Your browser is old and dusty. Try Google Chrome!

Details for slr1039

ORF slr1039
Accession NP_440501.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -221 -207 11.111 0.253
NP_442711.1_1 Forward -55 -41 11.111 0.253
NP_440557.1_3 Reverse -336 -355 7.47261 0.183
NP_440897.1_6 Reverse -116 -135 -0.787962 0.185
NP_440897.1_6 Reverse -363 -382 -4.03287 0.262
NP_441453.1_4 Forward -172 -164 4.93597 0.224
NP_441453.1_4 Forward -62 -54 4.24765 0.259
NP_441623.1_1 Reverse -148 -166 -5.09406 0.283
NP_442151.1_6 Reverse -363 -377 11.111 0.108
NP_442151.1_6 Forward -389 -375 5.40779 0.278
NP_442151.1_6 Reverse -163 -177 5.21113 0.288
NP_441818.1_9 Forward -58 -39 -2.45882 0.203
NP_441818.1_9 Forward -61 -42 -4.42544 0.236
NP_441818.1_9 Forward -217 -198 -8.35868 0.277
NP_441818.1_9 Forward -230 -211 -10.817 0.299
NP_441465.1_5 Reverse -177 -191 16.2242 0.286
NP_443002.1_5 Reverse -207 -225 9.26148 0.296
NP_442173.1_1 Forward -61 -53 4.93597 0.241
NP_441225.1_4 Forward -130 -111 -4.03212 0.255
NP_440784.1_7 Forward -388 -381 5.84064 0.248
NP_441250.1_3 Forward -323 -304 4.22769 0.252
NP_440061.1_9 Forward -129 -115 8.55376 0.17
NP_440061.1_9 Reverse -204 -218 5.40719 0.286
NP_442062.1_8 Forward -62 -52 11.6814 0.0419
NP_441859.1_3 Reverse -74 -93 10.815 0.116
NP_440044.1_8 Forward -163 -144 -0.787193 0.228
NP_440011.1_1 Reverse -162 -181 11.2092 0.286
NP_442602.1_3 Forward -359 -340 -0.885524 0.226
NP_441935.1_1 Forward -224 -205 7.96426 0.24
NP_441594.1_6 Forward -218 -199 10.5209 0.125
NP_441594.1_6 Reverse -203 -222 9.73422 0.14
NP_441365.1_5 Reverse -179 -198 -6.58872 0.255
NP_441925.1_4 Reverse -36 -55 -6.58946 0.185
NP_440056.1_1 Reverse -380 -399 7.86593 0.297
NP_441770.1_4 Reverse -156 -175 -3.63879 0.204
NP_443013.1_3 Forward -60 -41 3.93269 0.297
NP_441598.1_1 Forward -84 -65 6.19431 0.295
NP_441163.1_1 Forward -222 -205 5.44632 0.274
NP_441837.1_6 Forward -272 -253 19.174 0.265
NP_441486.1_1 Forward -65 -51 0.687908 0.129
NP_441486.1_1 Reverse -50 -64 -5.40861 0.237
NP_441486.1_1 Reverse -160 -174 -6.29359 0.288
NP_442634.1_4 Reverse -378 -392 2.2612 0.141
NP_441014.1_8 Reverse -350 -369 -7.76869 0.281
NP_442848.1_5 Reverse -205 -223 1.39578 0.276
NP_442848.1_5 Reverse -211 -229 -2.3408 0.285
NP_441012.1_4 Forward -275 -262 6.50913 0.278
NP_443018.1_3 Forward -61 -54 10.7572 0.0907
NP_443018.1_3 Forward -377 -370 8.39725 0.147
NP_443018.1_3 Reverse -54 -61 4.56234 0.241
NP_441634.1_8 Forward -160 -146 2.94952 0.158
NP_441634.1_8 Reverse -204 -218 -3.93365 0.295
NP_440376.1_1 Reverse -212 -221 3.63797 0.2
NP_440376.1_1 Reverse -206 -215 2.26134 0.228
NP_441588.1_4 Reverse -55 -65 8.1415 0.154
NP_442687.1_7 Reverse -211 -221 9.7148 0.0994
NP_442687.1_7 Forward -173 -163 6.56821 0.159
