Your browser is old and dusty. Try Google Chrome!

Details for slr1020

ORF slr1020
Accession NP_440474.1
Symbol sqdB
Category sulfolipid biosynthesis protein SqdB
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -352 -371 -29.4015 0.224
NP_441480.1_1 Forward -346 -327 7.7676 0.227
NP_441480.1_5 Reverse -46 -65 12.3892 0.19
NP_442151.1_6 Forward -152 -138 5.21113 0.288
NP_440931.1_5 Reverse -364 -383 17.5024 0.192
NP_440061.1_9 Reverse -231 -245 8.06211 0.183
NP_440878.1_9 Forward -72 -53 4.32602 0.174
NP_441859.1_3 Reverse -232 -251 1.96529 0.269
NP_439918.1_2 Reverse -352 -371 2.16274 0.207
NP_441208.1_9 Reverse -190 -204 5.1128 0.278
NP_440370.1_10 Reverse -184 -203 7.7676 0.25
NP_442726.1_7 Forward -383 -365 -1.65248 0.297
NP_441925.1_4 Forward -383 -364 9.93006 0.0791
NP_441925.1_4 Forward -380 -361 -13.5709 0.257
NP_440856.1_7 Reverse -193 -212 -9.047 0.282
NP_441738.1_2 Forward -82 -75 6.23363 0.264
NP_441163.1_1 Forward -390 -373 8.78956 0.226
NP_441495.1_2 Reverse -364 -383 17.404 0.153
NP_440747.1_10 Forward -65 -53 -12.0557 0.199
NP_441486.1_1 Reverse -15 -29 -5.9986 0.272
NP_442330.1_4 Reverse -51 -70 12.5063 0.286
NP_442634.1_2 Reverse -187 -206 10.1275 0.138
NP_441634.1_8 Reverse -362 -376 5.30946 0.114
NP_440376.1_1 Reverse -53 -62 12.7828 0.0185
NP_440266.1_3 Reverse -298 -314 16.8069 0.266
NP_442687.1_7 Forward -243 -233 12.7631 0.0661
NP_442687.1_7 Reverse -285 -295 4.40493 0.249
NP_442687.1_7 Reverse -52 -62 4.20827 0.262
NP_442589.1_4 Forward -394 -375 16.8132 0.135
NP_441846.1_10 Reverse -54 -73 -21.3384 0.256
NP_440642.1_10 Reverse -156 -170 1.76896 0.289
NP_440667.1_2 Reverse -364 -383 0.786102 0.208
NP_441950.1_7 Reverse -364 -383 0.687771 0.18
NP_440360.1_10 Reverse -235 -249 13.2743 0.101
NP_440360.1_10 Reverse -136 -150 1.86788 0.282
NP_442782.1_2 Reverse -53 -67 3.24451 0.267
NP_440184.1_2 Forward -251 -232 7.07928 0.245
NP_442937.1_5 Reverse -359 -378 7.86593 0.241
NP_441958.1_5 Forward -243 -233 -2.6749 0.28
NP_441127.1_1 Reverse -374 -388 9.04604 0.283
NP_440950.1_1 Forward -64 -45 1.37609 0.243
NP_440269.1_8 Forward -204 -185 5.70265 0.218
NP_441097.1_2 Reverse -243 -260 10.5603 0.203
NP_441097.1_2 Forward -53 -36 7.11867 0.245
NP_443055.1_6 Reverse -233 -251 3.45998 0.196
NP_440993.1_3 Forward -82 -63 11.6017 0.0882
NP_441429.1_4 Reverse -285 -304 16.0265 0.134
