Your browser is old and dusty. Try Google Chrome!

Details for slr1052

ORF slr1052
Accession NP_440357.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -316 -330 3.44117 0.164
NP_441061.1_2 Forward -98 -84 -0.197071 0.223
NP_441061.1_2 Reverse -322 -336 -2.36035 0.29
NP_440795.1_7 Forward -329 -322 6.92228 0.26
NP_441418.1_6 Forward -222 -203 -29.4015 0.224
NP_440897.1_6 Forward -324 -305 -1.37794 0.188
NP_441453.1_4 Forward -395 -387 5.0343 0.209
NP_441453.1_4 Reverse -315 -323 4.05099 0.268
NP_440226.1_1 Forward -395 -376 2.0644 0.278
NP_440150.1_6 Forward -327 -308 7.66927 0.223
NP_442744.1_8 Reverse -101 -120 1.76941 0.216
NP_441225.1_4 Reverse -317 -336 -12.1936 0.284
NP_440061.1_9 Forward -247 -233 13.1753 0.0839
NP_440061.1_9 Reverse -313 -327 9.24208 0.149
NP_440928.1_5 Reverse -316 -334 6.60732 0.267
NP_440110.1_8 Forward -221 -202 0.58944 0.211
NP_441476.1_5 Forward -137 -118 -2.45882 0.229
NP_442062.1_8 Reverse -315 -325 10.6981 0.0493
NP_441900.1_2 Reverse -119 -137 -4.60312 0.288
NP_441900.1_2 Reverse -314 -332 -6.76639 0.297
NP_441802.1_1 Forward -181 -162 4.71934 0.29
NP_440304.1_4 Reverse -100 -110 2.24165 0.299
NP_440908.1_2 Reverse -321 -334 15.0633 0.269
NP_442097.1_7 Forward -289 -270 3.83436 0.29
NP_439918.1_3 Forward -324 -305 8.25926 0.252
NP_439918.1_3 Forward -210 -191 3.73603 0.266
NP_441200.1_6 Reverse -312 -329 15.3785 0.177
NP_441208.1_9 Forward -327 -313 5.30946 0.271
NP_440518.1_9 Forward -94 -75 9.3409 0.293
NP_442110.1_7 Reverse -386 -400 0.786239 0.248
NP_442110.1_7 Reverse -223 -237 -0.590395 0.295
NP_441925.1_2 Forward -52 -33 3.73603 0.262
NP_441925.1_4 Reverse -311 -330 -4.62285 0.177
NP_441925.1_4 Reverse -194 -213 -15.4392 0.264
NP_441925.1_4 Reverse -308 -327 -15.9309 0.275
NP_441083.1_5 Reverse -308 -318 1.84832 0.198
NP_441083.1_5 Reverse -315 -325 0.963343 0.218
NP_441434.1_7 Forward -243 -229 1.57289 0.299
NP_442889.1_8 Reverse -312 -326 5.30886 0.231
NP_442889.1_8 Reverse -383 -397 4.42388 0.267
NP_441770.1_4 Forward -362 -343 -5.9004 0.22
NP_441770.1_5 Reverse -94 -113 3.24438 0.23
NP_442570.1_3 Forward -332 -313 -2.0655 0.212
NP_442570.1_3 Reverse -221 -240 -6.68705 0.259
NP_441598.1_1 Reverse -200 -219 24.7789 0.011
NP_441163.1_1 Forward -331 -314 4.95467 0.282
NP_440747.1_10 Forward -327 -315 -11.6624 0.131
NP_440747.1_10 Reverse -312 -324 -12.0557 0.199
NP_440747.1_10 Forward -114 -102 -12.2524 0.254
NP_441130.1_10 Forward -326 -312 11.2093 0.107
NP_441130.1_10 Reverse -313 -327 5.40779 0.231
NP_440842.1_10 Reverse -233 -247 9.2427 0.251
NP_442848.1_6 Forward -291 -272 22.6156 0.0686
NP_443018.1_3 Forward -323 -316 4.36568 0.254
NP_443018.1_3 Reverse -316 -323 4.07068 0.299
NP_441634.1_8 Reverse -106 -120 2.85119 0.16
