830.1_5 Forward -240 -226 4.71887 0.239
NP_442183.1_1 Forward -140 -126 18.5841 0.00743
NP_442183.1_1 Reverse -131 -145 13.3726 0.0437
NP_441407.1_5 Reverse -121 -140 17.994 0.0626
NP_442170.1_5 Forward -140 -121 6.78429 0.125
NP_442347.1_2 Reverse -132 -141 11.1111 0.056
NP_442347.1_2 Forward -378 -369 5.89959 0.21
NP_442347.1_2 Reverse -105 -114 4.0313 0.284
NP_442347.1_2 Forward -139 -130 3.34298 0.284
NP_441037.1_4 Forward -142 -132 16.2838 0.0168
NP_441037.1_4 Reverse -129 -139 7.31769 0.237
NP_442594.1_8 Reverse -301 -320 11.4058 0.167
NP_442317.1_6 Forward -145 -126 12.8808 0.158
NP_441633.1_3 Reverse -129 -142 3.95252 0.0699
NP_441633.1_3 Forward -329 -316 2.2809 0.1
NP_441633.1_3 Forward -142 -129 -3.91395 0.177
NP_440136.1_2 Forward -139 -132 15.9687 0.0123
NP_440136.1_2 Reverse -132 -139 15.9687 0.0123
NP_440136.1_2 Reverse -371 -378 4.26735 0.218
NP_440136.1_2 Reverse -279 -286 3.97235 0.288
NP_442590.1_10 Reverse -217 -236 5.60432 0.258
NP_442998.1_10 Forward -138 -131 15.5754 0.0102
NP_442998.1_10 Reverse -133 -140 15.5754 0.0102
NP_440899.1_1 Reverse -359 -378 8.40744 0.231
NP_440899.1_2 Reverse -120 -139 16.0265 0.0666
NP_440299.1_1 Forward -144 -131 10.3434 0.0573
NP_441799.1_1 Reverse -127 -141 13.7653 0.03
NP_441799.1_1 Forward -144 -130 12.2903 0.0441
NP_441799.1_1 Forward -383 -369 6.88214 0.158
NP_441799.1_9 Reverse -130 -149 -2.26216 0.213
NP_440640.1_6 Forward -90 -71 0.491109 0.272
NP_442802.1_6 Reverse -130 -149 18.0924 0.0174
NP_441007.1_10 Forward -145 -132 4.14919 0.182
NP_441007.1_10 Reverse -126 -139 2.47756 0.186
NP_442201.1_10 Reverse -199 -218 -14.6519 0.285
NP_440256.1_1 Reverse -128 -147 -2.26216 0.115
NP_440256.1_1 Forward -143 -124 -2.45882 0.118
NP_440087.1_1 Reverse -230 -249 -2.95047 0.218
NP_441559.1_8 Forward -118 -104 -4.7203 0.236
NP_441559.1_8 Forward -145 -131 -6.39192 0.277
NP_441270.1_5 Forward -129 -110 12.6039 0.236
NP_440915.1_6 Forward -144 -130 14.3559 0.0187
NP_442158.1_4 Reverse -155 -165 11.4848 0.271
NP_441296.1_9 Forward -379 -366 9.65513 0.277
NP_440717.1_1 Forward -366 -347 4.81767 0.289
NP_441704.1_8 Forward -151 -132 5.2102 0.3
NP_442866.1_1 Forward -145 -126 2.16274 0.158
NP_442866.1_1 Reverse -146 -165 -6.58872 0.255
NP_442866.1_1 Reverse -353 -372 -9.53865 0.294
NP_440748.1_5 Forward -376 -357 3.34271 0.21
NP_441464.1_8 Reverse -131 -145 6.6861 0.226
NP_441464.1_10 Forward -121 -107 7.47274 0.296
NP_440695.1_5 Reverse -131 -150 -1.67217 0.287
NP_441199.1_5 Reverse -109 -128 15.5357 0.099
NP_441199.1_6 Reverse -127 -146 3.93269 0.175
NP_442993.1_1 Forward -140 -124 -0.138127 0.0696
NP_442993.1_1 Reverse -278 -294 -9.67623 0.19
NP_442993.1_1 Reverse -131 -147 -9.67623 0.19
NP_440677.1_1 Forward -149 -130 11.1109 0.163
NP_442386.1_9 Forward -141 -132 15.7322 0.0144
NP_442386.1_9 Reverse -369 -378 10.2257 0.136
NP_442386.1_9 Forward -240 -231 8.75075 0.184
NP_442386.1_9 Forward -288 -279 7.86578 0.215
NP_442386.1_9 Reverse -277 -286 6.39082 0.219
NP_442386.1_9 Reverse -130 -139 6.39082 0.219
NP_441340.1_5 Forward -139 -132 15.6737 0.0124
NP_441340.1_5 Reverse -132 -139 15.6737 0.0124
NP_441947.1_4 Reverse -120 -139 17.7974 0.0763
NP_440168.1_9 Forward -142 -123 -5.99873 0.296
NP_440161.1_3 Forward -142 -123 9.63589 0.238
NP_440586.1_8 Forward -139 -132 13.2151 0.026
NP_440586.1_8 Reverse -132 -139 13.2151 0.026
NP_442251.1_6 Forward -139 -132 15.2804 0.0124
NP_442251.1_6 Reverse -132 -139 15.2804 0.0124
NP_442251.1_6 Forward -9 -2 8.69224 0.199
