Your browser is old and dusty. Try Google Chrome!

Details for slr1035

ORF slr1035
Accession NP_440492.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -308 -294 13.5693 0.168
NP_441061.1_2 Reverse -135 -149 13.0776 0.0424
NP_441061.1_2 Reverse -249 -263 10.521 0.0605
NP_440795.1_7 Forward -256 -249 14.6904 0.0123
NP_440795.1_7 Reverse -249 -256 14.6904 0.0123
NP_441418.1_6 Reverse -248 -267 0.58944 0.00871
NP_441418.1_6 Forward -269 -250 -21.9284 0.163
NP_440897.1_6 Forward -288 -269 2.45694 0.165
NP_441453.1_4 Reverse -248 -256 16.539 0.00633
NP_441453.1_4 Forward -257 -249 16.539 0.00633
NP_441453.1_7 Reverse -319 -326 12.9205 0.23
NP_442151.1_6 Forward -257 -243 6.88276 0.217
NP_441818.1_1 Reverse -249 -260 9.79292 0.232
NP_440226.1_1 Forward -257 -238 8.94757 0.0802
NP_442623.1_3 Reverse -249 -268 -18.1918 0.263
NP_441098.1_6 Forward -285 -266 18.3865 0.0886
NP_443002.1_5 Reverse -135 -153 9.55647 0.286
NP_442173.1_1 Forward -256 -248 15.4574 0.00633
NP_442173.1_1 Reverse -249 -257 15.4574 0.00633
NP_442752.1_4 Forward -257 -250 13.8055 0.0199
NP_442752.1_4 Reverse -248 -255 13.8055 0.0199
NP_443027.1_4 Forward -259 -249 11.0914 0.107
NP_443027.1_4 Reverse -246 -256 7.25653 0.24
NP_441812.1_3 Forward -258 -244 9.2427 0.245
NP_442975.1_10 Reverse -244 -258 18.0918 0.00914
NP_440784.1_7 Forward -256 -249 15.9687 0.0123
NP_440784.1_7 Reverse -249 -256 15.9687 0.0123
NP_440061.1_9 Reverse -246 -260 18.4851 0.00917
NP_441054.1_2 Forward -304 -285 10.6192 0.284
NP_442062.1_8 Reverse -248 -258 17.3846 0.00193
NP_442062.1_8 Forward -257 -247 10.3048 0.0493
NP_442062.1_8 Reverse -134 -144 4.89658 0.193
NP_440761.1_4 Forward -148 -129 -11.7019 0.196
NP_441900.1_2 Forward -119 -101 -5.29143 0.288
NP_441859.1_3 Reverse -247 -266 4.81688 0.213
NP_440304.1_4 Reverse -246 -256 10.8948 0.051
NP_440304.1_4 Forward -145 -135 5.97822 0.185
NP_440304.1_4 Forward -298 -288 1.84832 0.299
NP_440304.1_4 Forward -259 -249 1.84832 0.299
NP_442242.1_4 Forward -256 -249 14.3954 0.0124
NP_442242.1_4 Reverse -249 -256 14.3954 0.0124
NP_440044.1_8 Reverse -249 -268 2.85105 0.143
NP_439918.1_2 Reverse -94 -113 -4.91709 0.291
NP_441210.1_10 Forward -313 -295 17.9154 0.256
NP_442110.1_7 Reverse -248 -262 1.67122 0.222
NP_440273.1_1 Reverse -168 -187 14.1801 0.243
NP_440856.1_4 Forward -264 -245 8.06259 0.06
NP_441083.1_5 Reverse -248 -258 20.3345 0.00053
NP_441083.1_5 Forward -257 -247 11.2881 0.0159
NP_441434.1_6 Forward -323 -313 15.123 0.277
NP_441738.1_2 Forward -255 -248 15.28 0.0102
NP_441738.1_2 Reverse -250 -257 15.28 0.0102
NP_441645.1_1 Forward -391 -372 12.7816 0.172
NP_440209.1_1 Reverse -248 -256 18.1123 0.00295
NP_440209.1_1 Forward -257 -249 18.1123 0.00295
NP_442889.1_8 Reverse -245 -259 8.25877 0.126
NP_440447.1_6 Forward -265 -247 6.60732 0.143
NP_441713.1_1 Forward -263 -244 -16.2252 0.278
NP_440178.1_7 Forward -258 -239 -10.227 0.0742
NP_441716.1_1 Reverse -248 -262 17.2075 0.0287
NP_441327.1_5 Reverse -19 -28 15.0444 0.191
NP_442111.1_4 Reverse -247 -261 11.6026 0.0488
NP_442111.1_4 Forward -258 -244 9.93102 0.0575
NP_442111.1_4 Forward -270 -256 2.16287 0.286
NP_440906.1_5 Forward -256 -249 15.8704 0.0124
NP_440906.1_5 Reverse -249 -256 15.8704 0.0124
NP_440747.1_10 Forward -260 -248 26.5883 0.000317
NP_440747.1_10 Reverse -245 -257 5.44718 0.0137
NP_441486.1_1 Forward -260 -246 -1.96703 0.175
NP_441486.1_1 Reverse -245 -259 -3.04867 0.175
NP_441486.1_1 Reverse -276 -290 -5.70361 0.254
NP_442634.1_4 Forward -259 -245 -1.5737 0.149
NP_442634.1_4 Reverse -246 -260 -1.5737 0.149
NP_442634.1_4 Forward -145 -131 -5.70361 0.271
NP_442848.1_1 Forward -263 -249 -0.983719 0.263
NP_443018.1_3 Forward -256 -249 14.8871 0.0123
NP_443018.1_3 Reverse -249 -256 14.8871 0.0123
NP_443018.1_3 Reverse -135 -142 10.7572 0.0907
NP_443018.1_3 Forward -142 -135 4.56234 0.241
NP_441634.1_8 Reverse -132 -146 0.786239 0.217
NP_441634.1_8 Forward -259 -245 -3.24533 0.295
NP_440376.1_1 Forward -257 -248 19.4693 0.000692
NP_440376.1_1 Reverse -248 -257 19.4693 0.000692
NP_440376.1_1 Reverse -279 -288 4.71961 0.15
NP_441588.1_4 Forward -255 -245 13.943 0.0841
NP_442687.1_7 Reverse -259 -269 11.2881 0.0994
