Your browser is old and dusty. Try Google Chrome!

Details for slr1019

ORF slr1019
Accession NP_440471.1
Symbol
Category Other
Definition phenazine biosynthetic protein PhzF homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_1 Forward -149 -138 9.00628 0.267
NP_441818.1_9 Reverse -207 -226 -9.14533 0.287
NP_441342.1_3 Reverse -204 -223 16.5191 0.296
NP_442623.1_1 Reverse -219 -238 -17.7001 0.287
NP_442655.1_10 Reverse -209 -228 -18.5851 0.272
NP_442173.1_1 Reverse -213 -221 5.72262 0.203
NP_442173.1_1 Forward -104 -96 5.13263 0.226
NP_442173.1_3 Reverse -359 -369 15.418 0.299
NP_443027.1_4 Reverse -8 -18 6.76487 0.269
NP_441812.1_1 Reverse -161 -175 12.782 0.247
NP_441675.1_4 Reverse -5 -24 3.24438 0.277
NP_440784.1_7 Forward -149 -142 4.26735 0.272
NP_440061.1_9 Forward -379 -365 5.01387 0.298
NP_439979.1_9 Reverse -202 -220 8.67227 0.26
NP_442062.1_8 Forward -105 -95 7.74818 0.0897
NP_442242.1_4 Forward -149 -142 9.38056 0.26
NP_442110.1_7 Reverse -355 -369 1.67122 0.222
NP_440655.1_6 Reverse -334 -353 17.404 0.0523
NP_442889.1_8 Reverse -51 -65 4.32555 0.27
NP_440178.1_7 Forward -147 -128 -22.42 0.265
NP_441327.1_1 Reverse -47 -66 9.6916 0.203
NP_440747.1_10 Forward -108 -96 -4.68091 0.115
NP_441486.1_1 Forward -108 -94 -4.7203 0.205
NP_440470.1_6 Reverse -52 -68 24.7396 0.0129
NP_442848.1_4 Forward -384 -370 6.09611 0.284
NP_442848.1_9 Forward -380 -361 3.83436 0.215
NP_441634.1_8 Reverse -216 -230 4.91614 0.114
NP_440376.1_1 Forward -267 -258 1.86802 0.238
NP_440376.1_1 Reverse -366 -375 -0.196935 0.285
NP_441588.1_4 Forward -103 -93 5.68323 0.245
NP_442687.1_7 Forward -295 -285 6.96153 0.147
NP_442687.1_7 Reverse -95 -105 4.79825 0.234
NP_442687.1_7 Reverse -257 -267 4.69992 0.238
NP_441077.1_6 Reverse -384 -400 4.53719 0.255
NP_441077.1_6 Reverse -34 -50 3.38031 0.271
NP_442958.1_9 Forward -354 -344 16.893 0.277
NP_440181.1_2 Forward -226 -208 10.3439 0.297
NP_441029.1_3 Forward -226 -207 0.687771 0.277
NP_442658.1_1 Reverse -199 -209 7.55106 0.214
NP_442544.1_4 Forward -48 -29 6.19431 0.194
NP_440184.1_2 Reverse -359 -378 7.66927 0.245
NP_442653.1_1 Reverse -28 -47 0.196116 0.29
NP_442937.1_5 Forward -170 -151 10.8159 0.152
NP_442937.1_5 Reverse -363 -382 5.99764 0.293
NP_442937.1_5 Forward -299 -280 5.89931 0.295
NP_440984.1_7 Reverse -351 -365 7.9644 0.16
NP_440984.1_7 Forward -110 -96 6.48943 0.214
NP_441162.1_3 Reverse -202 -221 8.94757 0.254
NP_441338.2_5 Reverse -349 -368 6.29264 0.275
NP_442690.1_1 Reverse -45 -64 -5.31042 0.157
NP_442690.1_1 Reverse -16 -35 -5.31042 0.157
NP_442690.1_1 Forward -93 -74 -14.1602 0.269
NP_442911.1_2 Reverse -202 -221 -4.22878 0.129
NP_440325.1_1 Reverse -39 -58 13.2741 0.225
NP_440934.1_2 Forward -227 -208 17.699 0.0813