NP_441634.1_8 Forward -326 -312 -3.73699 0.295
NP_441634.1_8 Reverse -313 -327 -4.32697 0.295
NP_440376.1_1 Reverse -315 -324 7.76787 0.0688
NP_440376.1_1 Forward -324 -315 6.98123 0.088
NP_440376.1_1 Forward -395 -386 -1.27858 0.297
NP_442687.1_7 Reverse -314 -324 4.69992 0.238
NP_442485.1_3 Reverse -304 -323 -0.295539 0.252
NP_441422.1_7 Reverse -313 -330 4.85706 0.106
NP_440667.1_2 Forward -213 -194 0.392778 0.208
NP_441950.1_7 Forward -336 -317 -8.16202 0.287
NP_442658.1_1 Forward -326 -316 5.58445 0.262
NP_442198.1_7 Reverse -201 -220 11.0117 0.219
NP_440141.1_4 Forward -333 -314 4.62101 0.294
NP_440141.1_8 Forward -147 -128 4.12936 0.293
NP_441855.2_4 Forward -245 -226 9.13744 0.287
NP_441487.1_9 Forward -396 -377 -1.96717 0.29
NP_442321.1_1 Reverse -217 -236 2.45773 0.144
NP_442321.1_4 Forward -102 -83 -4.6221 0.284
NP_441317.1_4 Reverse -10 -24 13.3791 0.18
NP_441958.1_5 Forward -325 -315 -6.90313 0.293
NP_441127.1_1 Forward -213 -199 16.6175 0.1
NP_442836.1_10 Forward -282 -272 9.32148 0.277
NP_441097.1_2 Forward -340 -323 3.77542 0.293
NP_439990.1_5 Forward -116 -103 11.1307 0.128
NP_440153.1_5 Reverse -316 -330 0.589577 0.297
NP_440153.1_8 Reverse -315 -328 5.91914 0.175
NP_443055.1_6 Reverse -307 -325 -2.24319 0.291
NP_440138.1_6 Forward -244 -225 2.85027 0.259
NP_441294.1_7 Reverse -311 -325 15.0099 0.0328
NP_441646.1_1 Reverse -116 -135 6.98095 0.165
NP_441646.1_1 Reverse -308 -327 5.70265 0.176
NP_441646.1_1 Forward -331 -312 4.52268 0.191
NP_442438.1_10 Forward -329 -315 9.14437 0.0692
NP_441000.1_6 Forward -325 -311 -4.03198 0.225
NP_441000.1_6 Forward -299 -285 -4.7203 0.251
NP_442771.1_1 Reverse -376 -394 -10.6989 0.279
NP_440147.1_4 Reverse -313 -326 7.59077 0.0657
NP_441550.1_8 Reverse -234 -244 5.97777 0.22
NP_441916.1_7 Forward -324 -314 6.66654 0.0875
NP_441041.1_4 Forward -110 -91 -13.5702 0.291
NP_439966.1_7 Reverse -313 -323 4.89613 0.254
NP_439966.1_7 Reverse -202 -212 4.60114 0.265
NP_440202.1_8 Reverse -114 -133 9.32 0.297
NP_442941.1_3 Reverse -387 -397 0.57002 0.199
NP_440289.1_2 Reverse -312 -325 1.49425 0.125
NP_440983.1_5 Reverse -204 -223 -7.96535 0.294
NP_442256.1_2 Reverse -319 -337 -8.14232 0.217
NP_441556.1_7 Reverse -101 -120 -0.00131823 0.3
NP_441556.1_10 Reverse -78 -92 13.5313 0.178
NP_441196.1_4 Forward -317 -298 13.8641 0.112
NP_441644.1_6 Reverse -315 -325 6.27276 0.163
NP_441644.1_6 Forward -395 -385 4.69947 0.228
NP_442501.1_2 Forward -239 -220 34.317 0.0000235
NP_442501.1_3 Forward -191 -172 27.3355 0.00175
NP_442501.1_6 Forward -347 -328 26.8438 0.0018
NP_442501.1_7 Forward -101 -82 20.7473 0.00886
NP_442501.1_10 Forward -299 -280 32.6453 0.0000768
NP_442215.1_2 Reverse -384 -400 -1.61309 0.186
NP_442029.1_6 Forward -314 -295 9.14423 0.193