NP_442687.1_7 Reverse -247 -257 9.02648 0.0994
NP_442687.1_7 Forward -258 -248 8.92815 0.0994
NP_440667.1_2 Reverse -372 -391 -4.72043 0.249
NP_440360.1_10 Reverse -289 -303 9.43936 0.227
NP_442658.1_1 Forward -145 -135 16.3025 0.00966
NP_442658.1_1 Reverse -246 -256 13.0576 0.04
NP_442658.1_1 Forward -259 -249 7.94438 0.199
NP_441414.1_9 Forward -257 -238 8.45592 0.0278
NP_442937.1_5 Reverse -243 -262 7.66927 0.244
NP_442937.1_5 Forward -293 -274 7.07928 0.263
NP_442937.1_5 Forward -262 -243 6.09597 0.288
NP_441958.1_5 Reverse -247 -257 21.2195 0.000805
NP_441958.1_5 Forward -258 -248 12.2714 0.00183
NP_441958.1_5 Reverse -259 -269 -2.57657 0.28
NP_441127.1_1 Forward -296 -282 11.701 0.215
NP_440984.1_7 Reverse -243 -257 7.9644 0.16
NP_439990.1_5 Forward -262 -249 13.884 0.0889
NP_442911.1_2 Forward -267 -248 -0.000545616 0.0713
NP_442911.1_2 Reverse -238 -257 -10.817 0.289
NP_442064.1_4 Forward -267 -248 6.78348 0.246
NP_443055.1_6 Forward -296 -278 5.91824 0.172
NP_443055.1_6 Reverse -240 -258 4.63995 0.181
NP_440602.1_8 Reverse -366 -380 11.3077 0.242
NP_442995.1_5 Reverse -243 -262 13.6675 0.183
NP_441099.1_5 Forward -267 -248 16.0274 0.0153
NP_441099.1_5 Reverse -238 -257 -9.73531 0.231
NP_442002.1_9 Forward -297 -290 11.3472 0.185
NP_440475.1_5 Reverse -104 -123 9.3409 0.175
NP_441294.1_7 Reverse -244 -258 9.82656 0.223
NP_441646.1_1 Forward -295 -276 6.68596 0.173
NP_441646.1_1 Forward -264 -245 -1.47551 0.287
NP_442438.1_10 Forward -262 -248 0.88457 0.213
NP_441000.1_5 Reverse -280 -299 8.4551 0.229
NP_440484.1_3 Forward -259 -245 10.6193 0.242
NP_440147.1_4 Reverse -246 -259 20.5705 0.00219
NP_440147.1_4 Forward -259 -246 8.18076 0.0546
NP_441550.1_8 Reverse -246 -256 15.3192 0.0132
NP_441550.1_8 Forward -259 -249 15.1225 0.0132
NP_441916.1_7 Forward -257 -247 18.9579 0.00144
NP_441916.1_7 Reverse -248 -258 10.3048 0.0261
NP_441041.1_4 Forward -257 -238 -0.983855 0.0994
NP_441041.1_4 Reverse -248 -267 -8.65367 0.205
NP_441041.1_4 Forward -269 -250 -10.522 0.233
NP_441041.1_7 Reverse -245 -257 8.2922 0.139
NP_441041.1_7 Forward -260 -248 7.51478 0.162
NP_441041.1_7 Forward -338 -326 5.27969 0.265
NP_441547.1_2 Forward -268 -250 5.82068 0.215
NP_442004.1_6 Forward -338 -324 5.80112 0.181
NP_441725.1_4 Forward -262 -248 13.372 0.0693
NP_441725.1_5 Reverse -135 -145 4.89658 0.115
NP_441725.1_5 Reverse -249 -259 2.04498 0.115
NP_441725.1_5 Forward -256 -246 1.94665 0.115
NP_439966.1_7 Forward -259 -249 15.3192 0.0152
NP_439966.1_7 Reverse -246 -256 6.27276 0.185
NP_442941.1_3 Reverse -249 -259 19.2529 0.00262
NP_442941.1_3 Forward -256 -246 11.0914 0.0116
NP_440289.1_2 Forward -260 -247 -3.71729 0.267
NP_440289.1_2 Reverse -245 -258 -4.89726 0.294
NP_440983.1_5 Forward -399 -380 -7.67036 0.291
NP_440260.1_8 Forward -266 -248 -7.45401 0.295
NP_442281.1_1 Forward -262 -248 17.2068 0.00633
NP_442281.1_1 Forward -148 -134 10.1271 0.0622
NP_442281.1_1 Reverse -243 -257 9.93039 0.0648
NP_440177.1_5 Forward -108 -89 11.7992 0.269
NP_440177.1_9 Reverse -240 -259 15.0441 0.197
NP_442256.1_2 Forward -259 -241 -0.177514 0.139
NP_442256.1_2 Reverse -246 -264 -9.51896 0.274
NP_442012.1_1 Forward -263 -244 0.982764 0.226
NP_442012.1_1 Reverse -319 -338 -0.39387 0.259
NP_440498.1_1 Reverse -239 -257 4.54237 0.121
NP_440498.1_1 Reverse -125 -143 -1.06249 0.222
NP_440375.1_8 Forward -256 -237 7.17762 0.166
NP_442068.1_1 Reverse -31 -50 1.57275 0.298
NP_442068.1_4 Reverse -135 -154 12.0933 0.143
NP_441644.1_6 Forward -257 -247 19.0557 0.000803
NP_441644.1_6 Reverse -248 -258 17.3841 0.00127
NP_441644.1_6 Forward -143 -133 5.58445 0.184
NP_441644.1_6 Forward -77 -67 4.69947 0.228
NP_442215.1_2 Reverse -246 -262 -1.90808 0.189
NP_442215.1_2 Forward -290 -274 -2.5964 0.201
NP_442215.1_2 Forward -152 -136 -5.54633 0.251
NP_442247.1_8 Forward -259 -245 8.35772 0.273
NP_440253.1_2 Reverse -248 -266 15.1621 0.0171
NP_440253.1_2 Reverse -365 -383 -0.0791831 0.201
NP_440253.1_2 Forward -257 -239 -2.53746 0.268
NP_440253.1_2 Forward -152 -134 -2.93078 0.28
NP_440929.1_8 Forward -257 -248 19.2726 0.000701
NP_440929.1_8 Reverse -248 -257 19.2726 0.000701
NP_440469.1_3 Reverse -240 -259 16.3224 0.251