NP_441846.1_10 Forward -373 -354 -14.0619 0.216
NP_441846.1_10 Forward -61 -42 -22.9117 0.271
NP_442658.1_1 Reverse -51 -61 13.7459 0.0325
NP_442658.1_1 Reverse -147 -157 4.89613 0.292
NP_440720.1_1 Forward -183 -164 3.83436 0.26
NP_442937.1_5 Forward -226 -207 12.5858 0.105
NP_442937.1_5 Reverse -150 -169 11.1109 0.145
NP_441127.1_1 Reverse -146 -160 12.291 0.215
NP_441127.1_1 Reverse -377 -391 8.16106 0.3
NP_442486.1_6 Reverse -357 -376 -3.54046 0.266
NP_442836.1_5 Forward -221 -202 6.19431 0.182
NP_441338.2_5 Reverse -146 -165 1.86774 0.299
NP_442911.1_2 Forward -399 -380 -2.45882 0.0982
NP_441580.1_6 Reverse -42 -61 -0.295539 0.161
NP_440153.1_5 Forward -388 -374 3.24451 0.217
NP_440153.1_8 Reverse -206 -219 7.00078 0.168
NP_440153.1_8 Reverse -212 -225 -3.02898 0.276
NP_440993.1_3 Forward -231 -212 1.76863 0.225
NP_440827.1_1 Reverse -377 -396 14.1591 0.258
NP_443044.1_1 Forward -165 -146 9.93088 0.212
NP_441099.1_5 Forward -231 -212 -3.83545 0.139
NP_441294.1_7 Forward -176 -162 11.8423 0.124
NP_441646.1_1 Reverse -205 -224 5.60432 0.177
NP_441646.1_1 Forward -330 -311 -0.4922 0.266
NP_441646.1_1 Reverse -262 -281 -0.787193 0.272
NP_441646.1_1 Reverse -142 -161 -1.67217 0.293
NP_442438.1_10 Forward -377 -363 1.17956 0.204
NP_442438.1_10 Reverse -144 -158 -0.000409212 0.244
NP_442431.1_10 Forward -375 -357 1.49411 0.253
NP_442431.1_10 Forward -58 -40 -0.0791831 0.284
NP_440147.1_4 Reverse -210 -223 8.47575 0.0504
NP_440147.1_4 Forward -64 -51 1.49425 0.226
NP_440206.1_4 Reverse -145 -164 -1.47628 0.291
NP_440465.1_10 Forward -224 -205 -1.18052 0.29
NP_441041.1_4 Forward -221 -202 0.294447 0.0892
NP_441041.1_7 Forward -361 -349 8.09784 0.147
NP_441041.1_7 Reverse -265 -277 5.86276 0.236
NP_440569.1_10 Forward -359 -340 3.58052 0.278
NP_441547.1_2 Reverse -316 -334 3.26407 0.289
NP_440703.1_9 Reverse -294 -307 4.64028 0.295
NP_441725.1_5 Reverse -164 -174 0.57002 0.162
NP_439966.1_7 Reverse -73 -83 4.10949 0.289
NP_440983.1_5 Reverse -212 -231 -7.96535 0.294
NP_440983.1_5 Reverse -41 -60 -8.45701 0.295
NP_440260.1_8 Reverse -154 -172 3.55906 0.164
NP_442281.1_1 Reverse -48 -62 10.2254 0.0608
NP_440177.1_5 Reverse -41 -60 13.5691 0.252
NP_440177.1_8 Reverse -206 -225 17.699 0.258
NP_442256.1_2 Reverse -361 -379 -8.43732 0.224
NP_441644.1_6 Forward -221 -211 5.48612 0.188
NP_442215.1_2 Reverse -161 -177 5.95839 0.0749
NP_442215.1_2 Forward -374 -358 -5.448 0.25
NP_441810.1_5 Forward -229 -210 8.45592 0.297
NP_442029.1_1 Forward -85 -66 -19.7651 0.297
NP_442029.1_6 Forward -67 -48 6.58763 0.238
NP_440253.1_2 Reverse -149 -167 7.4923 0.0692
NP_442933.1_10 Reverse -53 -62 4.52295 0.24
NP_442554.1_8 Reverse -213 -223 5.09324 0.161
NP_442554.1_9 Reverse -151 -170 14.2177 0.269
