Your browser is old and dusty. Try Google Chrome!

Details for slr1037

ORF slr1037
Accession NP_440496.1
Symbol
Category two-component response regulator CheY subfamily
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_441418.1_6 Forward -119 -100 -29.4998 0.228
NP_442272.1_1 Reverse -37 -55 14.8032 0.238
NP_440897.1_6 Forward -119 -100 -2.26292 0.206
NP_441453.1_1 Forward -126 -108 3.16499 0.276
NP_441453.1_4 Reverse -110 -118 16.539 0.00633
NP_441453.1_4 Forward -119 -111 16.539 0.00633
NP_442151.1_6 Reverse -110 -124 13.7659 0.0457
NP_442151.1_6 Forward -119 -105 7.9644 0.184
NP_440561.1_8 Forward -242 -223 6.88262 0.282
NP_441818.1_1 Forward -118 -107 13.8245 0.0623
NP_441818.1_1 Reverse -111 -122 9.59626 0.232
NP_441818.1_9 Forward -244 -225 -7.4737 0.272
NP_441818.1_9 Reverse -185 -204 -9.44032 0.291
NP_441818.1_9 Forward -251 -232 -10.227 0.292
NP_440226.1_1 Reverse -110 -129 8.35759 0.0885
NP_440226.1_1 Forward -119 -100 1.76941 0.29
NP_441630.1_3 Reverse -102 -121 13.8641 0.0534
NP_442287.1_1 Reverse -224 -234 14.6309 0.256
NP_442173.1_1 Forward -118 -110 15.4574 0.00633
NP_442173.1_1 Reverse -111 -119 15.4574 0.00633
NP_442752.1_4 Forward -119 -112 13.8055 0.0199
NP_442752.1_4 Reverse -110 -117 13.8055 0.0199
NP_443027.1_4 Forward -121 -111 16.2046 0.0437
NP_441812.1_3 Reverse -109 -123 11.5043 0.21
NP_441812.1_3 Forward -28 -14 11.111 0.215
NP_442975.1_10 Forward -123 -109 12.782 0.0459
NP_442975.1_10 Reverse -106 -120 3.44058 0.259
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_440061.1_9 Forward -121 -107 17.7968 0.012
NP_441054.1_2 Forward -362 -343 14.0608 0.172
NP_441499.1_8 Reverse -237 -256 11.8975 0.161
NP_442062.1_3 Forward -52 -33 -2.75381 0.272
NP_442062.1_8 Forward -119 -109 17.6796 0.00193
NP_442062.1_8 Reverse -110 -120 10.3048 0.0493
NP_440761.1_4 Forward -124 -105 -13.5702 0.257
NP_441900.1_2 Reverse -45 -63 0.116744 0.258
NP_440304.1_4 Forward -121 -111 19.9412 0.00364
NP_440304.1_4 Reverse -108 -118 9.91146 0.051
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_440044.1_8 Reverse -111 -130 -0.983855 0.233
NP_441594.1_6 Forward -114 -95 0.392778 0.287
NP_442110.1_7 Reverse -110 -124 2.06454 0.222
NP_441925.1_4 Reverse -225 -244 -6.19614 0.185
NP_441925.1_4 Reverse -224 -243 -15.0459 0.263
NP_441925.1_4 Reverse -226 -245 -15.2425 0.263
NP_441083.1_5 Forward -119 -109 19.3512 0.000718
NP_441083.1_5 Reverse -110 -120 11.2881 0.0159
NP_442827.1_8 Reverse -102 -121 1.47364 0.178
NP_441434.1_7 Forward -117 -103 1.76955 0.295
NP_441738.1_2 Forward -117 -110 15.28 0.0102
NP_441738.1_2 Reverse -112 -119 15.28 0.0102
NP_441558.1_5 Forward -121 -102 10.9142 0.0895
NP_440209.1_1 Reverse -110 -118 18.1123 0.00295
NP_440209.1_1 Forward -119 -111 18.1123 0.00295
NP_442889.1_8 Reverse -107 -121 9.24208 0.101
NP_440447.1_1 Reverse -355 -373 5.82068 0.194
NP_440447.1_6 Reverse -102 -120 7.88563 0.14
NP_441770.1_5 Reverse -144 -163 -1.67217 0.277
NP_440178.1_7 Reverse -109 -128 6.29264 0.0153
NP_441716.1_1 Reverse -110 -124 4.12949 0.258
NP_441327.1_1 Forward -225 -206 4.02116 0.274
NP_442111.1_4 Forward -120 -106 9.34103 0.0609
NP_440343.1_3 Reverse -226 -244 14.768 0.0883
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_441209.1_8 Reverse -1 -19 13.8206 0.12
NP_440747.1_10 Reverse -107 -119 7.31547 0.00577
NP_440747.1_10 Forward -122 -110 -1.92764 0.0192
NP_441130.1_10 Reverse -108 -122 5.01447 0.251
NP_441486.1_1 Forward -122 -108 5.60446 0.036
NP_442634.1_4 Reverse -108 -122 15.2409 0.0126
NP_441265.1_3 Reverse -104 -118 1.57289 0.2
NP_441014.1_8 Reverse -226 -245 1.0811 0.214