NP_442933.1_10 Forward -257 -248 17.601 0.00325
NP_442933.1_10 Reverse -248 -257 17.601 0.00325
NP_441751.2_8 Reverse -249 -263 6.58777 0.0348
NP_441751.2_8 Reverse -135 -149 -6.58858 0.273
NP_439922.1_2 Forward -168 -149 22.1239 0.0264
NP_442554.1_8 Forward -256 -246 16.4013 0.0065
NP_442554.1_8 Reverse -249 -259 16.2046 0.0065
NP_442554.1_8 Reverse -135 -145 5.68323 0.141
NP_442554.1_8 Forward -142 -132 3.42162 0.226
NP_442554.1_9 Reverse -266 -285 12.9785 0.279
NP_441762.1_7 Forward -258 -246 0.333971 0.0747
NP_441762.1_7 Forward -153 -141 -6.2542 0.284
NP_441762.1_7 Reverse -247 -259 -6.64753 0.284
NP_442142.1_4 Forward -260 -247 14.08 0.0317
NP_442142.1_4 Forward -285 -272 2.96866 0.269
NP_442142.1_4 Reverse -245 -258 2.37867 0.294
NP_442142.1_9 Forward -150 -131 1.96607 0.282
NP_442292.1_1 Reverse -249 -258 18.486 0.00229
NP_442292.1_1 Forward -256 -247 17.5026 0.00435
NP_442476.1_5 Forward -206 -187 10.7175 0.294
NP_442999.1_3 Reverse -6 -20 19.337 0.151
NP_443009.1_5 Forward -258 -247 14.5128 0.02
NP_443009.1_5 Reverse -247 -258 10.1862 0.0792
NP_443009.1_5 Forward -336 -325 6.05637 0.177
NP_443009.1_5 Reverse -133 -144 3.8931 0.274
NP_441715.1_4 Reverse -249 -259 17.3846 0.0106
NP_441715.1_4 Forward -256 -246 7.35486 0.108
NP_441198.1_8 Reverse -246 -256 12.783 0.116
NP_440464.1_8 Reverse -295 -308 18.5049 0.253
NP_441468.1_1 Forward -256 -249 15.8704 0.0124
NP_441468.1_1 Reverse -249 -256 15.8704 0.0124
NP_441468.1_1 Forward -142 -135 4.07068 0.263
NP_441020.2_6 Reverse -246 -263 9.47861 0.17
NP_441015.1_10 Reverse -249 -268 -1.57384 0.174
NP_441015.1_10 Forward -155 -136 -6.1954 0.243
NP_441673.1_1 Forward -257 -248 20.8459 0.000698
NP_441673.1_1 Reverse -248 -257 20.8459 0.000698
NP_441731.1_3 Forward -265 -246 -6.09707 0.29
NP_441826.1_2 Forward -263 -249 3.93283 0.105
NP_441330.1_1 Reverse -243 -262 -13.5702 0.195
NP_442811.1_2 Forward -310 -291 1.47442 0.252
NP_442490.1_9 Reverse -248 -267 10.7175 0.0955
NP_442868.1_6 Forward -259 -249 19.2529 0.00563
NP_442868.1_6 Reverse -246 -256 0.963343 0.205
NP_442719.1_2 Reverse -279 -297 0.706727 0.162
NP_441056.1_1 Reverse -248 -267 0.786102 0.153
NP_441612.1_2 Forward -288 -278 8.83972 0.21
NP_441612.1_2 Reverse -248 -258 8.54929 0.21
NP_442227.1_2 Reverse -190 -209 0.294447 0.252
NP_442361.1_3 Forward -263 -250 8.18076 0.285
NP_442427.1_3 Forward -77 -59 10.8356 0.118
NP_442427.1_8 Reverse -239 -258 13.9625 0.134
NP_442427.1_8 Reverse -349 -368 4.916 0.288
NP_442808.1_1 Reverse -247 -257 8.73102 0.0481
NP_442808.1_1 Forward -258 -248 8.63269 0.0481
NP_440145.1_3 Reverse -238 -257 9.73422 0.0433
NP_442542.1_9 Forward -150 -136 6.0955 0.252
NP_442050.1_5 Forward -259 -249 14.3359 0.0206
NP_442050.1_5 Reverse -246 -256 9.22267 0.193
NP_440038.1_4 Reverse -292 -311 14.0608 0.176
NP_440558.1_2 Forward -266 -247 -4.6221 0.247
NP_441878.1_6 Reverse -247 -257 10.5014 0.0176
NP_441878.1_6 Forward -258 -248 10.4031 0.0176
NP_441878.1_6 Reverse -278 -288 -7.39479 0.222
NP_441878.1_6 Forward -144 -134 -7.49312 0.231
NP_441036.1_8 Reverse -247 -257 15.713 0.00724
NP_441036.1_8 Forward -258 -248 8.33817 0.174
NP_441557.1_5 Forward -257 -248 19.9609 0.000699
NP_441557.1_5 Reverse -248 -257 19.9609 0.000699
NP_441445.1_1 Reverse -270 -289 -0.4922 0.294
NP_441590.1_4 Forward -286 -267 12.29 0.246
NP_442183.1_1 Forward -257 -243 10.226 0.0869
NP_442183.1_1 Reverse -248 -262 7.47274 0.141
NP_441655.1_10 Forward -300 -282 3.65739 0.273
NP_442170.1_5 Forward -257 -238 -0.000545616 0.228
NP_442347.1_2 Reverse -249 -258 12.4878 0.056
NP_442347.1_2 Forward -256 -247 3.34298 0.284
NP_442645.1_2 Reverse -240 -259 -21.7317 0.29
NP_442645.1_2 Forward -265 -246 -22.715 0.293
NP_441037.1_4 Reverse -246 -256 15.0168 0.028
NP_442317.1_6 Forward -262 -243 2.55606 0.275
NP_441633.1_3 Forward -259 -246 3.36254 0.0699
NP_441633.1_3 Reverse -246 -259 -5.97891 0.236
NP_440136.1_2 Forward -256 -249 15.9687 0.0123
NP_440136.1_2 Reverse -249 -256 15.9687 0.0123
NP_442998.1_5 Reverse -284 -294 11.8781 0.176
NP_442998.1_5 Reverse -20 -30 10.5014 0.212
NP_442998.1_10 Forward -255 -248 15.5754 0.0102
NP_442998.1_10 Reverse -250 -257 15.5754 0.0102