NP_442142.1_4 Reverse -46 -59 11.6217 0.054
NP_442476.1_5 Reverse -336 -355 10.7175 0.294
NP_443009.1_5 Forward -63 -52 7.23633 0.135
NP_443009.1_5 Forward -127 -116 4.8764 0.226
NP_442250.1_5 Reverse -349 -360 17.6594 0.17
NP_442092.1_7 Reverse -277 -296 11.9958 0.266
NP_441715.1_4 Forward -61 -51 5.19158 0.224
NP_441198.1_1 Reverse -206 -225 -0.295539 0.271
NP_441468.1_1 Reverse -54 -61 4.07068 0.263
NP_441618.1_10 Forward -226 -207 12.6841 0.294
NP_441020.2_6 Forward -360 -343 6.13536 0.275
NP_441015.1_10 Forward -377 -358 -7.76869 0.271
NP_441015.1_10 Forward -226 -207 -10.6203 0.286
NP_440672.1_1 Reverse -207 -225 15.7521 0.29
NP_441826.1_2 Reverse -262 -276 -4.7203 0.299
NP_441826.1_2 Forward -221 -207 -4.7203 0.299
NP_441826.1_5 Forward -61 -42 8.84924 0.202
NP_442227.1_2 Reverse -362 -381 -1.57384 0.264
NP_440789.1_8 Forward -372 -353 13.5691 0.28
NP_442808.1_1 Reverse -115 -125 4.01116 0.212
NP_442808.1_1 Reverse -116 -126 2.83119 0.254
NP_441290.1_4 Reverse -40 -59 7.37428 0.16
NP_442820.1_3 Forward -309 -299 14.0409 0.277
NP_442542.1_2 Reverse -147 -160 14.3756 0.114
NP_442542.1_2 Reverse -266 -279 5.72248 0.253
NP_442050.1_8 Forward -221 -202 12.1397 0.272
NP_440342.1_1 Reverse -140 -159 10.1275 0.288
NP_441114.1_3 Reverse -165 -174 7.27622 0.247
NP_440558.1_2 Forward -306 -287 -4.72043 0.248
NP_440558.1_2 Reverse -265 -284 -7.57203 0.296
NP_440111.2_5 Reverse -358 -377 17.1891 0.29
NP_441518.1_3 Forward -111 -92 -9.44032 0.218
NP_441518.1_3 Forward -168 -149 -14.6519 0.279
NP_441878.1_6 Forward -173 -163 -6.8048 0.196
NP_441878.1_6 Forward -222 -212 -7.29646 0.217
NP_441878.1_6 Forward -216 -206 -7.88644 0.278
NP_441036.1_7 Reverse -335 -345 15.8108 0.292
NP_442066.2_9 Reverse -319 -332 7.78743 0.208
NP_441433.1_8 Reverse -164 -183 -3.04881 0.276
NP_440101.1_3 Reverse -375 -394 2.75272 0.246
NP_442183.1_9 Forward -55 -45 11.6814 0.206
NP_440190.1_5 Forward -24 -6 14.9655 0.254
NP_441574.1_1 Forward -236 -217 -7.08038 0.283
NP_441574.1_1 Reverse -143 -162 -7.76869 0.293
NP_442347.1_2 Reverse -93 -102 3.44131 0.284
NP_442645.1_2 Forward -70 -51 1.57275 0.045
NP_442888.1_6 Reverse -195 -214 6.39097 0.223
NP_442888.1_6 Reverse -42 -61 3.6377 0.244
NP_442508.1_8 Forward -57 -40 15.4768 0.243
NP_441633.1_3 Reverse -31 -44 0.117615 0.132
NP_441633.1_3 Forward -391 -378 -5.97891 0.236
NP_441633.1_3 Reverse -161 -174 -6.56889 0.259
NP_442385.1_6 Forward -226 -207 6.19431 0.223
NP_442590.1_10 Forward -221 -202 4.03102 0.282
NP_442590.1_10 Forward -55 -36 3.24438 0.294
NP_442998.1_10 Reverse -165 -172 10.4622 0.0819
NP_440299.1_1 Reverse -208 -221 5.91857 0.158
NP_441799.1_1 Forward -66 -52 4.8172 0.236
NP_442334.1_10 Reverse -206 -225 -16.5201 0.234
NP_440256.1_1 Forward -65 -46 19.0757 0.00424