NP_440929.1_8 Forward -324 -315 6.78456 0.082
NP_440929.1_8 Forward -245 -236 3.63797 0.214
NP_442933.1_10 Forward -324 -315 4.81794 0.212
NP_441751.2_8 Reverse -316 -330 -4.52363 0.174
NP_442554.1_8 Reverse -316 -326 7.45319 0.092
NP_442554.1_8 Forward -323 -313 3.61828 0.218
NP_442075.1_1 Reverse -203 -222 11.0125 0.187
NP_441762.1_7 Reverse -314 -326 -7.53251 0.293
NP_442142.1_4 Reverse -312 -325 4.14862 0.231
NP_442292.1_1 Reverse -316 -325 5.99792 0.125
NP_442292.1_1 Reverse -387 -396 -0.68859 0.268
NP_440421.1_1 Reverse -336 -350 14.2576 0.272
NP_440357.1_3 Reverse -234 -253 5.70265 0.242
NP_440357.1_4 Forward -239 -220 21.8289 0.052
NP_440357.1_9 Forward -299 -280 16.8141 0.258
NP_441448.1_5 Forward -110 -91 15.8307 0.287
NP_440379.1_5 Forward -126 -107 -7.27704 0.242
NP_440379.1_5 Forward -222 -203 -10.7186 0.283
NP_441468.1_1 Forward -323 -316 4.36568 0.237
NP_441020.2_6 Forward -326 -309 11.7402 0.112
NP_441015.1_10 Forward -329 -310 -7.27704 0.265
NP_441015.1_10 Forward -335 -316 -9.63698 0.282
NP_441673.1_1 Forward -324 -315 1.67135 0.0404
NP_441673.1_1 Reverse -315 -324 1.47469 0.0936
NP_441673.1_1 Forward -395 -386 -8.06341 0.254
NP_440852.1_7 Reverse -168 -187 12.9783 0.281
NP_441016.2_6 Reverse -195 -214 8.4551 0.222
NP_441826.1_2 Reverse -294 -308 -4.52363 0.296
NP_442490.1_9 Reverse -315 -334 -4.81876 0.273
NP_442490.1_9 Reverse -224 -243 -7.57203 0.278
NP_442719.1_2 Reverse -187 -205 -11.5846 0.292
NP_442227.1_2 Forward -244 -225 8.16093 0.173
NP_442227.1_2 Reverse -317 -336 8.06259 0.176
NP_442227.1_2 Reverse -320 -339 4.81767 0.204
NP_442808.1_1 Reverse -110 -120 12.1726 0.0481
NP_442808.1_1 Reverse -203 -213 7.84605 0.0668
NP_442808.1_1 Reverse -314 -324 6.37109 0.116
NP_442542.1_9 Forward -145 -131 8.25877 0.166
NP_440342.1_1 Forward -334 -315 15.9291 0.173
NP_440558.1_2 Forward -114 -95 -3.3438 0.234
NP_440274.1_4 Forward -240 -222 10.0489 0.157
NP_441878.1_6 Forward -325 -315 1.94665 0.0567
NP_441878.1_6 Reverse -101 -111 1.55333 0.0937
NP_441878.1_6 Reverse -314 -324 0.471689 0.142
NP_441878.1_6 Forward -229 -219 -0.0199663 0.163
NP_442650.1_2 Forward -330 -316 4.91614 0.16
NP_441557.1_4 Forward -37 -23 10.226 0.291
NP_441557.1_5 Forward -324 -315 0.786375 0.106
NP_441557.1_5 Reverse -315 -324 0.589713 0.134
NP_441557.1_8 Reverse -204 -214 10.8943 0.273
NP_441445.1_1 Forward -333 -314 7.37428 0.135
NP_441590.1_4 Reverse -200 -219 6.09517 0.26
NP_441590.1_4 Reverse -203 -222 4.32522 0.288
NP_442183.1_9 Forward -333 -323 9.41981 0.296
NP_442397.1_9 Reverse -308 -327 3.53937 0.264
NP_442397.1_9 Forward -330 -311 1.47442 0.283
NP_441467.1_5 Forward -22 -12 15.5163 0.232
NP_442645.1_2 Forward -332 -313 -22.2233 0.29
NP_441037.1_4 Reverse -384 -394 9.16938 0.231