NP_440138.1_6 Reverse -234 -253 4.71854 0.237
NP_441294.1_7 Forward -377 -363 11.1704 0.153
NP_442431.1_10 Reverse -358 -376 7.88563 0.164
NP_441674.1_5 Forward -82 -63 -2.16383 0.182
NP_441550.1_8 Forward -244 -234 12.8609 0.0296
NP_441331.1_5 Forward -185 -166 14.4533 0.294
NP_441916.1_7 Reverse -53 -63 4.20827 0.185
NP_441041.1_4 Reverse -60 -79 -12.7836 0.274
NP_443063.1_5 Forward -225 -206 15.3382 0.287
NP_440703.1_9 Reverse -329 -342 5.82024 0.29
NP_441079.1_1 Forward -203 -184 14.6508 0.264
NP_442847.1_2 Reverse -365 -384 19.174 0.175
NP_442012.1_1 Forward -208 -189 0.687771 0.235
NP_441087.1_6 Forward -206 -188 -0.374908 0.258
NP_441860.1_6 Forward -273 -254 15.3189 0.29
NP_441556.1_10 Forward -67 -53 12.2659 0.195
NP_441644.1_6 Reverse -233 -243 8.14104 0.106
NP_442029.1_1 Forward -148 -129 -11.8986 0.233
NP_441523.1_6 Reverse -61 -80 9.14423 0.18
NP_443009.1_5 Forward -243 -232 4.18809 0.259
NP_442301.1_2 Forward -380 -361 4.52188 0.275
NP_441448.1_1 Forward -154 -135 8.65258 0.206
NP_440379.1_5 Reverse -56 -75 -9.047 0.259
NP_441020.2_6 Reverse -179 -196 11.2486 0.124
NP_441015.1_10 Forward -247 -228 3.14605 0.14
NP_441015.1_10 Reverse -365 -384 1.86774 0.157
NP_441015.1_10 Reverse -359 -378 -9.73531 0.282
NP_441876.1_9 Forward -70 -60 10.1076 0.3
NP_442719.1_2 Forward -229 -211 -9.51964 0.266
NP_442719.1_2 Reverse -107 -125 -10.4046 0.273
NP_440789.1_2 Reverse -172 -191 15.2408 0.18
NP_440342.1_1 Reverse -367 -386 10.1275 0.288
NP_441878.1_6 Reverse -52 -62 -7.19813 0.21
NP_441590.1_1 Reverse -229 -248 10.6192 0.256
NP_441564.1_10 Reverse -380 -399 2.0644 0.287
NP_442135.1_1 Forward -223 -204 19.9096 0.134
NP_441549.1_9 Reverse -97 -115 -8.04399 0.219
NP_442347.1_2 Forward -71 -62 6.98123 0.138
NP_442645.1_2 Reverse -10 -29 -18.1918 0.27
NP_442965.1_2 Reverse -60 -79 -7.67036 0.274
NP_442965.1_2 Reverse -48 -67 -7.86702 0.274
NP_442317.1_2 Forward -124 -105 14.9458 0.142
NP_442590.1_6 Reverse -56 -75 16.1257 0.0749
NP_442590.1_10 Reverse -364 -383 5.11266 0.267
NP_441799.1_1 Reverse -282 -296 4.71887 0.238
NP_440640.1_6 Reverse -355 -374 2.45773 0.238
NP_442334.1_10 Forward -248 -229 -7.27704 0.22
NP_442333.2_5 Reverse -222 -241 -6.78538 0.227
NP_441559.1_8 Forward -67 -53 -1.67204 0.185
NP_441559.1_8 Reverse -198 -212 -5.60527 0.267
NP_441270.1_5 Forward -248 -229 11.14 0.294