NP_441559.1_8 Forward -131 -117 5.01447 0.102
NP_441559.1_8 Forward -121 -107 -4.52363 0.227
NP_441559.1_8 Reverse -113 -127 -6.58858 0.279
NP_441559.1_8 Reverse -112 -126 -6.58858 0.279
NP_441270.1_5 Forward -62 -43 12.3111 0.237
NP_440915.1_6 Reverse -264 -278 -0.197071 0.186
NP_441296.1_9 Reverse -61 -74 8.86849 0.289
NP_442452.1_3 Forward -175 -156 0.196116 0.298
NP_440748.1_5 Forward -321 -302 4.81767 0.195
NP_442031.1_9 Forward -294 -275 8.84842 0.289
NP_441464.1_10 Forward -54 -40 9.2427 0.262
NP_442150.1_2 Forward -73 -54 19.7377 0.136
NP_442453.1_6 Reverse -40 -54 15.2089 0.286
NP_442993.1_1 Forward -49 -33 -9.67623 0.19
NP_442386.1_9 Reverse -52 -61 10.914 0.111
NP_442386.1_9 Reverse -74 -83 8.06244 0.209
NP_442386.1_9 Reverse -116 -125 7.2758 0.219
NP_441750.1_1 Reverse -371 -390 -7.4737 0.265
NP_441750.1_1 Forward -89 -70 -9.53865 0.3
NP_441340.1_5 Forward -61 -54 3.97235 0.274
NP_442484.1_2 Reverse -42 -61 9.93088 0.124
NP_440168.1_9 Reverse -138 -157 -5.11376 0.296
NP_440586.1_1 Forward -225 -206 3.6377 0.202
NP_440586.1_8 Forward -377 -370 7.21693 0.27
NP_440192.1_4 Reverse -210 -229 10.4648 0.237
NP_440027.1_3 Reverse -139 -157 2.47668 0.289
NP_439996.1_1 Forward -369 -350 8.75091 0.263
NP_439937.1_8 Reverse -378 -397 -1.47551 0.249
NP_442294.1_3 Forward -191 -177 15.0436 0.213
NP_439943.1_2 Reverse -122 -141 11.7008 0.251
NP_440819.1_5 Reverse -175 -183 7.98423 0.228
NP_441803.1_2 Reverse -207 -226 2.75272 0.204
NP_440210.1_8 Reverse -46 -62 14.4149 0.17
NP_441572.1_7 Reverse -374 -393 -6.68705 0.3
NP_442384.1_10 Forward -221 -208 2.37923 0.228
NP_442384.1_10 Reverse -117 -130 0.314277 0.294
NP_441877.1_7 Reverse -48 -67 2.35861 0.23
NP_442262.1_10 Forward -377 -370 10.7572 0.124
NP_442262.1_10 Forward -61 -54 9.87221 0.164
NP_440163.1_10 Forward -161 -151 10.9931 0.18
NP_440531.1_6 Forward -156 -137 -1.18052 0.229
NP_440189.1_2 Forward -285 -266 4.22769 0.268
NP_440189.1_10 Reverse -160 -179 2.94938 0.289
NP_441965.1_10 Reverse -272 -288 2.32015 0.288
NP_441640.1_8 Forward -377 -358 -0.983855 0.206
NP_442693.1_7 Forward -222 -203 11.2092 0.227
NP_440297.1_9 Reverse -164 -174 4.79825 0.22
NP_440894.1_10 Forward -226 -207 4.03102 0.259
NP_440999.1_9 Reverse -208 -222 1.37622 0.166
NP_440999.1_9 Reverse -49 -63 0.0979218 0.193
NP_440999.1_9 Reverse -359 -373 -0.688726 0.214
NP_440888.1_2 Reverse -363 -377 12.6836 0.0405
NP_440888.1_2 Forward -62 -48 10.1271 0.104
NP_440888.1_2 Reverse -206 -220 7.66879 0.186
NP_440888.1_2 Reverse -212 -226 7.57046 0.19
NP_440888.1_2 Forward -126 -112 6.58715 0.228
NP_442892.1_9 Reverse -155 -169 12.5853 0.296
NP_441918.1_7 Forward -278 -259 6.78429 0.262
NP_441469.1_8 Reverse -148 -157 9.93116 0.227
NP_441469.1_8 Forward -153 -144 5.01461 0.297