NP_441037.1_4 Forward -326 -316 7.31769 0.237
NP_440151.1_5 Reverse -218 -237 9.24257 0.201
NP_441633.1_3 Reverse -313 -326 -3.22564 0.177
NP_441633.1_3 Forward -247 -234 -6.96221 0.283
NP_442014.1_1 Forward -119 -100 9.93088 0.189
NP_442590.1_9 Forward -238 -219 3.73603 0.284
NP_442590.1_10 Forward -336 -317 7.86593 0.218
NP_442998.1_2 Reverse -193 -212 7.27514 0.25
NP_442998.1_10 Reverse -388 -395 3.97235 0.297
NP_440899.1_2 Forward -239 -220 10.4217 0.163
NP_440899.1_8 Reverse -14 -33 -3.63879 0.231
NP_440299.1_1 Reverse -161 -174 6.31189 0.146
NP_441799.1_1 Reverse -311 -325 7.66879 0.136
NP_441799.1_4 Reverse -378 -397 -6.39206 0.266
NP_441799.1_9 Reverse -320 -339 -4.22878 0.256
NP_441007.1_10 Forward -179 -166 2.47756 0.186
NP_441007.1_10 Forward -329 -316 0.805932 0.216
NP_442201.1_10 Reverse -225 -244 -14.2585 0.28
NP_440456.1_7 Reverse -267 -281 10.4227 0.292
NP_441559.1_8 Reverse -79 -93 0.392915 0.167
NP_441559.1_8 Reverse -118 -132 -5.21195 0.254
NP_441559.1_8 Reverse -310 -324 -5.9986 0.271
NP_441270.1_5 Forward -220 -201 15.922 0.191
NP_441270.1_5 Forward -372 -353 12.5063 0.236
NP_442855.1_3 Reverse -221 -240 14.3558 0.21
NP_441296.1_9 Reverse -315 -328 8.77016 0.294
NP_440717.1_1 Reverse -84 -103 9.0459 0.25
NP_440748.1_5 Forward -345 -326 -2.75381 0.281
NP_441464.1_1 Forward -236 -217 11.8975 0.24
NP_441464.1_8 Forward -395 -381 4.71948 0.267
NP_441494.1_6 Forward -209 -196 5.52582 0.3
NP_442386.1_9 Forward -325 -316 9.73406 0.152
NP_442386.1_9 Reverse -314 -323 4.7192 0.289
NP_442386.1_9 Reverse -111 -120 4.52254 0.297
NP_440570.1_5 Forward -340 -321 -4.03212 0.299
NP_441750.1_1 Forward -183 -164 1.86774 0.166
NP_441750.1_7 Forward -213 -203 15.3197 0.254
NP_441340.1_5 Reverse -316 -323 3.97235 0.274
NP_440168.1_2 Reverse -313 -332 -2.36049 0.276
NP_440168.1_8 Reverse -309 -328 2.55606 0.257
NP_440327.1_6 Reverse -132 -151 12.2908 0.168
NP_440586.1_8 Forward -323 -316 5.8403 0.283
NP_442959.1_7 Reverse -203 -222 9.14423 0.129
NP_440523.1_5 Forward -101 -82 10.3242 0.203
NP_440027.1_3 Reverse -204 -222 7.88485 0.202
NP_440027.1_3 Reverse -194 -212 4.44329 0.26
NP_439984.1_10 Forward -349 -335 11.602 0.246
NP_439937.1_9 Reverse -314 -331 -8.12328 0.176
NP_439937.1_9 Forward -94 -77 -11.8598 0.267
NP_439937.1_9 Forward -284 -267 -13.2365 0.283
NP_439937.1_9 Reverse -203 -220 -14.3181 0.287
NP_439937.1_9 Forward -157 -140 -17.0714 0.291
NP_440408.1_7 Reverse -230 -249 7.27595 0.29
NP_441138.1_5 Forward -198 -185 7.89211 0.257
NP_441181.1_6 Forward -335 -317 10.5406 0.219
NP_441789.1_7 Reverse -202 -221 -3.14789 0.268
NP_440819.1_5 Forward -21 -13 7.68924 0.266
NP_440316.1_10 Forward -214 -204 13.8447 0.201
NP_440139.1_1 Forward -393 -374 1.76863 0.249
NP_442384.1_10 Forward -324 -311 6.70579 0.0963