NP_440899.1_3 Reverse -329 -348 13.7658 0.256
NP_440299.1_1 Forward -261 -248 20.2748 0.00128
NP_440299.1_1 Reverse -244 -257 3.95196 0.224
NP_441799.1_1 Reverse -244 -258 14.7486 0.0222
NP_441799.1_1 Forward -261 -247 7.57046 0.138
NP_441007.1_5 Reverse -249 -268 11.1109 0.214
NP_441007.1_10 Forward -148 -135 1.9859 0.202
NP_441007.1_10 Reverse -243 -256 0.805932 0.216
NP_441007.1_10 Forward -262 -249 -0.964025 0.296
NP_442334.1_2 Forward -153 -136 3.48043 0.2
NP_441435.1_3 Forward -111 -92 13.6675 0.222
NP_440256.1_1 Forward -260 -241 5.60432 0.035
NP_440256.1_1 Reverse -245 -264 -2.75381 0.122
NP_440256.1_1 Reverse -257 -276 -7.08038 0.228
NP_441559.1_8 Forward -262 -248 3.04785 0.143
NP_441559.1_8 Reverse -341 -355 -7.76856 0.299
NP_440915.1_6 Forward -261 -247 19.6658 0.00738
NP_442785.1_7 Reverse -246 -260 8.35772 0.298
NP_442452.1_3 Reverse -249 -268 1.96607 0.282
NP_441464.1_8 Forward -257 -243 3.8345 0.287
NP_441464.1_10 Forward -307 -293 10.816 0.238
NP_440695.1_5 Reverse -248 -267 4.916 0.186
NP_440695.1_5 Forward -269 -250 4.32602 0.203
NP_442993.1_1 Forward -143 -127 -10.7579 0.226
NP_440677.1_1 Forward -266 -247 7.57094 0.234
NP_440677.1_6 Forward -266 -247 9.83255 0.27
NP_442386.1_9 Forward -258 -249 13.8639 0.0289
NP_442386.1_9 Forward -144 -135 9.93072 0.144
NP_442386.1_9 Reverse -247 -256 6.39082 0.219
NP_441340.1_5 Forward -256 -249 15.6737 0.0124
NP_441340.1_5 Reverse -249 -256 15.6737 0.0124
NP_441340.1_5 Reverse -135 -142 3.97235 0.274
NP_441340.1_9 Reverse -19 -29 8.15881 0.256
NP_442484.1_2 Forward -268 -249 5.89931 0.159
NP_440211.1_4 Reverse -323 -333 14.4347 0.286
NP_440586.1_8 Forward -256 -249 13.2151 0.026
NP_440586.1_8 Reverse -249 -256 13.2151 0.026
NP_440586.1_8 Forward -287 -280 5.64364 0.297
NP_442251.1_6 Forward -256 -249 15.2804 0.0124
NP_442251.1_6 Reverse -249 -256 15.2804 0.0124
NP_442251.1_8 Forward -330 -316 19.9608 0.151
NP_440192.1_4 Reverse -324 -343 8.62144 0.292
NP_441262.1_3 Reverse -248 -255 14.7888 0.0223
NP_441262.1_3 Forward -257 -250 14.7888 0.0223
NP_443051.1_1 Reverse -247 -256 19.5676 0.00335
NP_443051.1_1 Forward -258 -249 10.4228 0.00754
NP_439984.1_10 Forward -114 -100 14.6503 0.162
NP_440439.1_1 Forward -260 -247 8.86907 0.0488
NP_440372.1_2 Forward -256 -249 16.3621 0.0124
NP_440372.1_2 Reverse -249 -256 16.3621 0.0124
NP_442722.1_3 Reverse -292 -311 10.2259 0.215
NP_439977.1_5 Reverse -108 -127 4.81767 0.15
NP_442384.1_10 Reverse -248 -261 20.8655 0.00194
NP_442384.1_10 Forward -257 -244 6.80412 0.0939
NP_442384.1_10 Forward -269 -256 1.29759 0.263
NP_442384.1_10 Forward -288 -275 0.707601 0.282
NP_442790.1_4 Forward -152 -133 -5.99873 0.144
NP_442790.1_4 Forward -266 -247 -8.85033 0.176
NP_442458.1_3 Reverse -73 -92 18.3873 0.0876
NP_442262.1_10 Forward -256 -249 14.1988 0.0123
NP_442262.1_10 Reverse -249 -256 14.1988 0.0123
NP_442262.1_10 Reverse -135 -142 9.87221 0.164
NP_441689.1_5 Reverse -246 -256 8.3377 0.132
NP_441689.1_5 Forward -259 -249 5.78111 0.197
NP_440344.1_10 Forward -264 -247 -8.71262 0.132
NP_440344.1_10 Reverse -241 -258 -9.20427 0.141
NP_440282.1_10 Reverse -124 -143 -3.54046 0.24
NP_440531.1_6 Reverse -271 -290 2.65439 0.152
NP_442910.1_1 Forward -264 -245 0.0977854 0.172
NP_441335.1_8 Forward -299 -280 11.6025 0.204
NP_440562.1_3 Reverse -249 -266 3.77542 0.216
NP_441965.1_10 Reverse -245 -261 4.77842 0.231
NP_441640.1_8 Reverse -249 -268 1.86774 0.168
NP_440297.1_9 Forward -142 -132 0.766681 0.282
NP_440297.1_9 Reverse -249 -259 -0.118297 0.282
NP_440297.1_9 Forward -256 -246 -0.216628 0.282
NP_439926.1_3 Forward -113 -94 11.0125 0.294
NP_442078.1_9 Forward -288 -271 11.8386 0.264
NP_440999.1_9 Forward -261 -247 7.57108 0.0846
NP_440999.1_9 Forward -147 -133 -2.95034 0.281
NP_440888.1_2 Reverse -248 -262 15.1419 0.0122
NP_440888.1_2 Forward -257 -243 6.19383 0.243
NP_440792.1_5 Forward -256 -237 12.5858 0.159
NP_440600.1_4 Forward -265 -247 -2.0458 0.183
NP_440600.1_4 Reverse -240 -258 -5.58572 0.28
NP_442948.1_2 Reverse -247 -266 12.4875 0.121
NP_442277.1_4 Forward -266 -247 7.86512 0.138
NP_440575.1_8 Forward -273 -254 0.786102 0.185
NP_442077.1_8 Forward -40 -21 10.0284 0.26