NP_440192.1_5 Reverse -235 -254 4.03102 0.268
NP_441262.1_3 Reverse -131 -138 14.7888 0.0223
NP_441262.1_3 Forward -140 -133 14.7888 0.0223
NP_440027.1_3 Reverse -66 -84 14.0797 0.12
NP_440027.1_3 Reverse -59 -77 7.58986 0.208
NP_440027.1_8 Reverse -194 -213 4.03023 0.294
NP_443051.1_1 Reverse -130 -139 19.5676 0.00335
NP_443051.1_1 Forward -141 -132 10.4228 0.00754
NP_439937.1_9 Reverse -130 -147 -6.45167 0.157
NP_439937.1_9 Reverse -112 -129 -14.1214 0.287
NP_439937.1_9 Reverse -369 -386 -16.383 0.287
NP_440408.1_3 Forward -81 -62 0.786102 0.204
NP_440439.1_1 Forward -143 -130 9.2624 0.0465
NP_440439.1_1 Reverse -128 -141 9.06573 0.0475
NP_440439.1_1 Reverse -220 -233 -1.16069 0.255
NP_442239.1_8 Forward -238 -219 8.06259 0.252
NP_440372.1_2 Forward -139 -132 16.3621 0.0124
NP_440372.1_2 Reverse -132 -139 16.3621 0.0124
NP_440372.1_2 Reverse -279 -286 4.07068 0.262
NP_441789.1_7 Forward -249 -230 -5.21283 0.294
NP_440316.1_10 Reverse -229 -239 8.04317 0.24
NP_441803.1_2 Reverse -61 -80 -0.590531 0.282
NP_439977.1_5 Forward -146 -127 9.24257 0.0937
NP_440139.1_1 Reverse -125 -144 3.24359 0.211
NP_440267.1_2 Reverse -126 -140 18.7801 0.0237
NP_442384.1_10 Reverse -131 -144 8.08242 0.0692
NP_442384.1_10 Reverse -104 -117 4.44418 0.157
NP_442384.1_10 Forward -20 -7 2.77255 0.213
NP_442114.1_4 Reverse -131 -142 12.1534 0.107
NP_440364.1_6 Reverse -216 -229 13.195 0.29
NP_441018.1_7 Forward -129 -110 13.2741 0.139
NP_442790.1_4 Forward -149 -130 -8.85033 0.176
NP_442262.1_10 Forward -139 -132 14.1988 0.0123
NP_442262.1_10 Reverse -132 -139 14.1988 0.0123
NP_441689.1_5 Reverse -129 -139 17.8758 0.0158
NP_440163.1_10 Reverse -220 -230 8.53483 0.271
NP_440344.1_10 Reverse -124 -141 5.74204 0.0197
NP_440344.1_10 Forward -147 -130 -0.551145 0.0435
NP_440344.1_10 Reverse -271 -288 -3.79607 0.0876
NP_440344.1_10 Forward -239 -222 -6.54933 0.114
NP_440344.1_10 Forward -386 -369 -12.0559 0.239
NP_440531.1_6 Reverse -123 -142 -5.11376 0.293
NP_442123.1_3 Forward -140 -121 16.2241 0.0904
NP_442123.1_3 Reverse -131 -150 12.0942 0.212
NP_440562.1_10 Reverse -122 -140 9.45892 0.284
NP_441965.1_10 Forward -143 -127 2.02515 0.292
NP_442750.1_3 Forward -143 -124 -4.22878 0.204
NP_442529.1_4 Forward -149 -130 11.7992 0.175
NP_440297.1_9 Forward -139 -129 9.22315 0.0917
NP_440297.1_9 Forward -378 -368 -0.216628 0.282
NP_440297.1_9 Reverse -132 -142 -0.216628 0.282
NP_440350.1_5 Reverse -156 -175 -2.26216 0.225
NP_441592.1_4 Forward -373 -354 -4.03212 0.293
NP_441896.1_3 Forward -149 -130 7.17762 0.0973
NP_440894.1_10 Forward -145 -126 8.45592 0.176
NP_440999.1_9 Forward -144 -130 9.2427 0.0667
NP_440999.1_9 Forward -227 -213 -3.147 0.287
NP_440888.1_2 Reverse -131 -145 16.0269 0.00832
NP_440888.1_2 Forward -140 -126 13.5686 0.027
NP_440888.1_2 Forward -379 -365 12.8803 0.0369
NP_440888.1_2 Forward -232 -218 5.50552 0.276
NP_440888.1_2 Forward -367 -353 5.40719 0.28
NP_440600.1_1 Reverse -56 -75 12.0793 0.298
NP_440179.1_6 Reverse -132 -151 4.71934 0.246
NP_441345.1_8 Forward -85 -66 12.5858 0.26
NP_442225.1_10 Forward -383 -364 5.80018 0.287
NP_441748.1_9 Forward -136 -117 16.2232 0.109
NP_442033.1_10 Forward -299 -280 -11.8003 0.258
NP_441759.1_2 Reverse -123 -142 13.2741 0.0831
NP_441543.1_2 Reverse -132 -141 18.486 0.00236
NP_441543.1_2 Forward -139 -130 15.9293 0.00518
NP_441543.1_2 Forward -378 -369 5.01461 0.209
NP_442845.1_2 Reverse -364 -378 6.3911 0.21
NP_441551.1_5 Forward -144 -128 10.4809 0.193