NP_440344.1_10 Reverse -308 -325 -11.2692 0.208
NP_442693.1_7 Forward -331 -312 10.3242 0.227
NP_440298.1_6 Forward -243 -229 17.5018 0.251
NP_440894.1_4 Reverse -274 -293 2.65439 0.219
NP_441679.1_1 Forward -183 -164 -5.01543 0.243
NP_440999.1_9 Reverse -119 -133 1.96621 0.156
NP_440999.1_9 Reverse -311 -325 -0.393733 0.205
NP_440888.1_2 Reverse -315 -329 17.3052 0.00418
NP_440888.1_2 Reverse -321 -335 9.93039 0.11
NP_440888.1_2 Reverse -300 -314 7.96378 0.175
NP_440803.1_3 Reverse -344 -363 7.57094 0.213
NP_442147.1_6 Reverse -202 -216 14.7486 0.281
NP_442277.1_4 Reverse -306 -325 3.83357 0.213
NP_441543.1_2 Reverse -387 -396 5.80125 0.174
NP_441543.1_2 Reverse -316 -325 5.11294 0.209
NP_442845.1_2 Forward -330 -316 9.04604 0.182
NP_441469.1_4 Forward -333 -314 6.78429 0.282
NP_441469.1_8 Reverse -314 -323 5.60459 0.258
NP_442337.1_8 Forward -382 -363 9.24257 0.169
NP_442578.1_7 Forward -394 -387 8.69224 0.172
NP_440710.1_1 Reverse -307 -325 -0.472507 0.163
NP_440148.1_8 Reverse -377 -387 18.6629 0.28
NP_442204.1_6 Forward -120 -101 4.52268 0.291
NP_440516.1_2 Forward -238 -220 0.21581 0.235
NP_440516.1_8 Forward -213 -204 -0.196935 0.185
NP_442428.1_5 Forward -323 -316 4.759 0.223
NP_441052.1_2 Reverse -315 -325 7.35486 0.0742
NP_441052.1_2 Reverse -321 -331 6.07655 0.0943
NP_441052.1_2 Forward -354 -344 2.92996 0.187
NP_442219.1_8 Forward -334 -315 8.16711 0.253
NP_442219.1_9 Reverse -316 -325 5.01461 0.193
NP_440436.1_4 Reverse -316 -325 4.91586 0.23
NP_441884.1_9 Forward -123 -104 -20.2567 0.178
NP_442864.1_3 Reverse -302 -321 9.93088 0.195
NP_440314.1_9 Forward -394 -375 7.07928 0.0509
NP_441004.1_1 Forward -222 -203 -11.8986 0.243
NP_441004.1_4 Reverse -141 -151 10.3048 0.254
NP_442813.1_4 Reverse -127 -146 -3.73712 0.293
NP_442813.1_4 Forward -228 -209 -5.11376 0.299
NP_439949.1_7 Forward -207 -193 10.3243 0.293
NP_442694.1_4 Forward -203 -194 12.0944 0.268
NP_443054.1_2 Forward -326 -312 1.47456 0.245
NP_441851.1_9 Forward -102 -83 6.58763 0.299
NP_441851.1_10 Forward -325 -315 11.7798 0.0631
NP_440495.1_7 Reverse -129 -148 9.63589 0.257
NP_442515.1_1 Forward -396 -382 2.85119 0.129
NP_442515.1_1 Reverse -344 -358 -2.95034 0.284
NP_441396.1_5 Forward -335 -326 8.65285 0.21
NP_441396.1_5 Forward -212 -203 7.66954 0.241
NP_440593.1_3 Forward -250 -231 -1.57384 0.211
NP_440593.1_3 Forward -109 -90 -6.88371 0.282
NP_440463.1_8 Reverse -308 -327 7.01583 0.267
NP_441046.1_2 Forward -45 -26 -2.0655 0.295
NP_442843.1_1 Reverse -90 -109 -8.55534 0.255
NP_440474.1_8 Forward -394 -380 4.22722 0.287
NP_441477.1_10 Forward -331 -313 -0.7675 0.294
NP_440431.1_3 Reverse -100 -119 -11.5053 0.286
NP_442006.1_2 Forward -147 -130 -8.0243 0.192
NP_442006.1_2 Forward -324 -307 -14.3175 0.203