NP_441543.1_2 Reverse -249 -258 16.9127 0.00359
NP_441543.1_2 Forward -256 -247 15.9293 0.00518
NP_441543.1_2 Reverse -135 -144 6.5879 0.143
NP_442845.1_2 Reverse -242 -256 9.2427 0.178
NP_441319.1_8 Forward -263 -245 4.54237 0.296
NP_441469.1_8 Forward -144 -135 12.3894 0.111
NP_441469.1_8 Reverse -247 -256 6.5879 0.227
NP_441469.1_8 Forward -258 -249 6.48957 0.227
NP_443064.1_6 Reverse -248 -258 12.5669 0.0796
NP_443064.1_6 Forward -257 -247 10.8217 0.13
NP_442578.1_7 Forward -256 -249 14.5921 0.026
NP_442578.1_7 Reverse -249 -256 14.5921 0.026
NP_441462.1_2 Forward -257 -247 20.2362 0.000805
NP_441462.1_2 Reverse -248 -258 11.5831 0.00406
NP_443062.1_1 Forward -257 -239 17.3216 0.0254
NP_443062.1_1 Reverse -248 -266 5.23067 0.235
NP_441601.1_2 Reverse -135 -154 -0.983855 0.231
NP_442204.1_1 Forward -261 -250 11.5634 0.0565
NP_442204.1_1 Reverse -256 -267 -0.236322 0.289
NP_442204.1_5 Forward -153 -134 8.35759 0.119
NP_440255.1_8 Forward -295 -276 18.6974 0.194
NP_440516.1_8 Forward -257 -248 16.9127 0.00442
NP_440516.1_8 Reverse -248 -257 16.9127 0.00442
NP_442428.1_5 Forward -256 -249 15.8704 0.0124
NP_442428.1_5 Reverse -249 -256 15.8704 0.0124
NP_442428.1_5 Forward -142 -135 4.46401 0.267
NP_442120.1_10 Forward -143 -124 -6.98204 0.217
NP_441867.1_2 Forward -305 -286 -13.9635 0.277
NP_440673.1_3 Forward -255 -248 12.4288 0.0426
NP_440673.1_3 Reverse -250 -257 12.4288 0.0426
NP_440673.1_3 Reverse -136 -143 8.98723 0.203
NP_440865.1_9 Reverse -242 -261 -7.37537 0.244
NP_441052.1_1 Forward -350 -331 19.2715 0.091
NP_441052.1_2 Reverse -248 -258 19.9412 0.00106
NP_441052.1_2 Forward -257 -247 10.4031 0.0285
NP_441052.1_2 Reverse -279 -289 4.99491 0.135
NP_441052.1_2 Forward -288 -278 4.40493 0.159
NP_441052.1_2 Reverse -143 -153 2.53664 0.201
NP_442219.1_9 Reverse -249 -258 17.7976 0.00718
NP_442219.1_9 Forward -256 -247 8.25953 0.0681
NP_442219.1_9 Reverse -280 -289 1.86802 0.295
NP_440436.1_4 Reverse -249 -258 17.2072 0.00233
NP_440436.1_4 Reverse -135 -144 11.9957 0.0435
NP_440436.1_4 Forward -256 -247 9.24241 0.0871
NP_441884.1_9 Reverse -245 -264 -23.7966 0.284
NP_442086.1_3 Forward -256 -237 7.66927 0.258
NP_440314.1_9 Forward -256 -237 7.86593 0.0427
NP_440648.1_1 Forward -257 -238 6.19431 0.21
NP_441719.1_4 Forward -256 -249 16.3621 0.0124
NP_441719.1_4 Reverse -249 -256 16.3621 0.0124
NP_441004.1_1 Reverse -267 -286 -14.9469 0.271
NP_441004.1_1 Reverse -94 -113 -18.2901 0.299
NP_441004.1_4 Forward -146 -136 7.74818 0.289
NP_441004.1_5 Forward -156 -142 14.4542 0.22
NP_442813.1_4 Reverse -309 -328 -0.4922 0.229
NP_442813.1_4 Forward -168 -149 -4.81876 0.299
NP_442366.1_3 Forward -369 -351 -0.177514 0.186
NP_442366.1_3 Reverse -247 -265 -2.83245 0.234
NP_442366.1_3 Reverse -133 -151 -5.68405 0.292
NP_442366.1_5 Reverse -245 -255 15.4175 0.0374
NP_440129.1_10 Forward -264 -250 14.7492 0.0534
NP_441115.1_4 Reverse -247 -265 8.57317 0.244
NP_442206.1_10 Reverse -248 -263 13.4512 0.0799
NP_440328.1_4 Forward -263 -244 3.6377 0.174
NP_443054.1_2 Reverse -132 -146 2.35953 0.245
NP_443054.1_2 Forward -259 -245 -0.492064 0.295
NP_441851.1_10 Forward -258 -248 15.8113 0.00552
NP_441851.1_10 Reverse -247 -257 8.53483 0.114
NP_441851.1_10 Reverse -324 -334 7.35486 0.142
NP_441851.1_10 Forward -144 -134 4.60159 0.259
NP_441542.1_4 Forward -300 -286 11.7993 0.239
NP_441542.1_4 Reverse -281 -295 5.1128 0.264
NP_442856.1_6 Forward -140 -122 15.2596 0.199
NP_442515.1_1 Forward -258 -244 5.30946 0.107
NP_442515.1_1 Forward -289 -275 -1.18038 0.248
NP_441396.1_5 Forward -304 -295 8.25953 0.224
NP_440593.1_3 Forward -268 -249 -4.91709 0.254
NP_440165.1_5 Reverse -247 -266 11.7008 0.0454
NP_442689.1_8 Forward -28 -11 -1.0428 0.206
NP_441349.1_10 Forward -267 -248 -5.50708 0.204
NP_441349.1_10 Reverse -238 -257 -9.44032 0.292
NP_440432.1_9 Forward -256 -241 14.0412 0.0164
NP_440474.1_8 Forward -142 -128 13.4703 0.0696
NP_440474.1_8 Forward -256 -242 3.93223 0.296
NP_441124.1_5 Reverse -309 -319 13.1036 0.215
NP_440431.1_3 Reverse -247 -266 -4.32711 0.178
NP_442450.1_5 Reverse -246 -256 7.64985 0.13
NP_440588.1_2 Forward -266 -247 -3.83545 0.197