NP_442848.1_1 Forward -125 -111 -2.26202 0.263
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_443018.1_3 Forward -110 -103 8.39725 0.147
NP_441634.1_8 Reverse -108 -122 -4.52363 0.295
NP_440376.1_1 Forward -119 -110 19.4693 0.000692
NP_440376.1_1 Reverse -110 -119 19.4693 0.000692
NP_441588.1_4 Reverse -112 -122 6.66654 0.185
NP_442687.1_7 Reverse -109 -119 18.5646 0.0028
NP_442687.1_7 Forward -120 -110 9.02648 0.0994
NP_441846.1_10 Forward -244 -225 -19.2734 0.256
NP_441846.1_10 Forward -250 -231 -21.4367 0.256
NP_441846.1_10 Forward -251 -232 -21.535 0.256
NP_441846.1_10 Forward -245 -226 -21.7317 0.256
NP_440642.1_10 Reverse -42 -56 1.5723 0.29
NP_441950.1_7 Reverse -181 -200 -6.88371 0.274
NP_441950.1_7 Reverse -128 -147 -7.4737 0.278
NP_441274.1_9 Forward -262 -243 20.059 0.0117
NP_442658.1_1 Reverse -108 -118 16.0075 0.00966
NP_442658.1_1 Forward -121 -111 13.0576 0.04
NP_442782.1_2 Forward -357 -343 6.98109 0.215
NP_442205.1_9 Reverse -146 -162 2.61514 0.209
NP_442205.1_9 Forward -125 -109 -3.08806 0.278
NP_440656.1_2 Reverse -31 -50 -0.885524 0.258
NP_440656.1_8 Forward -130 -111 7.07928 0.0791
NP_441414.1_9 Forward -119 -100 -7.86702 0.227
NP_441414.1_9 Reverse -110 -129 -10.9153 0.297
NP_441256.1_8 Reverse -184 -203 3.93269 0.272
NP_441958.1_5 Forward -120 -110 21.2195 0.000805
NP_441958.1_5 Reverse -109 -119 20.5312 0.000966
NP_440450.1_7 Reverse -224 -238 20.7467 0.0167
NP_442836.1_10 Forward -234 -224 11.0914 0.269
NP_439905.1_1 Forward -118 -105 8.57408 0.232
NP_440984.1_7 Reverse -105 -119 17.3058 0.0267
NP_439990.1_5 Forward -124 -111 6.80412 0.221
NP_442690.1_1 Forward -366 -347 -9.83364 0.205
NP_442690.1_1 Reverse -333 -352 -16.8151 0.291
NP_442911.1_2 Reverse -100 -119 -3.44213 0.112
NP_442911.1_2 Forward -129 -110 -9.73531 0.262
NP_440153.1_5 Reverse -111 -125 1.76955 0.245
NP_443055.1_6 Forward -119 -101 3.45998 0.196
NP_443055.1_6 Reverse -217 -235 -0.76823 0.266
NP_440993.1_2 Reverse -375 -391 5.36841 0.234
NP_440993.1_3 Reverse -100 -119 1.17865 0.235
NP_440496.1_1 Forward -249 -230 21.7306 0.00884
NP_440496.1_2 Forward -165 -146 20.059 0.033
NP_440496.1_3 Forward -222 -203 20.7691 0.0466
NP_440496.1_4 Forward -194 -175 20.8447 0.0313
NP_440496.1_5 Forward -386 -367 25.4482 0.00654
NP_440496.1_6 Forward -348 -329 27.4338 0.00181
NP_440496.1_7 Forward -105 -86 20.0581 0.0719
NP_440496.1_10 Forward -130 -116 20.2551 0.258
NP_440602.1_2 Reverse -176 -195 1.27776 0.263
NP_443044.1_1 Reverse -28 -47 11.0125 0.212
NP_439975.1_2 Forward -239 -221 11.8189 0.186
NP_441099.1_5 Reverse -100 -119 -11.8003 0.29
NP_442002.1_9 Reverse -109 -116 14.1004 0.074
NP_441294.1_7 Forward -123 -109 11.0744 0.157
NP_441294.1_7 Reverse -221 -235 8.57871 0.294
NP_441646.1_1 Reverse -103 -122 0.294447 0.252
NP_442885.1_5 Reverse -283 -302 14.3549 0.276
NP_441000.1_6 Reverse -109 -123 4.42448 0.0953
NP_441000.1_6 Forward -120 -106 -3.73699 0.225
NP_442870.1_4 Forward -385 -371 16.6175 0.22
NP_440147.1_4 Forward -121 -108 11.6223 0.0326
NP_440147.1_4 Reverse -108 -121 9.95071 0.0362
NP_441550.1_8 Reverse -108 -118 18.1707 0.00754
NP_441550.1_8 Forward -121 -111 13.0576 0.0273
NP_441916.1_7 Reverse -110 -120 18.9579 0.00144
NP_441916.1_7 Forward -119 -109 16.893 0.00407
NP_441041.1_7 Reverse -107 -119 10.8188 0.0864
NP_441041.1_7 Forward -122 -110 9.65268 0.108
NP_441725.1_5 Forward -118 -108 11.7798 0.0247
NP_441725.1_5 Reverse -111 -121 11.1898 0.0247
NP_439966.1_7 Forward -121 -111 14.8275 0.0177
NP_439966.1_7 Reverse -108 -118 8.63269 0.132
NP_442941.1_3 Reverse -111 -121 19.9412 0.00262
NP_442941.1_3 Forward -118 -108 10.6981 0.0116