NP_442315.1_1 Reverse -378 -396 7.09898 0.251
NP_442315.1_1 Forward -223 -205 4.44404 0.271
NP_442204.1_6 Forward -61 -42 9.93088 0.202
NP_440516.1_2 Reverse -111 -129 -2.53746 0.299
NP_440516.1_6 Forward -277 -263 8.55376 0.246
NP_440516.1_8 Reverse -268 -277 -0.590259 0.283
NP_442428.1_5 Reverse -54 -61 4.46401 0.267
NP_442823.1_8 Forward -73 -54 13.5691 0.259
NP_440673.1_2 Reverse -145 -164 9.31652 0.248
NP_440673.1_3 Forward -60 -53 10.5605 0.123
NP_441052.1_2 Reverse -363 -373 5.87989 0.0998
NP_441052.1_2 Reverse -275 -285 2.24165 0.213
NP_442219.1_8 Forward -168 -149 6.33108 0.3
NP_440436.1_4 Forward -61 -52 10.7174 0.0743
NP_441004.1_1 Forward -227 -208 -10.7186 0.225
NP_441004.1_1 Forward -61 -42 -16.8151 0.287
NP_441004.1_3 Forward -274 -255 6.58763 0.223
NP_441004.1_5 Forward -87 -73 7.57108 0.288
NP_441004.1_5 Forward -225 -211 6.6861 0.298
NP_442813.1_4 Forward -91 -72 1.47442 0.197
NP_442813.1_4 Forward -92 -73 -7.96535 0.299
NP_441437.1_1 Reverse -164 -183 10.7175 0.264
NP_442873.1_5 Reverse -211 -230 10.3234 0.248
NP_442206.1_2 Forward -60 -41 10.2259 0.26
NP_442206.1_10 Reverse -380 -395 3.22482 0.188
NP_440864.1_9 Forward -60 -41 14.1591 0.0633
NP_441851.1_10 Reverse -116 -126 8.82982 0.114
NP_441195.1_8 Forward -369 -350 12.7825 0.159
NP_442622.1_8 Forward -240 -222 -19.1554 0.296
NP_442515.1_1 Forward -173 -159 6.88276 0.097
NP_442515.1_1 Reverse -275 -289 6.48943 0.0975
NP_440593.1_3 Forward -226 -207 13.5691 0.099
NP_440463.1_10 Reverse -347 -366 21.0423 0.161
NP_441046.1_2 Reverse -375 -394 1.37609 0.256
NP_442314.1_8 Forward -223 -206 4.07041 0.278
NP_440389.1_3 Forward -224 -205 13.8641 0.232
NP_442843.1_1 Reverse -54 -73 -5.50708 0.244
NP_442843.1_1 Forward -61 -42 -6.98204 0.245
NP_442843.1_1 Forward -239 -220 -11.1119 0.286
NP_440588.1_2 Forward -135 -116 -6.58872 0.285
NP_442006.1_2 Reverse -169 -186 -8.90928 0.197
NP_441003.1_9 Forward -381 -362 5.60432 0.261
NP_441003.1_9 Forward -339 -320 5.01433 0.271
NP_442243.1_1 Forward -221 -203 6.01657 0.178
NP_442243.1_1 Reverse -40 -58 -2.9315 0.298
NP_441570.1_1 Reverse -363 -381 -12.1739 0.209
NP_441570.1_2 Reverse -172 -190 5.91901 0.267
NP_440078.1_10 Forward -221 -202 3.34271 0.269
NP_441078.1_4 Reverse -163 -172 -1.08191 0.222
NP_441078.1_4 Forward -221 -212 -1.86856 0.272
NP_441078.1_4 Forward -172 -163 -1.86856 0.272
NP_441732.1_2 Reverse -208 -224 -17.346 0.253
NP_441732.1_2 Forward -176 -160 -17.641 0.281
NP_440760.1_1 Reverse -212 -231 -16.0285 0.163
NP_442797.1_1 Reverse -42 -61 -2.75381 0.261
NP_440199.1_10 Forward -375 -365 10.2065 0.185
NP_440913.1_3 Reverse -46 -59 13.884 0.265
NP_442489.1_2 Reverse -358 -377 1.57275 0.285
NP_442489.1_7 Forward -221 -212 -1.18024 0.18
NP_442489.1_7 Reverse -163 -172 -2.06522 0.288