NP_440915.1_5 Reverse -365 -384 18.417 0.117
NP_440915.1_6 Forward -66 -52 -1.77037 0.246
NP_442866.1_1 Forward -247 -228 -7.37537 0.266
NP_442031.1_9 Forward -239 -220 10.4217 0.225
NP_441464.1_8 Forward -62 -48 5.99778 0.248
NP_440702.1_2 Forward -250 -231 -6.29373 0.257
NP_441750.1_1 Reverse -184 -203 -6.49039 0.239
NP_440327.1_6 Reverse -352 -371 7.66927 0.228
NP_439937.1_9 Forward -66 -49 -11.3682 0.251
NP_439937.1_9 Reverse -113 -130 -13.4331 0.286
NP_441789.1_7 Forward -200 -181 -5.1145 0.293
NP_440316.1_10 Reverse -373 -383 7.45319 0.251
NP_441803.1_2 Forward -241 -222 -0.295539 0.272
NP_442887.1_5 Reverse -206 -225 -14.1602 0.293
NP_442384.1_10 Reverse -193 -206 5.13249 0.137
NP_442384.1_10 Reverse -233 -246 2.67422 0.216
NP_441018.1_7 Reverse -366 -385 15.5357 0.102
NP_442790.1_4 Reverse -355 -374 -11.7019 0.233
NP_440189.1_5 Forward -267 -248 18.4848 0.238
NP_441965.1_10 Reverse -190 -206 3.30346 0.266
NP_442556.1_1 Reverse -58 -77 16.1257 0.0747
NP_440894.1_7 Forward -220 -201 8.4551 0.276
NP_441894.1_2 Forward -38 -20 12.2122 0.0248
NP_440999.1_9 Forward -377 -363 -2.06536 0.257
NP_442033.1_10 Forward -67 -48 -12.7836 0.277
NP_442033.1_10 Forward -204 -185 -13.4719 0.287
NP_442818.1_3 Reverse -206 -223 1.02215 0.234
NP_442845.1_2 Forward -235 -221 4.62115 0.256
NP_441469.1_8 Forward -63 -54 5.01461 0.297
NP_442337.1_6 Reverse -357 -376 14.9108 0.245
NP_442337.1_8 Forward -255 -236 3.44104 0.216
NP_442337.1_8 Reverse -357 -376 -1.86883 0.292
NP_440618.1_1 Forward -141 -122 -6.09707 0.241
NP_440673.1_3 Reverse -139 -146 10.4622 0.139
NP_440673.1_3 Reverse -103 -110 8.29892 0.221
NP_441052.1_2 Forward -229 -219 9.61647 0.0307
NP_441052.1_2 Forward -373 -363 4.89658 0.14
NP_442414.1_8 Reverse -132 -151 8.94757 0.273
NP_441004.1_1 Reverse -48 -67 1.0811 0.111
NP_441004.1_1 Reverse -47 -66 -4.13045 0.167
NP_441004.1_1 Reverse -60 -79 -14.2585 0.265
NP_441004.1_1 Forward -247 -228 -15.4385 0.275
NP_441004.1_1 Forward -248 -229 -16.0285 0.281
NP_441004.1_1 Forward -155 -136 -17.7001 0.294
NP_442366.1_3 Forward -276 -258 -1.65248 0.216
NP_442694.1_9 Reverse -117 -136 8.06259 0.277
NP_441851.1_3 Forward -343 -324 9.14423 0.299
NP_441851.1_10 Forward -116 -106 7.45319 0.14
NP_442208.1_5 Reverse -365 -384 -4.6221 0.258
NP_442208.1_5 Forward -151 -132 -8.26035 0.275
NP_441668.1_4 Reverse -354 -373 1.57275 0.212