NP_440289.1_2 Forward -122 -109 16.2439 0.00946
NP_440289.1_2 Reverse -107 -120 5.62415 0.0623
NP_442281.1_1 Reverse -105 -119 11.602 0.0447
NP_442281.1_1 Forward -124 -110 9.14375 0.0736
NP_442256.1_2 Forward -121 -103 -8.14232 0.217
NP_442256.1_8 Reverse -204 -223 15.1416 0.253
NP_440437.1_1 Forward -125 -106 -4.72043 0.266
NP_442012.1_9 Reverse -215 -233 16.4046 0.223
NP_442982.1_5 Forward -129 -110 -2.0655 0.281
NP_441644.1_6 Reverse -110 -120 19.0557 0.000803
NP_441644.1_6 Forward -119 -109 15.7125 0.0048
NP_443049.1_6 Forward -235 -225 11.153 0.278
NP_442177.1_5 Forward -237 -223 13.3726 0.22
NP_440253.1_2 Forward -119 -101 6.90232 0.0752
NP_440929.1_8 Forward -119 -110 19.2726 0.000701
NP_440929.1_8 Reverse -110 -119 19.2726 0.000701
NP_442933.1_10 Forward -119 -110 17.601 0.00325
NP_442933.1_10 Reverse -110 -119 17.601 0.00325
NP_441751.2_8 Reverse -111 -125 3.93283 0.0596
NP_442926.1_5 Reverse -105 -124 12.1147 0.19
NP_442554.1_8 Reverse -111 -121 16.9913 0.0065
NP_442554.1_8 Forward -118 -108 15.123 0.00944
NP_441762.1_7 Reverse -109 -121 1.61227 0.0736
NP_441762.1_7 Forward -120 -108 -6.74586 0.284
NP_442142.1_4 Forward -122 -109 6.90188 0.153
NP_442142.1_4 Reverse -107 -120 4.54195 0.217
NP_442292.1_1 Reverse -111 -120 17.5026 0.00435
NP_442292.1_1 Forward -118 -109 9.53783 0.0183
NP_442476.1_6 Forward -118 -104 1.96621 0.199
NP_442381.1_8 Forward -122 -103 -3.63879 0.126
NP_442381.1_8 Reverse -99 -118 -12.9802 0.267
NP_443009.1_5 Forward -120 -109 17.0694 0.00659
NP_443009.1_5 Reverse -109 -120 16.7744 0.00677
NP_442408.2_1 Reverse -110 -129 -4.03212 0.254
NP_441715.1_4 Reverse -111 -121 14.238 0.0295
NP_441715.1_4 Forward -118 -108 9.81313 0.097
NP_441198.1_4 Forward -240 -221 24.8772 0.00755
NP_441198.1_8 Forward -121 -111 13.2713 0.108
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441020.2_6 Forward -121 -104 13.9035 0.0641
NP_441020.2_7 Reverse -225 -244 16.6165 0.146
NP_441015.1_6 Forward -386 -367 10.7175 0.0911
NP_441015.1_10 Reverse -182 -201 -10.817 0.288
NP_441673.1_1 Forward -119 -110 20.8459 0.000698
NP_441673.1_1 Reverse -110 -119 20.8459 0.000698
NP_441826.1_2 Forward -125 -111 -4.52363 0.296
NP_442490.1_9 Reverse -98 -117 -8.55534 0.292
NP_442868.1_6 Reverse -108 -118 18.5646 0.0104
NP_442868.1_6 Forward -121 -111 1.06167 0.205
NP_442227.1_2 Reverse -225 -244 -2.95047 0.285
NP_442427.1_8 Forward -128 -109 12.0942 0.152
NP_442808.1_1 Reverse -109 -119 8.73102 0.0481
NP_442808.1_1 Forward -120 -110 8.73102 0.0481
NP_442808.1_1 Reverse -224 -234 3.22451 0.247
NP_442542.1_2 Reverse -108 -121 10.4424 0.126
NP_442050.1_5 Forward -121 -111 18.0724 0.00365
NP_442050.1_5 Reverse -108 -118 13.6475 0.0295
NP_442342.1_9 Reverse -108 -124 12.6449 0.103
NP_442792.1_5 Forward -356 -339 12.3302 0.268
NP_441878.1_6 Reverse -109 -119 20.2362 0.0046
NP_441878.1_6 Forward -120 -110 10.5014 0.0176
NP_441036.1_8 Forward -120 -110 15.713 0.00724
NP_441036.1_8 Reverse -109 -119 8.4365 0.174
NP_441557.1_5 Forward -119 -110 19.9609 0.000699
NP_441557.1_5 Reverse -110 -119 19.9609 0.000699
NP_441445.1_1 Forward -128 -109 2.16274 0.24
NP_441590.1_4 Reverse -225 -244 5.2102 0.279
NP_441590.1_4 Reverse -226 -245 3.73524 0.29
NP_441590.1_4 Reverse -232 -251 3.44025 0.29
NP_442267.1_4 Reverse -190 -209 6.19431 0.179
NP_441433.1_8 Reverse -135 -154 -2.26216 0.268
NP_442777.1_1 Reverse -232 -251 3.9319 0.3
NP_441739.1_2 Reverse -218 -234 6.2527 0.227
NP_441308.1_8 Forward -121 -111 13.353 0.218
NP_442183.1_1 Reverse -110 -124 9.34103 0.0986
NP_442183.1_9 Forward -61 -51 11.0914 0.229