NP_441830.1_2 Forward -125 -106 -1.37718 0.26
NP_440757.1_7 Forward -226 -208 -0.570838 0.269
NP_440559.1_1 Reverse -54 -63 4.52295 0.26
NP_441659.2_8 Reverse -212 -222 3.61828 0.154
NP_441040.1_2 Forward -223 -204 -6.09707 0.181
NP_441040.1_5 Reverse -113 -132 7.27595 0.229
NP_442346.1_1 Forward -61 -42 9.93088 0.275
NP_442346.1_5 Reverse -379 -389 6.46988 0.201
NP_442346.1_5 Forward -173 -163 4.89658 0.269
NP_440352.1_5 Reverse -165 -184 12.3637 0.229
NP_440352.1_5 Reverse -329 -348 11.4877 0.257
NP_440352.1_5 Forward -177 -158 10.9037 0.27
NP_440545.1_3 Reverse -376 -393 1.31714 0.121
NP_440025.1_3 Forward -353 -339 10.0299 0.29
NP_440831.1_3 Forward -381 -362 4.83391 0.298
NP_440459.1_2 Reverse -44 -61 14.9851 0.117
NP_440459.1_2 Reverse -72 -89 14.1985 0.119
NP_440459.1_2 Forward -181 -164 11.2486 0.18
NP_441653.1_2 Reverse -42 -61 11.2603 0.115
NP_440010.1_4 Forward -382 -363 -1.37794 0.267
NP_441943.1_8 Reverse -203 -222 -13.0786 0.261
NP_442551.1_4 Forward -305 -290 -2.47838 0.265
NP_442551.1_4 Reverse -161 -176 -2.97003 0.278
NP_442603.1_7 Reverse -363 -377 14.2569 0.0707
NP_442603.1_7 Reverse -212 -226 12.782 0.0948
NP_441585.1_5 Reverse -214 -233 1.86696 0.283
NP_441888.1_7 Reverse -48 -62 9.63603 0.142
NP_440671.1_4 Forward -158 -144 5.80112 0.271
NP_442140.1_3 Forward -220 -210 3.71661 0.283
NP_442021.1_3 Reverse -206 -225 -7.96535 0.288
NP_441671.1_10 Reverse -111 -130 7.66927 0.205
NP_441813.1_5 Reverse -51 -61 -0.806614 0.285
NP_441813.1_7 Reverse -43 -57 11.602 0.215
NP_440590.1_4 Reverse -213 -226 1.69091 0.115
NP_442497.1_10 Reverse -164 -173 0.196389 0.208
NP_441239.1_9 Reverse -73 -85 9.67541 0.0987
NP_441239.1_9 Reverse -51 -63 6.1355 0.2
NP_441239.1_9 Reverse -147 -159 4.46387 0.253
NP_441009.1_9 Forward -142 -123 12.0942 0.274
NP_441892.1_1 Reverse -203 -220 -3.10775 0.233
NP_441892.1_1 Reverse -354 -371 -3.8944 0.251
NP_440604.1_6 Reverse -380 -399 -4.52377 0.251
NP_442193.1_1 Forward -233 -215 12.9988 0.221
NP_442643.1_3 Forward -30 -11 -8.55534 0.295
NP_441017.1_6 Reverse -49 -63 11.012 0.285
NP_441541.1_1 Reverse -243 -261 -4.29515 0.273
NP_440833.1_6 Reverse -339 -353 11.7987 0.215
NP_442138.1_10 Reverse -149 -168 -5.01543 0.266
NP_442809.1_6 Reverse -118 -137 4.81767 0.256
NP_441184.1_3 Reverse -141 -160 1.17943 0.296
NP_440868.1_4 Reverse -365 -377 2.49725 0.153
NP_441249.1_1 Forward -149 -130 3.93269 0.197
NP_441474.1_1 Reverse -350 -369 -1.27961 0.261
NP_441848.1_7 Reverse -60 -79 2.35861 0.224
NP_441084.1_6 Reverse -183 -197 12.1559 0.169
NP_440696.1_6 Forward -226 -207 9.0459 0.229
NP_442358.1_10 Forward -43 -24 15.2408 0.219
NP_442023.1_2 Reverse -45 -64 6.39097 0.275
NP_441811.1_1 Reverse -65 -84 5.211 0.28
NP_441760.1_1 Forward -226 -207 14.5524 0.14