NP_440471.1_3 Forward -169 -155 19.9608 0.0654
NP_440471.1_6 Forward -221 -202 18.3873 0.165
NP_440471.1_9 Forward -382 -363 21.9273 0.0338
NP_442002.1_9 Reverse -257 -264 12.2322 0.185
NP_441294.1_7 Reverse -152 -166 14.338 0.0446
NP_442438.1_10 Reverse -207 -221 2.65453 0.17
NP_442431.1_10 Reverse -207 -225 2.18243 0.243
NP_440377.1_1 Reverse -35 -52 10.6939 0.293
NP_441000.1_6 Forward -298 -284 1.67122 0.163
NP_441125.1_6 Forward -29 -16 13.0973 0.244
NP_440465.1_3 Forward -191 -172 16.7157 0.299
NP_441041.1_4 Reverse -207 -226 -0.39387 0.0954
NP_441041.1_7 Reverse -209 -221 6.15429 0.221
NP_439966.1_7 Forward -376 -366 4.99446 0.248
NP_439966.1_7 Forward -223 -213 4.01116 0.295
NP_439966.1_9 Reverse -363 -372 6.98123 0.253
NP_439966.1_9 Reverse -210 -219 6.5879 0.253
NP_440983.1_5 Forward -221 -202 -4.13045 0.252
NP_442281.1_1 Forward -226 -212 3.73557 0.221
NP_442256.1_2 Forward -360 -342 -9.22396 0.254
NP_442012.1_5 Forward -216 -197 0.196116 0.288
NP_441556.1_10 Forward -363 -349 10.6112 0.266
NP_442215.1_2 Reverse -94 -110 -5.54633 0.251
NP_442029.1_10 Forward -375 -356 4.81767 0.29
NP_440469.1_6 Forward -220 -201 17.9932 0.133
NP_441346.1_5 Reverse -363 -382 20.7473 0.0349
NP_442933.1_10 Reverse -96 -105 4.22796 0.267
NP_440430.1_5 Reverse -311 -330 14.0608 0.219
NP_442167.1_1 Reverse -79 -98 12.3892 0.244
NP_442142.1_4 Forward -108 -95 9.95012 0.083
NP_442142.1_4 Forward -213 -200 6.0169 0.175
NP_442143.1_3 Forward -357 -338 8.55425 0.13
NP_443009.1_5 Forward -106 -95 10.2846 0.0792
NP_441715.1_4 Forward -149 -139 4.99491 0.24
NP_440881.1_3 Forward -305 -286 15.4366 0.276
NP_440379.1_5 Reverse -203 -222 -9.53865 0.264
NP_442253.1_5 Reverse -249 -266 -5.07437 0.293
NP_441826.1_5 Reverse -363 -382 12.9791 0.117
NP_443004.2_2 Reverse -21 -40 18.5853 0.135
NP_441637.1_9 Forward -90 -72 5.52568 0.245
NP_441764.1_1 Reverse -15 -34 13.8641 0.116
NP_441764.1_4 Forward -34 -17 15.0427 0.123
NP_442868.1_6 Reverse -201 -211 -0.216628 0.273
NP_442868.1_6 Reverse -139 -149 -0.216628 0.273
NP_442719.1_2 Reverse -87 -105 -9.22465 0.261
NP_442227.1_2 Forward -376 -357 -0.885524 0.26
NP_442808.1_1 Forward -376 -366 3.02785 0.25
NP_441878.1_6 Forward -147 -137 -7.78811 0.266
NP_441036.1_8 Reverse -364 -374 13.2547 0.0513
NP_441557.1_5 Forward -105 -96 -0.885252 0.26
NP_440084.1_8 Reverse -61 -75 10.6112 0.266
NP_441739.1_2 Reverse -73 -89 4.28609 0.245
NP_441549.1_7 Reverse -219 -238 14.7483 0.224
NP_441467.1_10 Forward -189 -175 5.40779 0.281
NP_442645.1_2 Forward -113 -94 -17.9951 0.267
NP_440690.1_3 Reverse -294 -313 15.3391 0.194
NP_442317.1_8 Forward -50 -31 19.6656 0.134
NP_440709.1_1 Reverse -27 -46 7.96345 0.109
NP_440733.1_2 Forward -93 -75 16.2356 0.105
NP_440748.1_5 Forward -225 -206 7.07928 0.187