NP_441574.1_1 Forward -161 -142 -2.36049 0.226
NP_442347.1_2 Forward -118 -109 3.34298 0.284
NP_442347.1_2 Reverse -111 -120 3.34298 0.284
NP_442645.1_2 Forward -176 -157 -19.5684 0.288
NP_442645.1_2 Reverse -150 -169 -19.5684 0.288
NP_441037.1_4 Reverse -108 -118 9.55921 0.21
NP_441037.1_4 Forward -121 -111 7.31769 0.237
NP_442594.1_8 Forward -64 -45 1.96607 0.295
NP_442508.1_8 Forward -241 -224 11.7402 0.256
NP_440151.1_3 Forward -249 -230 19.469 0.11
NP_441633.1_3 Forward -121 -108 -3.71729 0.177
NP_441633.1_3 Reverse -108 -121 -3.91395 0.177
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_441728.2_4 Reverse -325 -344 12.8432 0.263
NP_442998.1_5 Forward -358 -348 7.55152 0.289
NP_442998.1_10 Forward -117 -110 15.5754 0.0102
NP_442998.1_10 Reverse -112 -119 15.5754 0.0102
NP_440899.1_8 Reverse -39 -58 -7.4737 0.246
NP_440299.1_1 Reverse -106 -119 7.78685 0.105
NP_441799.1_1 Reverse -106 -120 13.2736 0.0337
NP_441799.1_1 Forward -123 -109 4.62054 0.242
NP_441007.1_10 Reverse -105 -118 -0.570702 0.287
NP_442201.1_10 Reverse -99 -118 7.17762 0.0503
NP_440256.1_1 Forward -122 -103 13.3725 0.0103
NP_440256.1_1 Reverse -107 -126 1.57275 0.0733
NP_441559.1_8 Forward -124 -110 -7.47356 0.294
NP_441270.1_5 Forward -381 -362 12.4087 0.237
NP_440915.1_6 Reverse -106 -120 11.701 0.0253
NP_440915.1_6 Forward -123 -109 2.75286 0.112
NP_442158.1_4 Reverse -137 -147 12.8614 0.239
NP_442785.1_7 Forward -121 -107 10.6193 0.228
NP_441866.1_3 Forward -187 -174 12.2123 0.225
NP_441866.1_6 Reverse -340 -359 11.7983 0.19
NP_441464.1_10 Forward -236 -222 11.5043 0.22
NP_440306.1_8 Forward -216 -197 0.588665 0.204
NP_441939.1_3 Forward -118 -99 22.1239 0.00364
NP_442993.1_1 Reverse -110 -126 8.90832 0.0235
NP_442993.1_1 Reverse -127 -143 -9.87289 0.197
NP_442386.1_9 Reverse -353 -362 6.48915 0.219
NP_442386.1_9 Forward -120 -111 6.39082 0.219
NP_442386.1_9 Reverse -109 -118 6.39082 0.219
NP_442386.1_9 Reverse -224 -233 5.70251 0.241
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_441271.1_8 Forward -349 -339 14.0414 0.266
NP_440327.1_6 Forward -251 -232 3.53937 0.284
NP_440327.1_6 Forward -245 -226 2.26107 0.298
NP_441254.1_1 Reverse -216 -229 11.3267 0.295
NP_440161.1_3 Reverse -108 -127 13.6675 0.132
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_440586.1_8 Forward -110 -103 7.21693 0.27
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_441262.1_3 Reverse -110 -117 14.7888 0.0223
NP_441262.1_3 Forward -119 -112 14.7888 0.0223
NP_440027.1_3 Reverse -225 -243 14.0797 0.12
NP_440027.1_3 Reverse -226 -244 12.0147 0.159
NP_443051.1_1 Forward -120 -111 19.5676 0.00335
NP_443051.1_1 Reverse -109 -118 18.0926 0.00402
NP_442294.1_3 Reverse -343 -357 13.077 0.274
NP_440439.1_1 Forward -122 -109 11.0324 0.0339
NP_440439.1_1 Reverse -107 -120 1.69091 0.147
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_441946.1_7 Reverse -226 -244 12.0147 0.258
NP_441789.1_7 Reverse -234 -253 -0.39464 0.251
NP_440589.1_3 Forward -244 -225 10.6192 0.147
NP_440139.1_1 Reverse -104 -123 6.68515 0.139
NP_440267.1_2 Forward -124 -110 9.73373 0.156
NP_440267.1_2 Reverse -105 -119 9.6354 0.156
NP_442549.1_6 Reverse -327 -346 22.3206 0.0179
NP_442384.1_10 Forward -119 -106 12.8023 0.0249
NP_441018.1_7 Reverse -130 -149 12.1925 0.167
NP_442790.1_4 Forward -378 -359 -11.2103 0.223
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_442262.1_10 Forward -110 -103 10.7572 0.124
NP_441689.1_5 Forward -121 -111 17.8758 0.0158
NP_440344.1_10 Forward -126 -109 -8.12263 0.123
NP_440531.1_6 Forward -127 -108 -0.197208 0.205
NP_442750.1_3 Forward -48 -29 -12.2919 0.276