NP_440505.1_3 Reverse -266 -276 7.84651 0.147
NP_442255.1_5 Reverse -251 -270 11.1109 0.227
NP_440914.1_1 Reverse -117 -127 7.24882 0.242
NP_442101.1_10 Reverse -300 -319 -7.17871 0.209
NP_442533.1_1 Forward -375 -356 -7.37537 0.188
NP_442533.1_6 Forward -221 -212 10.6195 0.0529
NP_442533.1_6 Forward -215 -206 4.62128 0.179
NP_441028.1_6 Forward -184 -174 12.6642 0.183
NP_440116.1_8 Forward -61 -42 -7.67036 0.236
NP_441347.1_5 Forward -133 -119 17.4035 0.157
NP_441059.1_2 Forward -25 -6 -5.60541 0.257
NP_440608.1_6 Forward -171 -152 8.75009 0.238
NP_441972.1_5 Forward -163 -144 -7.37537 0.248
NP_441106.1_1 Reverse -52 -61 4.42462 0.226
NP_439903.1_6 Reverse -311 -330 6.09517 0.173
NP_442588.1_8 Reverse -366 -385 8.06259 0.238
NP_442306.1_10 Reverse -289 -308 -21.24 0.254
NP_441286.1_1 Reverse -162 -174 -5.46756 0.203
NP_442674.1_3 Reverse -355 -374 7.27514 0.219
NP_441479.1_9 Reverse -326 -344 16.3421 0.23
NP_442908.1_9 Forward -223 -204 19.6656 0.0464
NP_440886.1_7 Reverse -211 -221 6.86274 0.113
NP_440886.1_7 Reverse -42 -52 4.89613 0.213
NP_442614.1_2 Reverse -176 -190 9.63603 0.242
NP_442614.1_2 Forward -215 -201 7.27608 0.275
NP_442213.1_5 Reverse -106 -125 -1.7705 0.293
NP_441463.1_6 Reverse -292 -306 8.0587 0.25
NP_440501.1_10 Forward -278 -259 23.4997 0.0477
NP_442893.1_9 Forward -202 -183 14.5516 0.281
NP_441962.1_4 Forward -282 -263 -10.6203 0.232
NP_441962.1_4 Reverse -207 -226 -11.9969 0.25
NP_440855.1_5 Reverse -204 -223 5.40686 0.285
NP_441431.1_2 Reverse -209 -223 8.16044 0.222
NP_441431.1_2 Reverse -50 -64 7.66879 0.237
NP_441431.1_2 Reverse -265 -279 5.99717 0.281
NP_441993.1_1 Forward -372 -353 3.31109 0.237
NP_441993.1_1 Reverse -206 -225 1.55686 0.274
NP_441993.1_1 Forward -68 -49 1.16703 0.284
NP_441993.1_1 Forward -221 -202 0.972113 0.288
NP_442224.1_1 Reverse -210 -229 1.86774 0.233
NP_440114.1_10 Reverse -268 -282 10.9143 0.13
NP_440114.1_10 Reverse -53 -67 5.89945 0.292
NP_442698.1_10 Forward -176 -157 1.37609 0.297
NP_441510.2_7 Reverse -164 -178 9.73373 0.281
NP_441510.2_7 Forward -164 -150 9.14375 0.296
NP_440293.1_9 Forward -335 -321 13.7601 0.214
NP_441237.1_9 Reverse -164 -174 12.3697 0.125
NP_442635.1_9 Forward -199 -180 15.3631 0.262
NP_441133.1_1 Forward -229 -210 14.7491 0.2
NP_440798.1_6 Reverse -164 -177 2.37923 0.177
NP_440142.1_7 Forward -220 -201 9.24257 0.214
NP_442514.1_5 Reverse -349 -368 -9.53937 0.296
NP_440554.1_4 Forward -61 -51 5.78156 0.132
NP_441845.1_5 Reverse -297 -316 16.1642 0.225
NP_442737.1_5 Forward -63 -44 15.2059 0.167
NP_441885.1_5 Reverse -212 -222 -0.118297 0.186
NP_442310.1_5 Reverse -258 -277 9.0459 0.237
NP_442341.1_7 Reverse -211 -225 6.3911 0.127
NP_442341.1_9 Reverse -203 -217 7.76712 0.187
NP_441173.1_9 Forward -262 -254 11.0321 0.228