NP_442243.1_1 Forward -263 -245 -2.83317 0.297
NP_441570.1_1 Reverse -248 -266 -9.71562 0.146
NP_441570.1_1 Forward -257 -239 -16.3038 0.242
NP_441570.1_1 Reverse -260 -278 -17.7788 0.291
NP_441078.1_4 Forward -257 -248 19.6659 0.0007
NP_441078.1_4 Reverse -248 -257 19.6659 0.0007
NP_441078.1_4 Forward -143 -134 -1.57357 0.266
NP_441078.1_4 Reverse -279 -288 -1.96689 0.282
NP_442729.1_5 Reverse -253 -263 8.04317 0.251
NP_441528.1_5 Reverse -291 -305 17.8952 0.184
NP_442443.1_1 Reverse -92 -111 5.50599 0.157
NP_442443.1_1 Reverse -280 -299 -2.0655 0.249
NP_440526.1_3 Reverse -249 -260 8.02298 0.126
NP_440526.1_3 Reverse -135 -146 1.92649 0.267
NP_441432.1_8 Reverse -247 -256 16.8143 0.00595
NP_441432.1_8 Forward -258 -249 16.8143 0.00595
NP_441432.1_8 Forward -144 -135 6.48957 0.114
NP_442320.1_8 Reverse -242 -256 5.30946 0.0394
NP_442320.1_8 Forward -263 -249 -4.62196 0.177
NP_442344.1_7 Forward -256 -237 -5.60541 0.168
NP_441732.1_2 Reverse -244 -260 -7.0213 0.0614
NP_441732.1_2 Forward -261 -245 -16.0677 0.164
NP_441732.1_2 Reverse -137 -153 -16.7561 0.195
NP_441030.1_4 Reverse -5 -24 4.43995 0.293
NP_440760.1_1 Forward -257 -238 -9.73531 0.084
NP_443011.1_4 Reverse -269 -288 21.3373 0.0256
NP_440281.1_1 Reverse -376 -395 13.8621 0.214
NP_440713.1_4 Forward -267 -248 1.96607 0.273
NP_442489.1_7 Forward -257 -248 20.1576 0.000695
NP_442489.1_7 Reverse -248 -257 20.1576 0.000695
NP_442489.1_7 Reverse -279 -288 -1.47524 0.203
NP_442489.1_7 Forward -143 -134 -1.57357 0.213
NP_442489.1_7 Reverse -134 -143 -2.06522 0.288
NP_441830.1_2 Forward -353 -334 1.67108 0.224
NP_440386.1_3 Forward -365 -346 5.40766 0.112
NP_442079.1_7 Reverse -249 -268 4.42435 0.192
NP_440559.1_1 Reverse -249 -258 17.4043 0.00658
NP_440559.1_1 Forward -256 -247 8.65285 0.0586
NP_441659.2_8 Forward -257 -247 20.9245 0.000805
NP_441659.2_8 Reverse -248 -258 18.1713 0.00133
NP_442913.1_10 Reverse -239 -258 1.37609 0.143
NP_439956.1_7 Reverse -362 -381 0.786102 0.296
NP_442008.1_2 Reverse -245 -264 14.9458 0.0806
NP_440708.1_6 Forward -267 -248 -5.80207 0.234
NP_442346.1_5 Forward -258 -248 16.6963 0.00248
NP_442346.1_5 Reverse -247 -257 16.303 0.00248
NP_442346.1_5 Forward -144 -134 4.20827 0.296
NP_442346.1_10 Reverse -324 -343 -3.63879 0.294
NP_440545.1_3 Reverse -244 -261 4.26707 0.073
NP_440486.1_6 Reverse -247 -266 10.9142 0.216
NP_441653.1_2 Forward -268 -249 5.94546 0.235
NP_442311.1_5 Reverse -282 -301 0.58944 0.274
NP_440847.1_3 Forward -381 -367 10.6187 0.287
NP_442603.1_7 Reverse -248 -262 16.5185 0.0304
NP_441585.1_5 Forward -40 -21 4.71854 0.227
NP_441888.1_7 Forward -262 -248 13.2743 0.0743
NP_441833.1_4 Forward -256 -249 15.9687 0.0124
NP_441833.1_4 Reverse -249 -256 15.9687 0.0124
NP_442162.1_9 Forward -256 -249 16.2637 0.0124
NP_442162.1_9 Reverse -249 -256 16.2637 0.0124
NP_442796.1_2 Forward -106 -87 14.7847 0.24
NP_442199.1_5 Forward -265 -246 0.58944 0.172
NP_442140.1_3 Reverse -249 -259 10.3048 0.0902
NP_442140.1_3 Forward -256 -246 6.66654 0.159
NP_442140.1_3 Reverse -135 -145 4.50326 0.243
NP_440875.1_9 Reverse -250 -260 8.37203 0.233
NP_441813.1_5 Forward -259 -249 18.1713 0.00743
NP_441813.1_5 Reverse -246 -256 8.63316 0.0367
NP_441813.1_7 Forward -288 -274 9.93039 0.235
NP_440590.1_4 Reverse -249 -262 5.72248 0.0585
NP_440567.1_1 Forward -256 -242 5.1128 0.107
NP_440567.1_1 Reverse -249 -263 5.01447 0.108
NP_442497.1_10 Forward -256 -247 17.601 0.00813
NP_442497.1_10 Reverse -249 -258 10.4228 0.0087
NP_440821.1_4 Forward -259 -249 9.41981 0.0286
NP_440821.1_4 Reverse -246 -256 2.24165 0.131
NP_440821.1_4 Forward -145 -135 -0.708283 0.287
NP_441239.1_9 Reverse -246 -258 11.1504 0.0648
NP_441239.1_9 Forward -145 -133 9.57708 0.102
NP_441239.1_9 Reverse -132 -144 6.23383 0.197
NP_441239.1_9 Forward -259 -247 5.25052 0.223
NP_441727.1_3 Reverse -241 -260 4.03102 0.275
NP_441892.1_1 Forward -347 -330 -5.46769 0.281
NP_442216.1_4 Forward -333 -325 8.37716 0.255
NP_442216.1_4 Forward -353 -345 8.1805 0.255
NP_442138.1_10 Reverse -248 -267 -1.37718 0.175
NP_440546.1_4 Forward -257 -247 13.5365 0.0459
NP_440546.1_4 Reverse -248 -258 10.046 0.109
NP_441509.1_1 Reverse -312 -331 7.57094 0.245