NP_440297.1_9 Forward -118 -108 9.61647 0.0917
NP_440297.1_9 Reverse -111 -121 9.22315 0.0917
NP_440350.1_5 Reverse -79 -98 -6.78538 0.297
NP_440888.1_2 Reverse -110 -124 14.5519 0.0168
NP_440888.1_2 Forward -119 -105 9.04542 0.139
NP_440600.1_4 Reverse -102 -120 -0.669169 0.155
NP_442277.1_4 Reverse -101 -120 8.25844 0.13
NP_440575.1_4 Reverse -128 -147 16.9065 0.115
NP_441543.1_2 Reverse -111 -120 15.9293 0.00518
NP_441543.1_2 Forward -118 -109 9.34117 0.0818
NP_442845.1_2 Reverse -96 -110 7.17775 0.198
NP_442845.1_2 Forward -369 -355 4.22782 0.264
NP_442845.1_4 Reverse -108 -127 7.57094 0.189
NP_441304.1_10 Forward -48 -39 14.7494 0.164
NP_440982.1_1 Forward -201 -182 4.81688 0.294
NP_441469.1_8 Reverse -109 -118 13.3727 0.073
NP_441469.1_8 Forward -120 -111 6.5879 0.227
NP_443064.1_6 Forward -119 -109 13.8273 0.0796
NP_443064.1_6 Reverse -110 -120 10.8217 0.13
NP_443064.1_6 Reverse -152 -162 9.46426 0.219
NP_442337.1_8 Forward -383 -364 2.16274 0.218
NP_442337.1_8 Forward -388 -369 -1.7705 0.29
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_440220.1_4 Reverse -341 -360 0.686995 0.244
NP_441462.1_2 Reverse -110 -120 20.2362 0.000805
NP_441462.1_2 Forward -119 -109 20.1379 0.000967
NP_441929.1_3 Reverse -36 -55 4.916 0.266
NP_443062.1_1 Reverse -110 -128 8.64343 0.15
NP_443062.1_6 Forward -127 -108 6.88262 0.179
NP_441601.1_4 Reverse -231 -250 1.37609 0.245
NP_441410.1_3 Reverse -101 -120 6.68596 0.23
NP_442204.1_1 Forward -123 -112 0.157002 0.283
NP_442872.1_1 Forward -151 -132 -11.9969 0.252
NP_440516.1_8 Forward -119 -110 16.9127 0.00442
NP_440516.1_8 Reverse -110 -119 16.9127 0.00442
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_440783.1_5 Forward -251 -232 3.14605 0.16
NP_440673.1_3 Forward -117 -110 12.4288 0.0426
NP_440673.1_3 Reverse -112 -119 12.4288 0.0426
NP_440718.1_2 Forward -356 -337 13.8641 0.197
NP_440865.1_9 Forward -125 -106 -7.37537 0.244
NP_441052.1_2 Forward -119 -109 10.4031 0.0285
NP_441052.1_2 Reverse -110 -120 10.4031 0.0285
NP_442219.1_9 Forward -118 -109 8.25953 0.0681
NP_442219.1_9 Reverse -111 -120 8.25953 0.0681
NP_440436.1_4 Forward -118 -109 15.9289 0.00508
NP_440436.1_4 Reverse -111 -120 9.24241 0.0871
NP_442577.1_9 Reverse -221 -235 10.1271 0.288
NP_441086.1_6 Reverse -355 -365 17.2858 0.141
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Forward -122 -109 6.60746 0.179
NP_442366.1_3 Reverse -109 -127 1.29745 0.153
NP_442695.1_3 Forward -365 -351 16.1252 0.219
NP_441115.1_4 Forward -120 -102 10.2448 0.183
NP_443054.1_2 Reverse -108 -122 2.85119 0.24
NP_443054.1_2 Forward -121 -107 0.88457 0.252
NP_441851.1_10 Reverse -109 -119 17.4829 0.0027
NP_441851.1_10 Forward -120 -110 8.53483 0.114
NP_441851.1_10 Reverse -197 -207 4.0116 0.291
NP_442515.1_1 Forward -120 -106 13.2743 0.0278
NP_442515.1_1 Reverse -109 -123 2.5562 0.133
NP_442709.1_7 Forward -333 -314 13.3716 0.278
NP_440940.1_7 Forward -129 -111 4.73828 0.242
NP_441349.1_10 Forward -129 -110 11.7992 0.022
NP_441409.1_6 Forward -125 -106 -13.9635 0.247
NP_441409.1_8 Forward -140 -121 6.92008 0.298
NP_440389.1_2 Reverse -147 -166 11.9958 0.281
NP_440432.1_9 Forward -118 -103 16.2045 0.0121
NP_440432.1_9 Reverse -111 -126 6.37141 0.0477
NP_439960.1_6 Reverse -230 -249 7.66927 0.28
NP_440474.1_8 Reverse -111 -125 5.60385 0.246
NP_442450.1_5 Reverse -108 -118 10.0098 0.115
NP_442450.1_5 Forward -121 -111 9.41981 0.115
NP_442335.1_2 Forward -374 -355 15.8307 0.28
NP_441570.1_1 Reverse -110 -128 11.1305 0.00811
NP_441078.1_4 Forward -119 -110 19.6659 0.0007
NP_441078.1_4 Reverse -110 -119 19.6659 0.0007