NP_440483.1_1 Forward -145 -126 -7.67036 0.267
NP_440483.1_1 Forward -218 -199 -8.55534 0.289
NP_440483.1_4 Forward -326 -307 4.22769 0.288
NP_441078.1_4 Forward -324 -315 7.96454 0.0404
NP_441078.1_4 Reverse -315 -324 0.786375 0.157
NP_441078.1_4 Reverse -386 -395 -1.27858 0.246
NP_441078.1_4 Forward -395 -386 -2.06522 0.295
NP_440539.1_9 Reverse -203 -222 -2.26216 0.286
NP_442348.1_2 Forward -204 -195 6.78456 0.299
NP_442443.1_1 Forward -290 -271 14.3558 0.0815
NP_442443.1_1 Reverse -269 -288 -3.83545 0.267
NP_442443.1_1 Forward -182 -163 -6.29373 0.294
NP_440526.1_3 Reverse -316 -327 1.13984 0.267
NP_441432.1_8 Forward -325 -316 4.62128 0.201
NP_442797.1_6 Forward -226 -207 9.19461 0.246
NP_442797.1_7 Reverse -314 -332 3.95239 0.234
NP_442797.1_7 Reverse -313 -331 1.59244 0.257
NP_440131.1_4 Forward -220 -201 4.81767 0.275
NP_440461.1_8 Forward -231 -212 19.3707 0.172
NP_441057.1_4 Forward -334 -316 -3.02911 0.278
NP_442010.1_1 Reverse -23 -41 10.8348 0.241
NP_442400.1_10 Forward -29 -16 11.4253 0.236
NP_440713.1_4 Forward -334 -315 11.4058 0.115
NP_442489.1_7 Forward -324 -315 8.45619 0.0206
NP_442489.1_7 Reverse -315 -324 0.786375 0.152
NP_441659.2_8 Reverse -315 -325 6.56821 0.0714
NP_440860.1_7 Forward -256 -237 17.404 0.227
NP_441040.1_5 Reverse -79 -98 2.85105 0.279
NP_442346.1_5 Forward -325 -315 6.56821 0.198
NP_442346.1_5 Reverse -143 -153 6.27322 0.208
NP_442346.1_10 Forward -326 -307 5.211 0.168
NP_440545.1_3 Forward -328 -311 1.71047 0.114
NP_440010.1_3 Forward -231 -212 -8.35868 0.297
NP_442311.1_5 Forward -336 -317 10.4225 0.223
NP_440847.1_3 Forward -235 -221 12.6836 0.234
NP_442603.1_7 Reverse -321 -335 9.83206 0.139
NP_441888.1_7 Reverse -310 -324 2.65453 0.225
NP_440946.1_6 Reverse -225 -244 6.58763 0.294
NP_440751.1_3 Reverse -194 -213 9.93006 0.264
NP_440912.1_3 Reverse -10 -29 10.2251 0.254
NP_442140.1_3 Forward -323 -313 3.81494 0.278
NP_441671.1_10 Reverse -208 -227 3.6377 0.222
NP_440875.1_9 Forward -322 -312 7.39866 0.267
NP_441813.1_5 Reverse -313 -323 0.0783647 0.222
NP_441813.1_7 Reverse -321 -335 11.012 0.23
NP_440594.1_6 Reverse -315 -334 9.04509 0.208
NP_440567.1_1 Reverse -316 -330 7.76774 0.0654
NP_440567.1_4 Forward -225 -206 1.86774 0.261
NP_441239.1_9 Reverse -202 -214 6.23383 0.197
NP_441239.1_9 Reverse -313 -325 5.74217 0.21
NP_441239.1_9 Forward -247 -235 4.16888 0.26
NP_441892.1_1 Reverse -312 -329 -3.00942 0.231
NP_440665.1_1 Forward -150 -131 -6.88371 0.214
NP_441017.1_8 Reverse -216 -231 8.2397 0.25
NP_441526.1_6 Forward -332 -313 1.96607 0.295
NP_442499.1_3 Forward -396 -378 6.70565 0.282
NP_440905.1_2 Forward -133 -116 17.4434 0.1
NP_442402.1_4 Forward -362 -343 -3.04956 0.211
NP_442402.1_4 Reverse -115 -134 -9.53937 0.291
NP_440696.1_3 Forward -223 -205 2.87075 0.213