NP_441668.1_4 Reverse -211 -230 -1.08219 0.267
NP_441396.1_2 Forward -349 -332 9.77286 0.107
NP_441982.1_6 Reverse -207 -216 10.7665 0.292
NP_442843.1_1 Reverse -204 -223 -11.8986 0.295
NP_439960.1_10 Reverse -357 -375 -3.22577 0.269
NP_440474.1_1 Forward -64 -45 22.418 0.0385
NP_440396.1_7 Reverse -372 -391 14.8466 0.288
NP_442006.1_2 Reverse -382 -399 -6.54933 0.164
NP_441570.1_1 Reverse -364 -382 -17.8771 0.295
NP_441078.1_4 Forward -62 -53 6.09625 0.0863
NP_442388.1_3 Reverse -190 -209 4.52268 0.293
NP_440539.1_9 Forward -222 -203 -2.45882 0.286
NP_442443.1_1 Reverse -368 -387 -3.54046 0.267
NP_441432.1_8 Reverse -17 -26 2.65466 0.292
NP_441732.1_2 Forward -383 -367 -17.4444 0.258
NP_440199.1_10 Reverse -15 -25 6.76487 0.269
NP_441092.1_6 Reverse -365 -384 8.16093 0.233
NP_442913.1_10 Reverse -184 -203 -3.93378 0.221
NP_441040.1_2 Forward -304 -285 -14.8485 0.286
NP_440708.1_6 Forward -72 -53 -6.29373 0.234
NP_441800.1_7 Forward -378 -360 1.10079 0.21
NP_440545.1_3 Reverse -49 -66 -0.747806 0.157
NP_440025.1_3 Reverse -111 -125 13.8056 0.235
NP_441629.1_3 Forward -383 -364 2.6536 0.218
NP_442551.1_4 Reverse -218 -233 6.56807 0.186
NP_442603.1_7 Forward -373 -359 7.96378 0.191
NP_440946.1_6 Forward -253 -234 6.19431 0.294
NP_441948.1_4 Reverse -46 -64 -3.32411 0.19
NP_441895.1_3 Forward -37 -18 -8.65367 0.277
NP_441895.1_10 Forward -128 -109 -17.9951 0.281
NP_441112.1_6 Reverse -381 -400 -3.04881 0.296
NP_442140.1_3 Forward -145 -135 4.0116 0.265
NP_441609.1_1 Reverse -214 -233 -2.65548 0.291
NP_441813.1_7 Forward -376 -362 12.6836 0.212
NP_442497.1_1 Reverse -233 -252 20.8447 0.0463
NP_440227.1_2 Forward -232 -216 8.80999 0.29
NP_441239.1_9 Reverse -231 -243 3.77555 0.276
NP_440400.1_1 Reverse -229 -248 5.99684 0.22
NP_442629.1_3 Forward -246 -227 12.6841 0.144
NP_440863.1_1 Reverse -295 -309 13.9992 0.25
NP_440833.1_6 Forward -223 -209 6.78381 0.296
NP_442216.1_4 Forward -83 -75 8.1805 0.255
NP_440354.1_7 Forward -248 -230 10.6389 0.224
NP_441474.1_1 Reverse -307 -326 -1.08295 0.258
NP_440905.1_1 Reverse -111 -129 6.11567 0.229
NP_442402.1_4 Forward -301 -282 -8.06442 0.278
NP_442402.1_4 Forward -70 -51 -8.06442 0.278
NP_442402.1_4 Forward -80 -61 -8.16275 0.278
NP_442402.1_4 Reverse -122 -141 -9.9327 0.295
NP_442402.1_10 Forward -217 -207 13.5492 0.2
NP_442402.1_10 Reverse -131 -141 11.8776 0.231