NP_441178.1_6 Forward -242 -223 6.58682 0.268
NP_441178.1_6 Forward -382 -363 5.89851 0.268
NP_441319.1_8 Forward -146 -128 8.86894 0.227
NP_440982.1_1 Forward -373 -354 10.7167 0.212
NP_441469.1_8 Forward -141 -132 16.126 0.00797
NP_441469.1_8 Forward -380 -371 11.2095 0.176
NP_441469.1_8 Reverse -130 -139 6.5879 0.227
NP_441469.1_8 Forward -288 -279 6.48957 0.227
NP_443064.1_6 Forward -140 -130 10.8217 0.13
NP_442337.1_8 Reverse -359 -378 4.916 0.21
NP_442578.1_7 Forward -139 -132 14.5921 0.026
NP_442578.1_7 Reverse -132 -139 14.5921 0.026
NP_441462.1_2 Forward -140 -130 20.2362 0.000805
NP_441462.1_2 Reverse -131 -141 11.5831 0.00406
NP_441462.1_2 Reverse -223 -233 7.15819 0.0583
NP_441621.1_7 Forward -142 -128 4.12949 0.0934
NP_441621.1_7 Reverse -129 -143 -3.147 0.188
NP_443062.1_1 Reverse -131 -149 11.4711 0.0984
NP_443062.1_1 Forward -287 -269 6.20575 0.206
NP_443062.1_1 Forward -140 -122 3.67056 0.289
NP_443062.1_6 Forward -86 -67 8.84924 0.135
NP_441601.1_4 Forward -230 -211 4.42435 0.191
NP_441601.1_4 Forward -227 -208 -5.99873 0.295
NP_442204.1_1 Reverse -127 -138 0.157002 0.283
NP_442204.1_1 Reverse -219 -230 -0.432984 0.299
NP_440516.1_2 Forward -293 -275 0.21581 0.235
NP_440516.1_2 Forward -219 -201 -2.43913 0.299
NP_440516.1_8 Forward -140 -131 16.9127 0.00442
NP_440516.1_8 Reverse -131 -140 16.9127 0.00442
NP_440516.1_8 Reverse -370 -379 -0.491928 0.262
NP_441033.1_2 Reverse -268 -287 -7.76869 0.293
NP_442428.1_5 Forward -139 -132 15.8704 0.0124
NP_442428.1_5 Reverse -132 -139 15.8704 0.0124
NP_442428.1_5 Reverse -371 -378 4.66067 0.244
NP_440783.1_5 Reverse -192 -211 -2.65548 0.272
NP_440778.1_8 Reverse -353 -372 18.0924 0.226
NP_440673.1_2 Reverse -121 -140 11.5602 0.171
NP_440673.1_3 Forward -138 -131 12.4288 0.0426
NP_440673.1_3 Reverse -133 -140 12.4288 0.0426
NP_440673.1_3 Forward -8 -1 11.3472 0.085
NP_440673.1_3 Forward -230 -223 8.8889 0.206
NP_441052.1_2 Forward -379 -369 15.6147 0.0106
NP_441052.1_2 Reverse -131 -141 10.5014 0.0285
NP_441052.1_2 Forward -140 -130 10.4031 0.0285
NP_442219.1_9 Reverse -132 -141 8.35786 0.0681
NP_442219.1_9 Forward -139 -130 8.25953 0.0681
NP_442219.1_9 Forward -378 -369 5.01461 0.193
NP_440436.1_4 Reverse -132 -141 18.1905 0.00233
NP_440436.1_4 Forward -378 -369 11.3073 0.0574
NP_440436.1_4 Forward -139 -130 9.24241 0.0871
NP_441884.1_9 Forward -143 -124 -14.0619 0.138
NP_441884.1_9 Reverse -63 -82 -21.0434 0.225
NP_441884.1_9 Reverse -128 -147 -23.01 0.284
NP_441893.1_10 Reverse -116 -135 17.7974 0.108
NP_440648.1_1 Reverse -131 -150 9.63589 0.184
NP_441719.1_4 Forward -139 -132 16.3621 0.0124
NP_441719.1_4 Reverse -132 -139 16.3621 0.0124
NP_441733.1_10 Reverse -128 -141 8.37742 0.14
NP_441733.1_10 Forward -143 -130 7.78743 0.15
NP_441363.1_4 Reverse -48 -67 6.88262 0.294
NP_442366.1_3 Forward -141 -123 3.3624 0.111
NP_440129.1_7 Reverse -334 -348 18.0925 0.287
NP_442873.1_3 Forward -150 -131 5.30853 0.259
NP_440296.1_10 Forward -143 -124 -14.7502 0.273
NP_441115.1_4 Reverse -130 -148 17.7179 0.0158
NP_442694.1_4 Forward -134 -125 11.9961 0.275
NP_442206.1_1 Reverse -131 -150 -11.1119 0.219
NP_443054.1_2 Reverse -129 -143 12.291 0.0722
NP_443054.1_2 Reverse -221 -235 -0.197071 0.288
NP_441851.1_10 Forward -141 -131 16.008 0.00552
NP_441851.1_10 Reverse -130 -140 8.53483 0.114
NP_441851.1_10 Reverse -369 -379 5.5849 0.207
NP_441851.1_10 Reverse -317 -327 4.79825 0.247
NP_442208.1_5 Forward -363 -344 -3.83545 0.258
NP_441157.1_1 Reverse -94 -108 6.48882 0.203