NP_441173.1_9 Forward -183 -175 9.75379 0.284
NP_441842.1_10 Forward -179 -165 7.07942 0.267
NP_441842.1_10 Forward -379 -365 6.78443 0.272
NP_442275.1_1 Forward -126 -107 8.45592 0.245
NP_442451.1_2 Reverse -45 -64 -9.14533 0.259
NP_441122.1_1 Reverse -159 -174 3.71647 0.28
NP_440149.1_8 Forward -68 -49 -0.688862 0.151
NP_440149.1_8 Reverse -53 -72 -7.86702 0.294
NP_441105.1_3 Forward -95 -76 -2.0655 0.156
NP_441105.1_3 Reverse -201 -220 -5.21209 0.214
NP_441105.1_3 Reverse -158 -177 -8.752 0.278
NP_441105.1_3 Forward -163 -144 -8.85033 0.279
NP_440172.1_1 Forward -372 -362 1.94665 0.29
NP_441844.1_5 Forward -288 -269 12.2908 0.195
NP_440198.1_3 Reverse -203 -222 15.9282 0.253
NP_441766.1_9 Forward -156 -137 6.19431 0.18
NP_440416.1_9 Forward -159 -140 -14.4552 0.176
NP_440416.1_9 Reverse -205 -224 -16.7168 0.22
NP_440416.1_9 Forward -133 -114 -18.2901 0.256
NP_440416.1_9 Forward -91 -72 -18.4868 0.259
NP_443052.1_9 Reverse -42 -61 -2.36049 0.238
NP_443052.1_9 Reverse -208 -227 -5.99873 0.276
NP_443052.1_9 Reverse -39 -58 -6.88371 0.289
NP_442403.1_9 Forward -191 -172 2.0644 0.292
NP_442154.1_1 Forward -61 -43 -13.5505 0.217
NP_440261.1_5 Reverse -164 -177 -12.0754 0.27
NP_440988.1_10 Forward -160 -146 5.77014 0.24
NP_440988.1_10 Forward -223 -209 5.38289 0.243
NP_440988.1_10 Reverse -367 -381 3.83388 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTTCATCACTGTCATCACCTCCCGATGGAGATGACGCAGGGGAGGTTGGTCAATTTCCTCTAGTCCGTTGACCTGGTCAAAGACCTTTTCATTGTGGCCCTTGACTTCAATGTTGTGGATGCCCAATTGCCGCGCTTTTTGCAAACCAATTAATAAGGCTCGATAGGACGCTTCTGTGCCGGTGGCCGAGGCCAGTAACTGTTTAACGCTGGTTCTTTTCCCCGTGGGCAATAGCAAAATGGCCACTGCGGCCCCTTGACCTTTTTGTCCTAGGGCTTCCCCGGCATAGAACAAAATTGGTATCGAATTACCTGTGCCATTGGGGGGAGAAGAATTAGCCATTGCTGGTGGTGTGGGGTGTTTACAATAACAGGGCAACCAGTTGGAGTAATTGACCG

CDS

ATGTTGGAAAGAATTCTGGAGCCAGAGGTAATGGACACCGAAGCAGAAGCAATGGACTACGATGCCATGGACTTTCAAGCGGTTAATCTGGCTTTTGCCCAGAGAGCTTGCCAACTCGGCCCAAGCAAAGCCACAGTGTTAGATGCCGGTACTGGTACGGCCCGTATTCCCATTCTACTCGCCCAGTTACGTCCTGCATGGCAAATCACTGCCATCGATTTTGCTCGTTCTATGTTGGCGATCGCCAAGGAAAATGTGATCGCAGCGGGGTGTGAAACTCAAATTTGCCTGGAATTTGTCGATGCAAAACAATTGCCCTACGCCAATGGTTCCTTTGACGGAGTGATTGCCAATAGCCTCTGTCATCATTTGCCCAGGCCGCTGGATTTTTTGCGGGAGGTAAAACGGGTGCTCAAGCCCCACGGTTTCCTATTAATTAGGGATTTAATTCGCCCCGAATCCCCGGAAAAATTAGCTGATTTCGTAACGGCGATCGGCTCCGACTACAACGACCAGCAGAGGAAACTTTTTGCTGATTCCCTCCACGCTTCCCTAACTATCGCTGAAATACAAGACTATCTCCAGCATTTGGGTTGGGTCGGTGATGATGGTCCCAACCTGGAGTTACACCTTTACCAGTCTTCCGATCGCCATTGGACATTGGAGAAGAAGTTCCAAAGTTCAACCATAGTACAGCGATAG

Protein

MLERILEPEVMDTEAEAMDYDAMDFQAVNLAFAQRACQLGPSKATVLDAGTGTARIPILLAQLRPAWQITAIDFARSMLAIAKENVIAAGCETQICLEFVDAKQLPYANGSFDGVIANSLCHHLPRPLDFLREVKRVLKPHGFLLIRDLIRPESPEKLADFVTAIGSDYNDQQRKLFADSLHASLTIAEIQDYLQHLGWVGDDGPNLELHLYQSSDRHWTLEKKFQSSTIVQR