NP_440036.1_10 Forward -249 -237 15.8703 0.284
NP_441848.1_4 Reverse -4 -20 7.74165 0.288
NP_442882.1_8 Reverse -373 -392 6.58763 0.295
NP_442380.1_10 Reverse -366 -384 8.18062 0.263
NP_440825.1_6 Reverse -87 -106 7.17762 0.287
NP_440160.1_2 Reverse -220 -239 -9.24366 0.293
NP_441203.1_1 Forward -241 -222 -15.7335 0.239
NP_442533.1_1 Reverse -48 -67 -7.76869 0.197
NP_442533.1_1 Reverse -49 -68 -11.0136 0.235
NP_442533.1_1 Reverse -60 -79 -16.1268 0.263
NP_442533.1_6 Forward -229 -220 5.99792 0.121
NP_442533.1_6 Forward -62 -53 5.21127 0.15
NP_442533.1_6 Forward -202 -193 4.91628 0.165
NP_442533.1_6 Reverse -220 -229 4.22796 0.186
NP_443016.1_1 Reverse -214 -233 -4.6221 0.235
NP_441028.1_6 Forward -71 -61 11.2876 0.193
NP_441028.1_6 Reverse -132 -142 6.0761 0.232
NP_441028.1_6 Forward -60 -50 6.0761 0.232
NP_441028.1_6 Reverse -109 -119 3.51951 0.292
NP_441527.1_4 Forward -136 -117 -5.01375 0.194
NP_441527.1_4 Reverse -330 -349 -9.31089 0.256
NP_441602.1_3 Forward -207 -188 0.687771 0.217
NP_441602.1_3 Forward -247 -228 -1.08219 0.226
NP_441972.1_5 Forward -109 -90 -8.45701 0.265
NP_001035870.1_10 Reverse -329 -348 13.7064 0.248
NP_440886.1_7 Forward -374 -364 15.9091 0.0203
NP_440886.1_7 Forward -63 -53 5.09279 0.201
NP_442614.1_2 Forward -116 -102 12.1926 0.166
NP_442794.1_1 Reverse -360 -372 2.89058 0.286
NP_442615.1_1 Forward -304 -286 -7.55234 0.296
NP_441431.1_2 Forward -170 -156 11.897 0.131
NP_442647.1_7 Reverse -228 -241 12.5073 0.214
NP_441836.1_2 Reverse -131 -150 4.32602 0.145
NP_441993.1_1 Reverse -361 -380 2.04414 0.265
NP_440114.1_10 Reverse -193 -207 5.70279 0.296
NP_440293.1_3 Reverse -365 -384 -5.01543 0.269
NP_440293.1_10 Forward -152 -133 -3.14714 0.287
NP_439988.1_7 Reverse -235 -249 13.8636 0.292
NP_440801.1_8 Reverse -289 -308 -1.86883 0.283
NP_440801.1_9 Forward -340 -326 12.8353 0.286
NP_441436.1_8 Reverse -51 -70 7.17762 0.293
NP_442862.1_1 Forward -67 -48 7.96426 0.269
NP_441885.1_5 Forward -62 -52 -1.59326 0.273
NP_442341.1_7 Reverse -17 -31 4.42448 0.191
NP_439962.1_4 Forward -387 -368 -8.94866 0.298
NP_440149.1_8 Reverse -12 -31 -5.99873 0.238
NP_441105.1_3 Forward -253 -234 -4.52377 0.201
NP_440216.1_1 Reverse -53 -67 -11.6035 0.203
NP_440216.1_1 Reverse -364 -378 -12.4884 0.274
NP_440416.1_9 Forward -79 -60 -16.9135 0.226
NP_443052.1_9 Forward -67 -48 -2.16383 0.233