NP_441094.1_6 Forward -163 -146 8.10125 0.269
NP_440526.1_3 Reverse -111 -122 1.82816 0.267
NP_440526.1_3 Forward -118 -107 1.72983 0.267
NP_441432.1_8 Forward -120 -111 16.8143 0.00595
NP_441432.1_8 Reverse -109 -118 8.35786 0.0755
NP_442320.1_8 Forward -125 -111 -3.147 0.11
NP_442320.1_8 Reverse -104 -118 -3.93365 0.136
NP_441732.1_2 Forward -123 -107 -16.4611 0.167
NP_440760.1_1 Forward -119 -100 -18.7818 0.217
NP_440760.1_1 Reverse -110 -129 -22.8133 0.271
NP_442797.1_1 Reverse -225 -244 -2.0655 0.243
NP_440199.1_10 Forward -122 -112 14.238 0.0861
NP_440713.1_4 Reverse -142 -161 4.52268 0.226
NP_442489.1_7 Forward -119 -110 20.1576 0.000695
NP_442489.1_7 Reverse -110 -119 20.1576 0.000695
NP_440941.1_1 Forward -241 -231 16.4996 0.241
NP_440565.1_7 Forward -259 -240 -1.96717 0.291
NP_440559.1_1 Forward -118 -109 17.306 0.00658
NP_440559.1_1 Reverse -111 -120 8.65285 0.0586
NP_441659.2_8 Reverse -110 -120 20.9245 0.000805
NP_441659.2_8 Forward -119 -109 19.3512 0.000966
NP_441022.1_1 Forward -355 -346 11.1625 0.284
NP_442913.1_10 Reverse -101 -120 -4.72043 0.244
NP_440779.1_5 Forward -119 -102 -5.56602 0.149
NP_440779.1_5 Reverse -110 -127 -14.8091 0.274
NP_441185.1_6 Reverse -154 -173 0.58944 0.24
NP_442346.1_5 Reverse -109 -119 17.9746 0.00128
NP_442346.1_5 Forward -120 -110 16.303 0.00248
NP_440545.1_5 Forward -238 -221 5.54538 0.233
NP_440545.1_5 Reverse -188 -205 4.3654 0.252
NP_441786.1_10 Forward -128 -109 6.68596 0.278
NP_441923.1_6 Reverse -141 -155 7.66941 0.298
NP_440486.1_6 Reverse -315 -334 9.83255 0.219
NP_441653.1_2 Reverse -99 -118 12.3233 0.0959
NP_440847.1_3 Reverse -233 -247 11.4053 0.263
NP_442603.1_7 Forward -119 -105 9.43874 0.146
NP_440449.1_6 Reverse -102 -120 6.21331 0.255
NP_441948.1_4 Forward -126 -108 6.31233 0.0646
NP_441948.1_4 Reverse -103 -121 2.77242 0.121
NP_440170.1_6 Forward -161 -142 16.3224 0.14
NP_441358.1_2 Forward -245 -226 9.93088 0.244
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_440671.1_4 Forward -125 -111 12.4876 0.107
NP_441973.1_1 Reverse -41 -56 -0.118434 0.269
NP_440772.1_8 Reverse -219 -238 6.98095 0.297
NP_440204.1_4 Reverse -129 -148 10.1275 0.138
NP_442199.1_5 Reverse -102 -121 0.884433 0.166
NP_442140.1_3 Forward -118 -108 11.5831 0.0743
NP_442723.1_1 Forward -165 -146 5.60352 0.276
NP_442723.1_1 Reverse -215 -234 2.85027 0.282
NP_440875.1_9 Reverse -112 -122 7.59334 0.255
NP_441813.1_5 Reverse -108 -118 18.3679 0.00743
NP_441813.1_5 Forward -121 -111 15.9097 0.01
NP_440590.1_4 Forward -118 -105 1.29759 0.127
NP_440590.1_4 Reverse -153 -166 -2.34066 0.241
NP_440590.1_4 Reverse -111 -124 -3.81562 0.255
NP_440567.1_1 Forward -118 -104 -0.688726 0.298
NP_442497.1_10 Forward -118 -109 19.8626 0.00532
NP_442497.1_10 Reverse -111 -120 17.601 0.00813
NP_440821.1_4 Forward -121 -111 11.0914 0.0146
NP_440821.1_4 Reverse -108 -118 10.9931 0.0146
NP_441239.1_9 Forward -121 -109 15.6736 0.0186
NP_441239.1_9 Reverse -108 -120 12.6253 0.0446
NP_441892.1_1 Forward -128 -111 5.44704 0.101
NP_441017.1_6 Forward -123 -109 12.6836 0.217
NP_442216.1_4 Reverse -220 -228 8.1805 0.255
NP_442216.1_4 Reverse -49 -57 8.08217 0.255
NP_440354.1_7 Reverse -104 -122 6.60732 0.278
NP_440412.1_2 Forward -71 -52 6.39097 0.281
NP_440546.1_4 Reverse -110 -120 13.5365 0.0459
NP_440546.1_4 Forward -119 -109 12.8578 0.0572
NP_440546.1_6 Reverse -338 -357 11.8975 0.245
NP_440462.1_4 Forward -241 -227 6.78443 0.278
NP_440462.1_6 Forward -121 -111 16.893 0.00853
NP_440462.1_6 Reverse -108 -118 9.7148 0.0429
NP_440868.1_4 Forward -123 -111 5.93884 0.0879
NP_440868.1_4 Reverse -106 -118 1.02229 0.193