NP_442622.1_5 Forward -142 -123 5.70265 0.0634
NP_441542.1_4 Forward -129 -115 4.52282 0.264
NP_442856.1_7 Forward -84 -65 -1.08219 0.216
NP_442515.1_1 Reverse -65 -79 7.76774 0.0871
NP_442515.1_1 Reverse -130 -144 7.27608 0.0935
NP_442515.1_1 Forward -328 -314 -4.91696 0.298
NP_440593.1_10 Reverse -239 -258 9.0459 0.272
NP_441409.1_6 Forward -146 -127 -5.99873 0.118
NP_440432.1_9 Forward -139 -124 17.4828 0.00961
NP_442843.1_1 Reverse -231 -250 -3.3438 0.222
NP_440474.1_8 Reverse -132 -146 16.1252 0.0514
NP_440474.1_8 Forward -139 -125 12.8803 0.0782
NP_441124.1_5 Reverse -323 -333 14.918 0.21
NP_442450.1_5 Forward -381 -371 12.9597 0.115
NP_442450.1_5 Reverse -129 -139 9.41981 0.115
NP_439950.1_1 Forward -29 -20 12.2911 0.287
NP_439950.1_1 Reverse -12 -21 12.2911 0.287
NP_440195.1_4 Reverse -211 -230 10.5209 0.164
NP_440943.1_6 Reverse -247 -266 14.2574 0.267
NP_442006.1_2 Forward -306 -289 -15.1041 0.215
NP_442006.1_2 Reverse -230 -247 -17.1691 0.27
NP_443047.1_7 Forward -139 -120 9.14423 0.188
NP_441570.1_1 Forward -140 -122 8.86894 0.0129
NP_441570.1_1 Forward -75 -57 -13.6489 0.224
NP_441078.1_4 Forward -140 -131 19.6659 0.0007
NP_441078.1_4 Reverse -131 -140 19.6659 0.0007
NP_441078.1_4 Reverse -223 -232 -1.86856 0.272
NP_441078.1_4 Reverse -370 -379 -2.06522 0.295
NP_441078.1_4 Forward -379 -370 -2.06522 0.295
NP_442729.1_8 Forward -144 -131 19.1938 0.0312
NP_442729.1_8 Reverse -314 -327 7.39411 0.153
NP_442388.1_3 Reverse -128 -147 5.11266 0.282
NP_442443.1_1 Reverse -263 -282 -5.21209 0.282
NP_440526.1_3 Reverse -132 -143 2.51647 0.267
NP_440526.1_3 Forward -139 -128 1.82816 0.267
NP_440526.1_3 Forward -378 -367 0.451529 0.281
NP_441432.1_8 Reverse -130 -139 16.8143 0.00595
NP_441432.1_8 Forward -141 -132 8.25953 0.0755
NP_441432.1_8 Reverse -65 -74 5.21127 0.185
NP_441432.1_8 Reverse -369 -378 4.32629 0.223
NP_442320.1_8 Reverse -125 -139 3.73617 0.0578
NP_442320.1_8 Forward -146 -132 -1.37704 0.0817
NP_442344.1_7 Reverse -132 -151 8.65258 0.0466
NP_441732.1_2 Reverse -127 -143 -6.62797 0.0495
NP_440629.1_4 Reverse -111 -130 8.65258 0.264
NP_440760.1_1 Reverse -131 -150 -20.1584 0.221
NP_442797.1_6 Reverse -334 -353 7.54634 0.283
NP_440199.1_10 Reverse -128 -138 14.238 0.0861
NP_440913.1_1 Forward -142 -124 5.91901 0.234
NP_442400.1_10 Forward -399 -386 7.89211 0.281
NP_440713.1_4 Reverse -225 -244 8.45592 0.17
NP_440713.1_4 Reverse -360 -379 1.86774 0.277
NP_442489.1_7 Forward -140 -131 20.1576 0.000695
NP_442489.1_7 Reverse -131 -140 20.1576 0.000695
NP_442489.1_7 Reverse -223 -232 -1.37691 0.195
NP_442489.1_7 Reverse -370 -379 -1.57357 0.213
NP_442489.1_7 Forward -75 -66 -1.6719 0.235
NP_440757.1_6 Forward -144 -125 7.86593 0.3
NP_440565.1_3 Forward -243 -224 16.3539 0.218
NP_440565.1_7 Forward -365 -346 -1.27885 0.282
NP_442079.1_7 Reverse -132 -151 12.2908 0.0873
NP_442079.1_7 Forward -139 -120 2.55606 0.226
NP_440559.1_1 Reverse -132 -141 8.75118 0.0586
NP_440559.1_1 Forward -139 -130 8.65285 0.0586
NP_441659.2_8 Forward -140 -130 20.9245 0.000805
NP_441659.2_8 Reverse -131 -141 11.9764 0.0147
NP_442913.1_10 Forward -84 -65 -4.52377 0.24
NP_442913.1_10 Reverse -57 -76 -4.6221 0.242
NP_441040.1_2 Reverse -331 -350 -0.295539 0.128
NP_441040.1_2 Forward -83 -64 -6.39206 0.181
NP_441800.1_7 Reverse -61 -79 -0.669169 0.232
NP_441800.1_7 Reverse -108 -126 -2.63579 0.264
NP_440779.1_5 Forward -140 -123 -6.05768 0.159
NP_442346.1_5 Reverse -130 -140 16.303 0.00248