NP_443052.1_9 Forward -380 -361 -4.22878 0.255
NP_443052.1_9 Reverse -136 -155 -5.40875 0.27
NP_443052.1_9 Forward -383 -364 -5.50708 0.271
NP_442154.1_1 Reverse -350 -368 -17.9754 0.273
NP_442564.1_9 Reverse -101 -115 13.6387 0.275
NP_440261.1_5 Reverse -234 -247 -12.3704 0.284
NP_440988.1_7 Reverse -360 -379 -4.32711 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCCCCTTCCTGTTGGGCCACACAGCCCGCCACCACCAGAGTTAATTCCGGTTCTACTTGTTTCCTTTTGGCTTGACGACCAAGGTATGAGTAGACTTTTTGCTCAGCGTTGTCCCGAATAGAACAGGTATTGTAGAGGACTAAATCCGCCTGGTTGGGGTCATCGGTGTAGGTCATGCCCAAATTTTCCAGAATGCCGGCCATCCTTTCCGAGTCCGCCTTATTCATCTGGCAGCCAAAGGTAATAATGTGGTAGCGACGGTGGGAAACATTCATGGGAAATAGGGCGAAGCAATGAACAGCACAATGTCTGATTATAGTTCCCCGTCTTGACCCCCGGCTGTCCCCCAACCTGATAAATTGGACAGATATCAGTGATAGACATTTACTCGGATTTAAT

CDS

ATGAGAGCTCTGGTTATTGGCGGTGATGGTTACTGTGGTTGGGCCACGGCACTGTATCTCTCTAACAAAGGCTATGAAGTCGGTATTTTAGACAGTTTGGTGCGGCGCTATTGGGACGCCCAGTTGGGGGCTGAAACCTTGACTCCCATCGCCCCCATCCGGCAACGCCTTGATCGTTGGTATGAGTTGACCGGCAAAAAGATCGACCTGTTCATTGGCGATATTAACGACTATCCCTTTTTGACCAACGCCCTCCGTCAGTTCCAGCCCGATGCGGTGGTGCATTTTGGGGAGCAACGGTCAGCGCCTTTTTCCATGATTGACCGGGAACATGCGGTGCTGACCCAGGCCAATAACGTATTGGGCAACTTGAATCTGCTCTATGCACTGAAGGAAGATTTCCCCGATTGTCATTTGGTGAAACTAGGCACCATGGGGGAATACGGTACGCCCAACATTGACATCGAAGAAGGGTACATCACCATTGAGCATAAAGGTCGTAAAGACACCCTACCCTACCCCAAACAACCCGGTAGTTTCTATCACCTCAGTAAGGTTCACGATAGCCATAACATCCACTTCGCTTGCAAAATCTGGGGTCTGCGGGCCACGGATTTAAACCAGGGCATTGTTTACGGGGTACTCACCGAAGAAACCGGCATGGATGAAATGCTGATCAACCGTCTTGATTATGACGGTGTATTTGGTACGGCTCTGAATCGTTTTTGTATTCAGGCGGCCATTGGCCATCCCCTGACAGTGTACGGTAAAGGTGGACAAACCCGTGGTTTGCTGGATATTCGGGATACGGTGCGCTGTATTGAACTGGCGATCGCCAACCCGGCCGATAAAGGTCAATTCCGGGTGTTTAACCAATATACGGAACTGTTCAGCGTTGGTGACTTGGCCCAAATGGTGCAAAAAGCGGGCGCGGATCTCGGTCTAAAAGTGGAAATTGACCACTTGGAAAATCCCCGGGTTGAGTTGGAAGAACACTATTTCAACGCCGTCAATACCAATCTGCTGGATTTGGGACTCCAACCCCACTTCTTGTCTGATTCTTTGCTCGATTCCCTGTTGAACTTTGCCACCAAGTACAAAGACCGGGTGGATCAAAAACACATTCTGCCGAAAGTTACCTGGCGCGGCTAG

Protein

MRALVIGGDGYCGWATALYLSNKGYEVGILDSLVRRYWDAQLGAETLTPIAPIRQRLDRWYELTGKKIDLFIGDINDYPFLTNALRQFQPDAVVHFGEQRSAPFSMIDREHAVLTQANNVLGNLNLLYALKEDFPDCHLVKLGTMGEYGTPNIDIEEGYITIEHKGRKDTLPYPKQPGSFYHLSKVHDSHNIHFACKIWGLRATDLNQGIVYGVLTEETGMDEMLINRLDYDGVFGTALNRFCIQAAIGHPLTVYGKGGQTRGLLDIRDTVRCIELAIANPADKGQFRVFNQYTELFSVGDLAQMVQKAGADLGLKVEIDHLENPRVELEEHYFNAVNTNLLDLGLQPHFLSDSLLDSLLNFATKYKDRVDQKHILPKVTWRG