NP_440401.1_9 Reverse -229 -236 14.5917 0.287
NP_441474.1_1 Reverse -225 -244 6.29183 0.212
NP_441474.1_1 Reverse -227 -246 -2.75457 0.285
NP_442402.1_4 Forward -152 -133 -5.90115 0.249
NP_442402.1_4 Reverse -340 -359 -5.99948 0.249
NP_442402.1_10 Forward -37 -27 10.206 0.299
NP_440696.1_3 Forward -244 -226 8.47561 0.15
NP_440696.1_6 Reverse -187 -206 5.211 0.279
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_441926.1_3 Reverse -127 -143 11.4649 0.124
NP_441926.1_3 Reverse -110 -126 7.04003 0.17
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_442837.1_4 Reverse -232 -251 9.43923 0.233
NP_442053.1_1 Forward -119 -110 18.3876 0.0007
NP_442053.1_1 Reverse -110 -119 18.3876 0.0007
NP_440505.1_3 Forward -121 -111 15.123 0.014
NP_440505.1_3 Reverse -108 -118 9.61647 0.122
NP_441701.1_3 Forward -62 -45 12.2319 0.207
NP_441252.1_6 Forward -230 -223 11.6422 0.288
NP_440914.1_1 Reverse -110 -120 16.3248 0.00196
NP_440914.1_1 Forward -119 -109 8.51751 0.186
NP_441011.1_8 Reverse -111 -120 16.6177 0.00602
NP_441011.1_8 Forward -118 -109 14.356 0.0249
NP_442533.1_1 Forward -244 -225 -5.01543 0.155
NP_442533.1_1 Forward -64 -45 -12.7836 0.236
NP_442533.1_1 Forward -243 -224 -14.1602 0.24
NP_442533.1_1 Forward -249 -230 -15.2418 0.253
NP_442533.1_1 Forward -250 -231 -15.5368 0.256
NP_442533.1_6 Forward -119 -110 17.2076 0.00137
NP_442533.1_6 Reverse -110 -119 17.2076 0.00137
NP_442322.1_4 Reverse -228 -245 -1.53514 0.226
NP_442322.1_4 Reverse -227 -244 -6.55 0.277
NP_441482.1_7 Forward -125 -111 -1.37704 0.0683
NP_441482.1_7 Reverse -104 -118 -2.85201 0.1
NP_441482.1_7 Reverse -354 -368 -3.73699 0.138
NP_439944.1_9 Reverse -111 -121 17.6796 0.00347
NP_439944.1_9 Forward -118 -108 8.82982 0.101
NP_440816.1_8 Reverse -338 -352 16.2235 0.282
NP_441028.1_6 Forward -154 -144 7.94438 0.217
NP_441028.1_6 Forward -205 -195 4.10949 0.278
NP_440115.1_6 Reverse -107 -117 7.05986 0.161
NP_439965.1_7 Forward -265 -246 11.9744 0.294
NP_441106.1_1 Forward -120 -111 18.486 0.0028
NP_441106.1_1 Reverse -109 -118 9.73449 0.0311
NP_442306.1_10 Forward -124 -105 -10.9153 0.111
NP_441286.1_1 Forward -120 -108 6.03717 0.0258
NP_441286.1_1 Reverse -109 -121 4.95553 0.027
NP_440670.1_8 Forward -119 -110 18.3876 0.000699
NP_440670.1_8 Reverse -110 -119 18.3876 0.000699
NP_441647.1_8 Reverse -226 -245 12.3883 0.258
NP_440886.1_7 Forward -120 -110 8.04271 0.0805
NP_440886.1_7 Reverse -109 -119 8.04271 0.0805
NP_442614.1_2 Reverse -198 -212 9.73436 0.242
NP_442072.1_9 Reverse -109 -127 -12.9605 0.095
NP_442401.1_3 Forward -243 -224 15.3391 0.175
NP_440907.2_8 Forward -118 -108 9.91099 0.103
NP_440907.2_8 Reverse -111 -121 9.51767 0.103
NP_441021.1_8 Reverse -105 -123 3.75572 0.226
NP_440841.1_4 Forward -121 -102 0.196116 0.124
NP_441463.1_6 Forward -121 -107 5.64286 0.287
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442615.1_1 Reverse -101 -119 13.5888 0.0113
NP_442615.1_1 Forward -128 -110 -4.40575 0.185
NP_442615.1_1 Forward -366 -348 -5.48739 0.215
NP_441962.1_9 Forward -199 -180 12.6841 0.191
NP_441993.1_1 Forward -255 -236 8.86616 0.136
NP_440114.1_10 Reverse -110 -124 17.5025 0.0104
NP_440114.1_10 Forward -119 -105 14.2576 0.0429
NP_440114.1_10 Reverse -127 -141 9.14437 0.183
NP_442090.1_10 Reverse -192 -205 12.409 0.18
NP_442323.1_7 Reverse -55 -74 0.785326 0.299
NP_440754.1_7 Forward -380 -362 22.9201 0.0134
NP_441510.2_7 Reverse -226 -240 14.5519 0.28
NP_440766.1_4 Forward -123 -109 4.52282 0.126
NP_442743.1_1 Forward -159 -140 17.9932 0.195
NP_442743.1_1 Reverse -344 -363 6.88182 0.268
NP_442743.1_4 Forward -173 -154 -3.93378 0.249