NP_442346.1_5 Forward -141 -131 9.02648 0.118
NP_442346.1_5 Reverse -65 -75 6.76487 0.192
NP_442346.1_6 Reverse -105 -124 18.7807 0.0989
NP_442346.1_10 Forward -142 -123 -2.36049 0.294
NP_440545.1_3 Reverse -127 -144 -2.91109 0.195
NP_440545.1_5 Reverse -193 -210 5.25038 0.241
NP_441856.1_3 Reverse -128 -147 -3.63879 0.299
NP_440831.1_3 Reverse -214 -233 5.02806 0.29
NP_441126.1_6 Forward -341 -327 13.8515 0.283
NP_440459.1_2 Reverse -189 -206 8.20031 0.267
NP_441653.1_2 Reverse -212 -231 3.81952 0.264
NP_440010.1_3 Forward -231 -212 -7.96535 0.294
NP_440010.1_4 Reverse -213 -232 -2.8529 0.291
NP_440010.1_10 Reverse -211 -230 4.81767 0.244
NP_442603.1_7 Reverse -131 -145 8.25877 0.178
NP_442603.1_7 Reverse -66 -80 7.76712 0.195
NP_441233.1_9 Reverse -68 -87 12.5858 0.283
NP_441888.1_7 Forward -244 -230 2.94952 0.225
NP_441888.1_7 Forward -15 -1 0.88457 0.276
NP_440946.1_6 Reverse -347 -366 2.3594 0.294
NP_440449.1_6 Forward -148 -130 10.3956 0.155
NP_441948.1_4 Reverse -124 -142 7.88563 0.0623
NP_441833.1_4 Forward -139 -132 15.9687 0.0124
NP_441833.1_4 Reverse -132 -139 15.9687 0.0124
NP_441112.1_6 Reverse -121 -140 -1.47551 0.296
NP_442162.1_9 Forward -139 -132 16.2637 0.0124
NP_442162.1_9 Reverse -132 -139 16.2637 0.0124
NP_440671.1_4 Reverse -217 -231 7.9644 0.205
NP_440671.1_4 Reverse -125 -139 6.48943 0.245
NP_440772.1_6 Reverse -73 -92 8.84924 0.292
NP_440772.1_6 Reverse -132 -151 6.78429 0.292
NP_442199.1_5 Reverse -123 -142 -1.27885 0.18
NP_442199.1_5 Forward -148 -129 -3.63879 0.209
NP_442140.1_3 Reverse -132 -142 17.4829 0.0159
NP_442140.1_3 Forward -286 -276 6.07655 0.184
NP_442140.1_3 Reverse -2 -12 4.89658 0.238
NP_442140.1_3 Reverse -371 -381 4.60159 0.242
NP_440875.1_9 Reverse -133 -143 9.44274 0.233
NP_440875.1_9 Forward -138 -128 7.59334 0.255
NP_441813.1_5 Reverse -129 -139 15.9097 0.01
NP_441813.1_5 Forward -142 -132 10.0098 0.0208
NP_441813.1_5 Forward -289 -279 3.42162 0.169
NP_441813.1_5 Forward -12 -2 0.0783647 0.222
NP_440594.1_8 Reverse -132 -145 10.9334 0.153
NP_441227.1_6 Reverse -303 -322 10.9142 0.293
NP_442089.1_1 Reverse -128 -147 -0.787193 0.261
NP_440590.1_4 Reverse -132 -145 12.409 0.0141
NP_440590.1_4 Reverse -279 -292 -5.78224 0.289
NP_440567.1_1 Reverse -132 -146 8.16106 0.0609
NP_440567.1_1 Forward -139 -125 4.52282 0.118
NP_440567.1_4 Forward -137 -118 8.16093 0.177
NP_442497.1_10 Forward -139 -130 17.601 0.00813
NP_442497.1_10 Reverse -132 -141 10.4228 0.0087
NP_440821.1_4 Forward -142 -132 18.7612 0.00422
NP_440821.1_4 Reverse -129 -139 11.0914 0.0146
NP_440821.1_4 Reverse -368 -378 5.38824 0.113
NP_441239.1_9 Forward -142 -130 16.0669 0.0175
NP_441239.1_9 Reverse -129 -141 14.6903 0.0258
NP_441239.1_9 Forward -241 -229 12.4287 0.0477
NP_441239.1_9 Forward -234 -222 3.67722 0.279
NP_441951.1_4 Forward -238 -219 4.71934 0.273
NP_441892.1_1 Forward -241 -224 6.13536 0.0995
NP_441892.1_1 Reverse -122 -139 -1.0428 0.196
NP_440796.1_3 Reverse -210 -228 7.88485 0.282
NP_440900.1_5 Forward -145 -126 19.0196 0.0957
NP_440354.1_7 Forward -146 -128 9.95058 0.224
NP_442138.1_10 Forward -140 -121 2.65439 0.117
NP_442138.1_10 Forward -232 -213 -3.44213 0.238
NP_440546.1_4 Forward -140 -130 13.5365 0.0459
NP_440546.1_4 Reverse -131 -141 11.8882 0.0679
NP_440546.1_4 Reverse -370 -380 10.143 0.109
NP_440546.1_7 Forward -81 -71 14.533 0.279
NP_441230.1_5 Forward -237 -218 3.44104 0.2
NP_440441.1_7 Reverse -188 -207 3.53937 0.288
NP_440462.1_4 Reverse -363 -377 8.45605 0.263