NP_440462.1_6 Reverse -246 -256 10.5014 0.0396
NP_440462.1_6 Forward -259 -249 9.61647 0.0429
NP_440868.1_4 Forward -261 -249 8.00379 0.0602
NP_440868.1_4 Reverse -244 -256 5.84051 0.0879
NP_442479.1_9 Reverse -276 -295 -13.7669 0.29
NP_442402.1_10 Forward -332 -322 10.5993 0.287
NP_440036.1_2 Reverse -378 -397 13.0775 0.269
NP_441084.1_6 Reverse -132 -146 9.24716 0.29
NP_442039.1_4 Forward -256 -249 15.1821 0.0124
NP_442039.1_4 Reverse -249 -256 15.1821 0.0124
NP_442039.1_7 Reverse -320 -330 11.3864 0.257
NP_441811.1_8 Forward -341 -327 7.37441 0.25
NP_441926.1_3 Forward -257 -241 6.45005 0.17
NP_441926.1_3 Forward -143 -127 4.0901 0.201
NP_442837.1_3 Forward -256 -249 15.7721 0.0124
NP_442837.1_3 Reverse -249 -256 15.7721 0.0124
NP_442053.1_1 Forward -257 -248 18.3876 0.0007
NP_442053.1_1 Reverse -248 -257 18.3876 0.0007
NP_440505.1_3 Forward -259 -249 18.3679 0.00213
NP_440505.1_3 Reverse -33 -43 11.3864 0.0778
NP_440505.1_3 Reverse -246 -256 8.04317 0.147
NP_441102.1_1 Reverse -249 -268 5.211 0.256
NP_441252.1_6 Forward -299 -292 11.9372 0.25
NP_442532.1_7 Forward -257 -243 2.06454 0.254
NP_440914.1_1 Reverse -248 -258 17.5935 0.000537
NP_440914.1_1 Forward -257 -247 16.3248 0.00196
NP_440914.1_1 Forward -143 -133 10.9573 0.116
NP_441011.1_8 Forward -256 -247 16.6177 0.00602
NP_441011.1_8 Reverse -249 -258 8.25953 0.144
NP_442101.1_10 Reverse -240 -259 -1.18052 0.101
NP_442533.1_6 Forward -257 -248 17.2076 0.00137
NP_442533.1_6 Reverse -248 -257 17.2076 0.00137
NP_442533.1_6 Forward -288 -279 5.70292 0.132
NP_443016.1_1 Reverse -242 -261 -8.45701 0.298
NP_441482.1_7 Forward -263 -249 6.88276 0.0257
NP_441482.1_7 Reverse -242 -256 -5.01529 0.168
NP_441482.1_7 Reverse -254 -268 -9.83351 0.209
NP_439944.1_9 Reverse -249 -259 10.5014 0.0887
NP_439944.1_9 Forward -256 -246 9.12481 0.1
NP_441028.1_6 Forward -114 -104 5.38779 0.255
NP_440116.1_5 Forward -260 -243 5.84037 0.174
NP_440116.1_8 Reverse -249 -268 5.01433 0.0669
NP_440115.1_6 Forward -260 -250 16.008 0.0325
NP_440007.1_9 Forward -261 -247 8.84938 0.171
NP_440007.1_9 Reverse -256 -270 1.57289 0.285
NP_441972.1_5 Forward -268 -249 -5.01543 0.213
NP_441106.1_1 Reverse -247 -256 18.486 0.0028
NP_441106.1_1 Forward -258 -249 9.63616 0.0311
NP_441106.1_1 Forward -144 -135 5.3096 0.162
NP_441286.1_1 Forward -258 -246 5.93884 0.0258
NP_441286.1_1 Reverse -247 -259 3.48056 0.0467
NP_440670.1_8 Forward -257 -248 18.3876 0.000699
NP_440670.1_8 Reverse -248 -257 18.3876 0.000699
NP_440886.1_7 Reverse -247 -257 8.04271 0.0805
NP_440886.1_7 Forward -258 -248 7.94438 0.0805
NP_440886.1_7 Reverse -142 -152 4.89613 0.213
NP_440828.1_4 Reverse -133 -152 -7.86776 0.294
NP_442614.1_2 Forward -288 -274 9.04604 0.242
NP_442213.1_5 Reverse -268 -287 -1.96717 0.293
NP_441753.1_10 Reverse -239 -258 2.75272 0.227
NP_440907.2_8 Forward -256 -246 15.9091 0.0161
NP_440907.2_8 Reverse -144 -154 8.73102 0.117
NP_441021.1_1 Reverse -249 -268 1.67108 0.0837
NP_441021.1_1 Reverse -135 -154 -12.3902 0.286
NP_441463.1_3 Forward -267 -248 0.294447 0.132
NP_441463.1_3 Reverse -238 -257 -0.295539 0.132
NP_441463.1_3 Reverse -124 -143 -3.83545 0.188
NP_441626.1_2 Forward -256 -249 15.7721 0.0124
NP_441626.1_2 Reverse -249 -256 15.7721 0.0124
NP_442365.1_5 Reverse -135 -154 9.63589 0.203
NP_442365.1_7 Forward -261 -242 -0.688862 0.183
NP_442238.1_1 Forward -149 -130 9.3409 0.122
NP_442794.1_1 Forward -261 -249 20.0002 0.00523
NP_442615.1_1 Forward -266 -248 0.0191479 0.109
NP_440387.1_1 Forward -257 -241 8.61333 0.0282
NP_440387.1_1 Reverse -248 -264 5.6634 0.0311
NP_440387.1_1 Forward -143 -127 -3.67804 0.164
NP_441431.1_2 Forward -260 -246 10.8154 0.153
NP_441836.1_2 Reverse -242 -261 -3.04881 0.233
NP_441193.1_1 Reverse -109 -128 8.55343 0.292
NP_440634.1_6 Forward -289 -275 15.8309 0.24
NP_441993.1_1 Reverse -242 -261 4.28566 0.222
NP_442352.1_1 Forward -149 -136 13.8059 0.285
NP_440467.1_3 Forward -268 -249 10.7679 0.296
NP_440114.1_10 Forward -257 -243 14.7492 0.0346
NP_440114.1_10 Forward -143 -129 10.226 0.151
NP_440492.1_2 Forward -370 -351 18.1907 0.0665
NP_440492.1_5 Forward -37 -18 18.7807 0.256
NP_440492.1_7 Forward -297 -281 19.4297 0.295