NP_441811.1_8 Forward -330 -316 8.35772 0.238
NP_442679.1_1 Forward -33 -14 -1.7705 0.24
NP_440825.1_6 Forward -205 -186 8.25926 0.285
NP_441053.1_3 Forward -341 -322 -3.14714 0.299
NP_441053.1_10 Reverse -227 -237 18.8596 0.293
NP_440160.1_2 Reverse -95 -114 -1.67217 0.243
NP_440160.1_2 Reverse -83 -102 -8.65367 0.286
NP_442053.1_1 Reverse -315 -324 5.21127 0.203
NP_440505.1_3 Forward -397 -387 11.7798 0.0676
NP_442532.1_7 Forward -395 -381 2.16287 0.252
NP_441011.1_8 Forward -323 -314 9.83282 0.117
NP_442533.1_1 Forward -333 -314 -14.1602 0.24
NP_442533.1_1 Forward -339 -320 -15.9302 0.26
NP_442533.1_6 Reverse -315 -324 8.1612 0.0807
NP_442533.1_6 Forward -324 -315 6.98123 0.0992
NP_442541.1_10 Reverse -315 -329 4.8172 0.248
NP_442232.1_3 Forward -332 -313 4.81767 0.0823
NP_441219.1_6 Forward -325 -307 21.2586 0.0362
NP_439944.1_9 Reverse -316 -326 7.05986 0.157
NP_439944.1_9 Reverse -387 -397 6.76487 0.168
NP_441527.1_4 Reverse -230 -249 -10.8388 0.275
NP_440007.1_9 Forward -399 -385 2.85119 0.277
NP_441420.1_8 Forward -231 -212 14.9458 0.17
NP_440429.1_2 Reverse -205 -224 7.07928 0.295
NP_441216.1_3 Forward -364 -345 16.4207 0.291
NP_441286.1_1 Forward -246 -234 -6.15587 0.251
NP_442674.1_3 Reverse -313 -332 5.30853 0.269
NP_440886.1_7 Reverse -203 -213 15.2208 0.0327
NP_440886.1_7 Reverse -314 -324 7.94438 0.0805
NP_440886.1_7 Reverse -326 -336 4.69947 0.22
NP_440886.1_7 Reverse -320 -330 4.01116 0.255
NP_440828.1_1 Reverse -203 -222 9.14342 0.197
NP_441427.1_2 Reverse -327 -346 9.63589 0.144
NP_441403.1_4 Forward -219 -201 17.9154 0.282
NP_441463.1_3 Forward -334 -315 -3.73712 0.184
NP_441626.1_2 Forward -394 -387 4.85733 0.244
NP_441460.1_2 Forward -247 -234 15.1616 0.197
NP_442794.1_1 Forward -102 -90 4.16888 0.276
NP_442615.1_1 Forward -333 -315 -0.964162 0.123
NP_441962.1_4 Forward -329 -310 1.0811 0.108
NP_440387.1_1 Forward -395 -379 -3.38305 0.158
NP_440387.1_1 Reverse -315 -331 -3.97304 0.171
NP_440855.1_5 Reverse -313 -332 3.83357 0.287
NP_441431.1_2 Reverse -201 -215 13.8636 0.0784
NP_441488.1_7 Forward -333 -314 3.24438 0.23
NP_440634.1_8 Reverse -204 -223 8.65176 0.23
NP_441993.1_1 Forward -330 -311 4.38312 0.221
NP_442224.1_1 Reverse -103 -122 -4.81876 0.238
NP_441272.1_10 Forward -288 -274 14.3559 0.244
NP_439988.1_3 Reverse -224 -238 7.86607 0.273
NP_440502.1_3 Forward -241 -231 13.8873 0.289
NP_442867.1_8 Reverse -130 -149 9.3409 0.224
NP_440457.1_1 Forward -321 -309 -0.256015 0.259
NP_442940.1_2 Reverse -315 -334 -0.39387 0.296
NP_442680.1_5 Forward -33 -14 2.02604 0.237
NP_441984.1_3 Reverse -382 -400 18.997 0.0928
NP_441984.1_4 Forward -336 -322 11.7993 0.299
NP_441332.1_6 Reverse -203 -213 12.034 0.236
NP_441889.1_7 Forward -344 -326 14.8671 0.239