NP_440462.1_6 Forward -142 -132 17.9746 0.00578
NP_440462.1_6 Reverse -129 -139 16.893 0.00853
NP_440868.1_4 Forward -144 -132 11.937 0.0259
NP_440868.1_4 Reverse -127 -139 5.93884 0.0879
NP_440374.1_1 Forward -161 -142 23.1072 0.0269
NP_441474.1_1 Reverse -121 -140 -2.45958 0.277
NP_441084.1_6 Reverse -129 -143 14.192 0.106
NP_441084.1_6 Forward -169 -155 10.0228 0.255
NP_441084.1_6 Reverse -50 -64 9.24716 0.29
NP_442039.1_4 Forward -139 -132 15.1821 0.0124
NP_442039.1_4 Reverse -132 -139 15.1821 0.0124
NP_442039.1_7 Reverse -62 -72 10.3048 0.257
NP_441926.1_3 Forward -140 -124 7.72835 0.17
NP_440825.1_6 Reverse -149 -168 7.47261 0.285
NP_442837.1_3 Forward -139 -132 15.7721 0.0124
NP_442837.1_3 Reverse -132 -139 15.7721 0.0124
NP_442053.1_1 Forward -140 -131 18.3876 0.0007
NP_442053.1_1 Reverse -131 -140 18.3876 0.0007
NP_442053.1_1 Reverse -370 -379 4.52295 0.242
NP_440505.1_3 Reverse -129 -139 15.123 0.014
NP_440505.1_3 Forward -142 -132 14.1397 0.0235
NP_440505.1_3 Reverse -195 -205 9.41981 0.122
NP_440505.1_3 Reverse -368 -378 6.46988 0.18
NP_441102.1_1 Forward -139 -120 3.73603 0.285
NP_442532.1_7 Reverse -131 -145 6.6861 0.171
NP_440914.1_1 Forward -140 -130 16.3248 0.00196
NP_440914.1_1 Reverse -131 -141 8.6151 0.186
NP_441011.1_8 Reverse -132 -141 16.9127 0.00602
NP_441011.1_8 Forward -139 -130 16.6177 0.00602
NP_442533.1_1 Reverse -193 -212 -12.3902 0.236
NP_442533.1_6 Forward -140 -131 17.2076 0.00137
NP_442533.1_6 Reverse -131 -140 17.2076 0.00137
NP_442533.1_6 Forward -232 -223 11.8978 0.0362
NP_442533.1_6 Forward -379 -370 6.98123 0.0992
NP_440263.1_5 Forward -397 -383 11.6026 0.294
NP_443016.1_1 Reverse -364 -383 -4.91709 0.238
NP_441482.1_7 Reverse -125 -139 -3.34366 0.118
NP_439944.1_9 Forward -139 -129 17.6796 0.00347
NP_439944.1_9 Reverse -132 -142 10.4031 0.0887
NP_442269.1_10 Forward -124 -105 4.42435 0.247
NP_441028.1_6 Forward -205 -195 5.68278 0.243
NP_442202.1_4 Forward -228 -214 13.2231 0.259
NP_441602.1_3 Forward -145 -126 -5.50708 0.288
NP_441170.1_4 Forward -149 -131 5.91901 0.219
NP_441972.1_5 Reverse -359 -378 -0.983855 0.172
NP_441972.1_5 Reverse -67 -86 -3.3438 0.199
NP_441106.1_1 Reverse -130 -139 18.486 0.0028
NP_441106.1_1 Forward -141 -132 18.191 0.0028
NP_441106.1_1 Reverse -216 -225 8.94785 0.0405
NP_441106.1_1 Reverse -222 -231 2.55633 0.28
NP_440429.1_2 Reverse -205 -224 8.16093 0.274
NP_440429.1_9 Reverse -302 -321 5.80098 0.211
NP_439903.1_6 Forward -143 -124 0.293673 0.267
NP_442306.1_10 Reverse -126 -145 -19.0768 0.197
NP_441286.1_1 Reverse -130 -142 5.34885 0.0259
NP_441286.1_1 Forward -141 -129 4.8572 0.0272
NP_441286.1_1 Reverse -369 -381 -4.9759 0.183
NP_441286.1_1 Forward -328 -316 -6.05754 0.245
NP_440670.1_8 Forward -140 -131 18.3876 0.000699
NP_440670.1_8 Reverse -131 -140 18.3876 0.000699
NP_440886.1_7 Forward -141 -131 17.7774 0.0011
NP_440886.1_7 Reverse -130 -140 8.04271 0.0805
NP_440886.1_7 Forward -380 -370 5.09279 0.201
NP_440886.1_7 Reverse -65 -75 3.8145 0.265
NP_440886.1_7 Forward -288 -278 3.71617 0.267
NP_442614.1_2 Reverse -370 -384 11.8976 0.176
NP_439995.1_5 Forward -150 -131 15.4374 0.141
NP_442717.1_1 Reverse -245 -264 -1.96717 0.285
NP_442072.1_9 Reverse -130 -148 -21.3187 0.207
NP_441427.1_6 Forward -236 -218 7.39397 0.297
NP_440907.2_8 Reverse -132 -142 17.4824 0.00685
NP_440907.2_8 Forward -139 -129 9.51767 0.103
NP_441021.1_8 Reverse -126 -144 4.9357 0.215
NP_441463.1_3 Forward -150 -131 11.0125 0.0481
NP_441463.1_3 Reverse -121 -140 -1.37718 0.14