NP_440287.1_6 Reverse -132 -151 5.99764 0.171
NP_440766.1_2 Forward -329 -313 16.7741 0.22
NP_439910.1_2 Reverse -240 -257 -22.0856 0.207
NP_439911.1_6 Reverse -109 -128 7.47261 0.189
NP_440457.1_1 Forward -261 -249 7.61046 0.101
NP_440457.1_1 Reverse -256 -268 1.21895 0.244
NP_442940.1_2 Forward -294 -275 5.60432 0.233
NP_440798.1_6 Forward -256 -243 2.67422 0.166
NP_441801.1_4 Reverse -118 -128 12.1731 0.231
NP_440473.1_9 Forward -154 -135 11.1109 0.0406
NP_442509.1_9 Reverse -248 -258 8.14104 0.192
NP_442509.1_9 Forward -257 -247 8.04271 0.192
NP_442509.1_9 Forward -335 -325 6.66608 0.259
NP_442514.1_5 Forward -265 -246 0.490334 0.178
NP_440554.1_4 Reverse -249 -259 8.92815 0.0646
NP_440554.1_4 Forward -256 -246 8.82982 0.0646
NP_442862.1_3 Reverse -268 -285 12.5269 0.181
NP_442862.1_3 Forward -29 -12 5.25038 0.279
NP_441885.1_5 Reverse -248 -258 20.9245 0.000538
NP_441885.1_5 Forward -257 -247 11.3864 0.00668
NP_441885.1_5 Forward -150 -140 -1.78992 0.284
NP_440478.1_10 Reverse -246 -260 8.06273 0.257
NP_442341.1_7 Forward -400 -386 5.1128 0.167
NP_442341.1_7 Forward -289 -275 3.34284 0.227
NP_442341.1_7 Forward -153 -139 1.96621 0.274
NP_442341.1_7 Reverse -140 -154 1.08123 0.299
NP_442341.1_9 Reverse -246 -260 11.5037 0.125
NP_441173.1_9 Forward -330 -322 11.3271 0.226
NP_441173.1_9 Forward -395 -387 9.75379 0.284
NP_443000.1_7 Forward -259 -249 19.9412 0.00223
NP_443000.1_7 Reverse -246 -256 10.6981 0.0345
NP_443000.1_7 Reverse -277 -287 1.94665 0.226
NP_440275.1_3 Forward -259 -249 15.123 0.0182
NP_440275.1_3 Reverse -246 -256 9.02648 0.0563
NP_441389.1_5 Forward -138 -119 9.83255 0.286
NP_439962.1_4 Forward -113 -94 -6.1954 0.281
NP_440149.1_8 Reverse -248 -267 -5.50708 0.228
NP_441105.1_3 Forward -268 -249 0.786102 0.12
NP_440216.1_1 Forward -257 -243 5.1128 0.0222
NP_440216.1_1 Reverse -248 -262 -0.590395 0.0284
NP_440216.1_9 Forward -325 -316 14.0611 0.184
NP_440216.1_9 Forward -391 -382 6.39124 0.289
NP_440216.1_9 Reverse -17 -26 5.89959 0.289
NP_440172.1_1 Forward -257 -247 17.5813 0.00421
NP_440172.1_1 Reverse -248 -258 15.0247 0.00945
NP_440172.1_1 Forward -143 -133 4.99491 0.157
NP_442015.1_10 Forward -261 -248 21.1604 0.00329
NP_441226.1_7 Forward -256 -249 14.4934 0.0123
NP_441226.1_7 Reverse -249 -256 14.4934 0.0123
NP_441111.1_7 Forward -256 -248 18.7023 0.00294
NP_441111.1_7 Reverse -249 -257 18.7023 0.00294
NP_442379.1_10 Forward -264 -247 -3.79607 0.268
NP_441766.1_2 Forward -257 -248 17.5026 0.00297
NP_441766.1_2 Reverse -248 -257 17.5026 0.00297
NP_442969.1_4 Reverse -162 -181 4.81767 0.276
NP_442417.1_5 Reverse -248 -262 9.2427 0.137
NP_442417.1_5 Forward -257 -243 8.16106 0.164
NP_440416.1_1 Forward -257 -238 6.4893 0.0584
NP_440416.1_9 Forward -264 -245 -5.21209 0.0791
NP_440416.1_9 Reverse -253 -272 -16.4218 0.215
NP_443052.1_8 Reverse -238 -257 -8.94866 0.182
NP_443052.1_9 Forward -113 -94 -0.885524 0.218
NP_442116.1_6 Reverse -13 -30 5.2087 0.299
NP_440261.1_5 Reverse -249 -262 -2.63565 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCGCTTCACCAAAGAAAATCAAACCCCCGTCTGCGAATTTCTAGTAGAATTCCCCGGCATGAGGGATGATTCCCCCAAGGAAAGTTTGAAAGTAGTTGGTTGGGGCAATTTGGCCAACACCATCAAAGAAACCTATCACCCTGGCGATCGCCTAATTATCGAAGGACGCTTAGGTATGAATATGATAGAACGGCAGGAAGGCTTTAAGGAAAAACGAGCTGAGCTAACTGCTTCCCGCATTAGTTTGGTGGATAGCGGCAATGGCATTAATCCTGGTGAGTTGTCTTCTCCTCCAGAACCTGAAGCAGTGGACCTTAGTAACACCGATGATATTCCGTTCTAACATCCACAATTCAGCTACTCCCAGTCAGATTTTTCCTTGAACTTGAAATTTCCACA

CDS

ATGGCGGATTCCCTTCCCAATTTAGTCGATCTCAACTTCTTACCTTTTTTAACGGAGGCTGGGGAAATTGATCCGAACTACGAAAAACGTATTGGGGTTTACGCCATTTTTGACCAGCATCAGAATCTACAATACGTAGGCTATTCCCGTAATTTAGCCATTAGCCTGCTGCAACATTTGGTGCGTCAACCAGAGCATTGCCATGGGCTCAAAGTACACATCATCGACCGCCCCGATCGCCAATTATTAGTTCAAATTCAAAACCATTGGTTGGTGGGGCAAAATCCTCCTGGCAATGGTGAAAGTCAGAAAATTTGGGCTGAATCGATTAATGTGCAGGATTATTGGACTCCAGAAGAGGCCGCCACCGTTGCTAAAAGTGAACCAGGGGACACGCCCAAACTTTTGAAAAAAATTGCCCGTAGGCTAGAGGCAGAAGTGTTGGCAAAACTGGAAGCCAGGGGAGTGGCACAACAAATTCGCTTCAATCCCAAGCTGAAAGAACAAGGGCTGTTGGACATCACCTAG

Protein

MADSLPNLVDLNFLPFLTEAGEIDPNYEKRIGVYAIFDQHQNLQYVGYSRNLAISLLQHLVRQPEHCHGLKVHIIDRPDRQLLVQIQNHWLVGQNPPGNGESQKIWAESINVQDYWTPEEAATVAKSEPGDTPKLLKKIARRLEAEVLAKLEARGVAQQIRFNPKLKEQGLLDIT