NP_442509.1_9 Forward -324 -314 6.0761 0.293
NP_440734.1_2 Forward -213 -194 16.0274 0.213
NP_441885.1_5 Reverse -315 -325 2.14332 0.0827
NP_441885.1_5 Reverse -386 -396 0.275027 0.174
NP_442341.1_7 Reverse -200 -214 1.37622 0.292
NP_442341.1_9 Reverse -325 -339 4.8172 0.291
NP_442395.2_4 Reverse -212 -231 0.195343 0.276
NP_440423.1_6 Reverse -228 -247 -11.7019 0.181
NP_440507.2_3 Forward -102 -83 7.76679 0.27
NP_440275.1_3 Reverse -384 -394 7.94484 0.0641
NP_443060.1_5 Reverse -121 -140 6.98015 0.235
NP_439962.1_4 Forward -245 -226 -6.68705 0.283
NP_441105.1_3 Forward -335 -316 4.32602 0.0807
NP_442373.1_3 Forward -338 -319 8.25926 0.281
NP_440216.1_1 Forward -324 -310 -1.77037 0.0383
NP_440216.1_9 Reverse -109 -118 8.45619 0.286
NP_442015.1_10 Reverse -91 -104 1.49425 0.204
NP_441226.1_7 Forward -236 -229 6.52862 0.253
NP_442034.1_7 Reverse -107 -125 8.47561 0.245
NP_441111.1_7 Forward -323 -315 -0.472234 0.131
NP_441111.1_7 Reverse -387 -395 -0.668896 0.274
NP_441111.1_7 Reverse -316 -324 -0.668896 0.274
NP_442417.1_5 Reverse -204 -218 7.37441 0.19
NP_443052.1_9 Reverse -317 -336 6.09597 0.138
NP_443052.1_9 Reverse -202 -221 -2.16383 0.233
NP_443052.1_9 Forward -109 -90 -6.78538 0.289
NP_443052.1_9 Reverse -272 -291 -7.27704 0.295
NP_440072.1_5 Forward -213 -195 -3.52077 0.28
NP_440072.1_5 Forward -339 -321 -3.6191 0.281
NP_440591.1_9 Forward -331 -313 5.23069 0.253
NP_442154.1_1 Forward -338 -320 -15.0255 0.218
NP_442154.1_1 Forward -212 -194 -15.0255 0.218
NP_440988.1_10 Forward -239 -225 4.31795 0.266
NP_440988.1_10 Forward -332 -318 4.12432 0.274
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAATGGCGGTAGCATCATTACCCTGACTTACTTTGGCGGCGTGAAGGTTATTCCCAACTACAACCTGATGGGGGTGGCGAAGGCCGGTCTGGAAATGACTGTGCGTTATCTGGCCGCAGAATTGGGGCCCCAAAATATTCGTGTTAATGGTATTTCCGCTGGCCCCATCCGGACCCTGGCTTCTTCGGCGGTGGGGGGCATTTTGGATATGATTCACCATGTGGAAGAGGTGGCACCACTAAAGCGTACCGTCACCCAAACGGAAGTGGGGAATACAGCGGCTTTCCTGGCCAGTGACCTTTCCAGTGGCATTACCGGACAAATTATCTACGTCGATTCTGGCTATGAAATTATGGGTATGTAATGGTGAAGATTAAACGAGAAAAATAGTTCTTTGCC

CDS

ATGGGATCCGAGTATCAAGGCCAATTTGAGCAAAAATTTGAGGAAGGAAAGGCCGCTTTCGACCGGGGACGTTACCGCCAAAGTATTAGTCTTTTTGAGGAAGCGGTGAAGCTTTCGGCTGGGGCATCCCGTCGGGGCGGCGAAGCTCAGTTGTGGTTGGCCATGGCCCACCAAGCCAGCGGAGATCTGCCCACTGCCAAACAAATTTGCCGTAAATTGGTGCGCCATCCCCATCCTGAGTGCCGCAAGCAGGGGCAACAGGTGCTGGAAATTTTGCAAGCCCCCCAATTAACCAGGCCCAAGGAATGGTTGACTCCGATCCCGGATTTAACCGACCAGGAAAATACCAAACCCACTACTCCCCGCATGGCCCGTCGCCGTCGTCGTCTGCCGGAGCCTACCCCCATTCAGTTTGAAGATACCCGGAAAATGAATACCAAGGACAATGGTTTCATCTTTGCGGCGATCGCCTTTTTGGCAGTGTTGCTGGGGTTTACCTATTGGTTAAGTTAA

Protein

MGSEYQGQFEQKFEEGKAAFDRGRYRQSISLFEEAVKLSAGASRRGGEAQLWLAMAHQASGDLPTAKQICRKLVRHPHPECRKQGQQVLEILQAPQLTRPKEWLTPIPDLTDQENTKPTTPRMARRRRRLPEPTPIQFEDTRKMNTKDNGFIFAAIAFLAVLLGFTYWLS