NP_441463.1_6 Reverse -129 -143 14.2433 0.165
NP_441463.1_6 Reverse -368 -382 6.80246 0.267
NP_442842.1_4 Forward -124 -105 5.01433 0.249
NP_441626.1_2 Forward -139 -132 15.7721 0.0124
NP_441626.1_2 Reverse -132 -139 15.7721 0.0124
NP_442211.1_3 Forward -172 -153 7.95832 0.275
NP_442365.1_5 Reverse -132 -151 13.3725 0.121
NP_442615.1_1 Forward -149 -131 13.5888 0.0113
NP_441962.1_4 Forward -353 -334 -12.1936 0.253
NP_441962.1_4 Reverse -126 -145 -15.0452 0.297
NP_441962.1_5 Forward -244 -225 4.71934 0.291
NP_440387.1_1 Reverse -131 -147 6.35172 0.0282
NP_440387.1_1 Forward -140 -124 -0.43312 0.138
NP_440387.1_1 Forward -232 -216 -5.34967 0.227
NP_441431.1_2 Reverse -220 -234 6.39049 0.272
NP_441431.1_3 Reverse -358 -377 6.39097 0.254
NP_441836.1_1 Reverse -22 -41 13.6421 0.223
NP_441993.1_1 Forward -81 -62 4.96787 0.21
NP_441993.1_1 Forward -88 -69 4.48058 0.22
NP_441174.1_2 Reverse -128 -142 11.996 0.27
NP_440358.1_1 Forward -263 -249 20.8458 0.00322
NP_440358.1_8 Forward -340 -321 28.1221 0.00207
NP_440467.1_8 Reverse -119 -138 9.93088 0.292
NP_440114.1_10 Forward -140 -126 19.0758 0.00367
NP_440114.1_10 Reverse -131 -145 9.14437 0.183
NP_440114.1_10 Reverse -278 -292 6.09611 0.285
NP_440114.1_10 Reverse -370 -384 5.99778 0.289
NP_441510.2_7 Reverse -217 -231 18.3868 0.163
NP_441510.2_7 Forward -262 -248 9.53707 0.281
NP_442087.1_2 Reverse -317 -336 12.631 0.288
NP_440766.1_4 Reverse -127 -141 7.07942 0.097
NP_440766.1_5 Reverse -375 -387 8.51522 0.277
NP_439988.1_3 Forward -243 -229 6.29277 0.278
NP_439988.1_3 Reverse -346 -360 3.93283 0.298
NP_439910.1_2 Forward -148 -131 -21.3973 0.183
NP_439910.1_2 Reverse -123 -140 -21.4956 0.183
NP_440502.1_7 Forward -107 -88 13.6675 0.268
NP_440457.1_1 Reverse -366 -378 6.33216 0.123
NP_440457.1_1 Reverse -127 -139 0.137309 0.25
NP_440457.1_1 Reverse -219 -231 -0.944332 0.285
NP_440457.1_1 Reverse -226 -238 -1.23932 0.3
NP_441332.1_6 Forward -380 -370 13.583 0.184
NP_441436.1_6 Forward -229 -210 7.86593 0.26
NP_441436.1_8 Reverse -199 -218 7.37428 0.293
NP_441436.1_8 Reverse -196 -215 7.27595 0.293
NP_442509.1_4 Forward -379 -360 17.404 0.237
NP_442509.1_4 Forward -226 -207 14.5524 0.237
NP_442509.1_8 Forward -243 -227 18.544 0.148
NP_442509.1_9 Reverse -131 -141 16.2041 0.00739
NP_442509.1_9 Forward -140 -130 8.04271 0.192
NP_442509.1_9 Forward -287 -277 7.25606 0.229
NP_442784.1_9 Reverse -215 -234 14.1591 0.17
NP_442587.1_9 Reverse -11 -24 11.6223 0.265
NP_440554.1_4 Forward -139 -129 16.1063 0.0189
NP_440554.1_4 Reverse -132 -142 13.943 0.0218
NP_441885.1_5 Reverse -131 -141 11.4848 0.00668
NP_441885.1_5 Forward -140 -130 11.3864 0.00668
NP_441885.1_5 Forward -379 -369 -0.41329 0.197
NP_441428.1_8 Forward -148 -129 14.4541 0.0912
NP_441428.1_8 Forward -386 -367 2.65439 0.268
NP_441466.1_9 Reverse -211 -230 19.9233 0.0915
NP_442341.1_7 Reverse -130 -144 9.14437 0.0773
NP_442341.1_7 Reverse -65 -79 7.9644 0.0956
NP_442341.1_7 Forward -233 -219 7.37441 0.107
NP_442341.1_9 Forward -142 -128 6.19383 0.238
NP_441756.1_5 Forward -243 -224 -0.590531 0.247
NP_441756.1_5 Forward -321 -302 -4.81876 0.296
NP_441173.1_9 Reverse -45 -53 9.85212 0.275
NP_440423.1_6 Reverse -123 -142 -5.11376 0.131
NP_440423.1_6 Reverse -222 -241 -21.3384 0.288
NP_443000.1_7 Reverse -129 -139 17.4829 0.00719
NP_443000.1_7 Forward -142 -132 2.04498 0.226
NP_441561.1_4 Forward -86 -67 12.2908 0.169
NP_441842.1_1 Reverse -372 -385 10.6384 0.292
NP_441842.1_10 Reverse -124 -138 12.291 0.107