NP_439910.1_2 Forward -127 -110 -4.18939 0.0692
NP_440457.1_1 Reverse -106 -118 9.18376 0.0949
NP_440457.1_1 Forward -123 -111 0.137309 0.25
NP_442940.1_2 Forward -158 -139 -1.18052 0.296
NP_440798.1_6 Forward -118 -105 4.64084 0.144
NP_441801.1_4 Reverse -50 -60 3.12662 0.231
NP_442509.1_5 Reverse -225 -242 15.181 0.199
NP_442509.1_9 Forward -119 -109 17.3841 0.00128
NP_442509.1_9 Reverse -110 -120 8.04271 0.192
NP_441253.1_7 Forward -205 -187 6.60732 0.276
NP_442514.1_6 Reverse -100 -119 6.29264 0.24
NP_440554.1_4 Reverse -111 -121 16.1063 0.0189
NP_440554.1_4 Forward -118 -108 8.82982 0.0646
NP_441885.1_5 Forward -119 -109 11.3864 0.00668
NP_441885.1_5 Reverse -110 -120 11.3864 0.00668
NP_441275.1_6 Forward -256 -243 13.589 0.212
NP_442341.1_7 Reverse -95 -109 1.08123 0.299
NP_442341.1_9 Reverse -108 -122 8.3571 0.171
NP_441173.1_9 Reverse -351 -359 12.1137 0.21
NP_441173.1_9 Forward -153 -145 11.3271 0.226
NP_440409.1_10 Forward -358 -339 11.8975 0.29
NP_443000.1_7 Forward -121 -111 17.4829 0.00719
NP_443000.1_7 Reverse -108 -118 11.6814 0.0344
NP_441842.1_10 Reverse -103 -117 7.66941 0.249
NP_440275.1_3 Reverse -108 -118 16.9913 0.0133
NP_440275.1_3 Forward -121 -111 9.12481 0.055
NP_440091.1_1 Forward -123 -111 8.9871 0.0567
NP_441307.1_3 Reverse -220 -239 14.8474 0.0483
NP_442451.1_2 Forward -127 -108 -10.9153 0.28
NP_440149.1_8 Reverse -110 -129 1.0811 0.129
NP_441875.1_7 Forward -162 -152 15.3197 0.236
NP_441105.1_3 Reverse -99 -118 -4.72043 0.204
NP_440216.1_1 Forward -119 -105 24.9757 0.000528
NP_440216.1_1 Reverse -110 -124 6.09611 0.0162
NP_440172.1_1 Reverse -110 -120 17.5813 0.00421
NP_440172.1_1 Forward -119 -109 16.303 0.00854
NP_442015.1_10 Reverse -106 -119 3.65753 0.178
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_441226.1_7 Reverse -232 -239 5.34865 0.289
NP_441226.1_7 Reverse -226 -233 5.34865 0.289
NP_440198.1_10 Forward -228 -209 8.65258 0.296
NP_440305.1_1 Reverse -254 -268 13.9534 0.233
NP_441111.1_7 Forward -118 -110 18.7023 0.00294
NP_441111.1_7 Reverse -111 -119 18.7023 0.00294
NP_441766.1_2 Forward -119 -110 17.5026 0.00297
NP_441766.1_2 Reverse -110 -119 17.5026 0.00297
NP_441766.1_8 Forward -341 -322 17.7282 0.198
NP_443052.1_9 Reverse -231 -250 0.294447 0.2
NP_443052.1_9 Reverse -45 -64 -2.45882 0.238
NP_441940.1_5 Forward -174 -155 15.9339 0.278
NP_442154.1_1 Forward -243 -225 -7.35568 0.141
NP_442154.1_1 Forward -242 -224 -8.24065 0.158
NP_442154.1_1 Reverse -183 -201 -18.6637 0.284
NP_441430.1_1 Reverse -240 -259 11.6017 0.271
NP_440261.1_5 Forward -118 -105 7.09911 0.0316
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTTTAACGGCTCAATTTGTTCTGGATTGGTTTGATAGGCTTGGCTAAAACTTTGGCTGAGATTATTCAACCATTCCGGTAAACTTTCTACCTGGTCTGTTAGATCAAAGGAGATATGATAGTAGCCCACGTAATGTTCATCTTTGAAGGCATCAGGGGCGGGTTGGGGTTGGGGAATTTGAATTAATTCAATGCGTCCCCCCAGACCAGTCAACCAGCAAGCTAAGGTATAACCAGTGGTGAACCTTTCCCCCACGGTAAAACCCAATAGCTCATAAAAGGCGATCGCCCGATGGATATTAGCAGTACGAATAGAAACATGGTGCATGATGCTTTATGCTGGGGGAGTTAAGGGGAAATTAACTTTTCAGCGGTGCTCAATTTATTACAACCTTACCA

CDS

ATGTCCGAACTGAAAATCCTAATTGTTGACGACGAACCCCACATTGTAATTCTGCTGGAAGAGGTGTTTGAGCTTTTAGAAGAAGATTACGGGGTGGAGTTATTGACCGCCATGGATGGGGAAAAAGCCTTGGCTTTAGCAGTGGAACATCAACCCCAATTGGTTATTTTAGATGTGATGTTGCCCAAGATTAGTGGTTTAGCAGTTTGTCAACGTATTAAAGAAAATCCTGAGCTAGCTAATACCACGGTGATTTTGCTCACGGCCAAGGGCCAACAGTTCGATCGCCAGGCAGGGTTAGCCGCGGGGGCGGATTGCTACGTAACTAAACCCTTTGGCCCCAGGGATTTATTGGCCCAAGCGAAGGGAATTTTGGGTATTGAAGAAGAGGATTAA

Protein

MSELKILIVDDEPHIVILLEEVFELLEEDYGVELLTAMDGEKALALAVEHQPQLVILDVMLPKISGLAVCQRIKENPELANTTVILLTAKGQQFDRQAGLAAGADCYVTKPFGPRDLLAQAKGILGIEEED