NP_441842.1_10 Forward -147 -133 9.2427 0.195
NP_440275.1_3 Forward -142 -132 17.9746 0.0082
NP_440275.1_3 Reverse -129 -139 9.12481 0.055
NP_440091.1_1 Reverse -127 -139 8.9871 0.0567
NP_440091.1_1 Forward -144 -132 3.2839 0.163
NP_440679.1_10 Forward -138 -119 -16.0285 0.25
NP_443010.1_10 Reverse -128 -145 2.28762 0.277
NP_439962.1_4 Forward -234 -215 -9.14533 0.299
NP_440149.1_8 Forward -140 -121 -4.32711 0.206
NP_440216.1_1 Forward -140 -126 5.99778 0.0166
NP_440216.1_1 Reverse -131 -145 -2.45868 0.0513
NP_440216.1_9 Forward -165 -156 5.99792 0.289
NP_440172.1_1 Forward -140 -130 17.5813 0.00421
NP_440172.1_1 Reverse -131 -141 8.73149 0.0586
NP_440172.1_1 Reverse -370 -380 4.79825 0.166
NP_442015.1_10 Reverse -7 -20 0.805932 0.218
NP_441226.1_7 Forward -139 -132 14.4934 0.0123
NP_441226.1_7 Reverse -132 -139 14.4934 0.0123
NP_441226.1_7 Forward -378 -371 11.2485 0.0971
NP_441226.1_7 Forward -286 -279 8.59356 0.197
NP_441226.1_7 Forward -231 -224 8.59356 0.197
NP_441111.1_7 Forward -139 -131 18.7023 0.00294
NP_441111.1_7 Reverse -132 -140 18.7023 0.00294
NP_441766.1_2 Forward -140 -131 17.5026 0.00297
NP_441766.1_2 Reverse -131 -140 17.5026 0.00297
NP_442417.1_5 Forward -232 -218 4.81781 0.288
NP_442252.1_3 Reverse -271 -289 14.4738 0.0882
NP_440416.1_1 Forward -140 -121 -12.6852 0.272
NP_440416.1_9 Forward -227 -208 -16.4218 0.215
NP_443052.1_8 Reverse -121 -140 -9.83364 0.197
NP_443052.1_9 Forward -371 -352 -2.75381 0.242
NP_443052.1_9 Reverse -341 -360 -6.88371 0.289
NP_442552.1_1 Reverse -342 -361 4.52268 0.203
NP_442403.1_8 Forward -129 -110 2.0644 0.226
NP_442154.1_1 Reverse -231 -249 -9.12563 0.175
NP_442154.1_1 Reverse -196 -214 -17.5821 0.26
NP_442154.1_1 Forward -133 -115 -17.8771 0.272
NP_442154.1_1 Reverse -240 -258 -18.6637 0.284
NP_442046.1_8 Forward -378 -359 10.1275 0.297
NP_440261.1_5 Reverse -132 -145 6.60746 0.0318
NP_440988.1_10 Reverse -64 -78 7.99683 0.209
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAATTTGCCGTAAATTGGTGCGCCATCCCCATCCTGAGTGCCGCAAGCAGGGGCAACAGGTGCTGGAAATTTTGCAAGCCCCCCAATTAACCAGGCCCAAGGAATGGTTGACTCCGATCCCGGATTTAACCGACCAGGAAAATACCAAACCCACTACTCCCCGCATGGCCCGTCGCCGTCGTCGTCTGCCGGAGCCTACCCCCATTCAGTTTGAAGATACCCGGAAAATGAATACCAAGGACAATGGTTTCATCTTTGCGGCGATCGCCTTTTTGGCAGTGTTGCTGGGGTTTACCTATTGGTTAAGTTAATAAAGTCGCCGGTGGTGGTTGCCATTTGTTACTAGTTTGCTAAAAAGCCAGTAAACTAGGCGAGAAATAATCATCCCCCACGATTGCT

CDS

ATGGAATGGTTCGCCATTGCCCTGTCTACTTTTCTCACTTTCCTGGCCCCAGTTAACTTCATTAGTGATCAGGTCATAGCCAATCAAATTCGCCAGCGGGTCCATGGGGTGGAAGACCTATCGGTGCGGGTGGACAATGCCCCCAACTACCAACTAATCCAGGGCAAAATCCAACGGGTACGCCTGGCCAGTCGGGGTTTGGAAATTGTGCCCAGTCTACGGATTCAACAGGTGCAATTGGAAACCGATCCCATCGACGTGGATTTGCAAGCTCTGCGGGAAAATCGCAACCTACCGGGATTGAGGCAAGCTCTACGGCAACCATTGCAAGGGGCGGCGGAACTGGTGCTCACGGAAGCTGATGTCAATAAGGCTTTGCAAAATGCCACTGTTAAAGAGCGGTTACAAAAACAAATTGACCAACGGGTGCCGGCTGATGTACCCCGCTTTCAACTGCTCAGCGCCCAGGTGGATTTCCTCCCAGACGATCGCCTAGGCATTAATTTAGAACTGGGGCAACAGTTGGAACCCAATGCTGAACTAGAAAAATTAGTCATTACCATCGAAACTGGCATCTCGATCCAAAACGGCGATCGCCTAACCCTGGTGGACCCCAGTGCCATTCTTAACGGCCGCCGCATTAATACCAATATTCTCAACAGCATCATTGGTAGTTTTAGTGATAATCTCAGCCTGAAAAGATTGGAAAATCGGGGCATCACCGCCAGAATTTTACGGTACGACATCACCGCTGATGAGTTCAGTTTCAGCGCCTTTGGCAGTATTGCTCCAGCAAAAGAATAA

Protein

MEWFAIALSTFLTFLAPVNFISDQVIANQIRQRVHGVEDLSVRVDNAPNYQLIQGKIQRVRLASRGLEIVPSLRIQQVQLETDPIDVDLQALRENRNLPGLRQALRQPLQGAAELVLTEADVNKALQNATVKERLQKQIDQRVPADVPRFQLLSAQVDFLPDDRLGINLELGQQLEPNAELEKLVITIETGISIQNGDRLTLVDPSAILNGRRINTNILNSIIGSFSDNLSLKRLENRGITARILRYDITADEFSFSAFGSIAPAKE