NP_441199.1_5 Reverse -292 -311 8.65258 0.259
NP_441271.1_1 Reverse -206 -224 10.3431 0.282
NP_441254.1_1 Reverse -170 -183 16.8333 0.178
NP_442251.1_6 Forward -104 -97 8.69224 0.199
NP_440192.1_4 Reverse -363 -382 8.4274 0.298
NP_440027.1_3 Forward -222 -204 10.1465 0.176
NP_440027.1_3 Forward -374 -356 2.47668 0.289
NP_440408.1_7 Forward -358 -339 9.93088 0.253
NP_440921.1_4 Forward -375 -356 16.2241 0.252
NP_442239.1_8 Reverse -362 -381 4.71934 0.296
NP_440271.1_1 Forward -167 -148 10.0292 0.119
NP_441789.1_7 Forward -220 -201 3.24359 0.205
NP_439977.1_5 Reverse -206 -225 -1.37718 0.25
NP_440267.1_2 Reverse -162 -176 6.19383 0.239
NP_440364.1_6 Reverse -200 -213 15.4566 0.275
NP_441877.1_9 Reverse -80 -97 1.31714 0.299
NP_440282.1_10 Forward -156 -137 11.0125 0.0802
NP_440282.1_10 Reverse -339 -358 -7.4737 0.251
NP_441060.1_6 Reverse -368 -384 11.9566 0.254
NP_440189.1_2 Reverse -277 -296 0.196116 0.279
NP_441965.1_10 Forward -209 -193 2.22182 0.289
NP_442750.1_1 Forward -100 -81 10.3234 0.255
NP_441896.1_3 Reverse -203 -222 -3.14714 0.297
NP_442378.1_1 Forward -46 -29 16.4601 0.22
NP_440894.1_10 Forward -226 -207 9.83255 0.155
NP_440894.1_10 Forward -347 -328 4.03102 0.259
NP_440937.1_5 Reverse -206 -225 12.8808 0.275
NP_440937.1_5 Forward -300 -281 8.06259 0.287
NP_439969.1_1 Forward -376 -357 -3.93378 0.288
NP_441543.1_2 Reverse -55 -64 4.32629 0.26
NP_440220.1_4 Reverse -79 -98 -0.0996487 0.257
NP_440148.1_1 Forward -93 -74 -3.3438 0.219
NP_443062.1_3 Reverse -200 -216 17.6598 0.134
NP_441601.1_4 Reverse -358 -377 6.78429 0.162
NP_441601.1_4 Forward -223 -204 -5.40875 0.293
NP_440454.1_2 Reverse -176 -190 10.5157 0.291
NP_442428.1_7 Reverse -83 -102 8.55425 0.213
NP_440673.1_3 Forward -103 -96 11.3472 0.085
NP_440673.1_7 Forward -204 -185 1.0811 0.254
NP_441714.1_3 Forward -112 -94 14.768 0.169
NP_441052.1_2 Reverse -156 -166 4.89658 0.14
NP_440436.1_4 Forward -104 -95 10.4224 0.0777
NP_440436.1_4 Reverse -97 -106 4.42421 0.265
NP_441884.1_9 Forward -266 -247 -23.6 0.284
NP_441884.1_9 Forward -209 -190 -23.895 0.284
NP_440314.1_1 Forward -46 -27 27.9255 0.000618
NP_440314.1_1 Reverse -31 -50 25.9588 0.00119
NP_441733.1_10 Reverse -362 -375 8.08242 0.143
NP_442813.1_2 Reverse -12 -31 6.68596 0.191
NP_442366.1_3 Reverse -95 -113 4.05072 0.101
NP_443054.1_2 Reverse -256 -270 -0.492064 0.295
NP_441966.1_7 Reverse -167 -186 1.17865 0.214
NP_441851.1_2 Forward -101 -82 6.58763 0.181
NP_441851.1_10 Forward -106 -96 5.5849 0.207
NP_441157.1_1 Reverse -78 -92 14.3553 0.136
NP_441273.1_1 Reverse -290 -309 12.0942 0.269
NP_441396.1_5 Forward -167 -158 8.25953 0.224
NP_441982.1_6 Forward -99 -90 12.7718 0.274
NP_440165.1_5 Forward -375 -356 -7.4737 0.265
NP_442689.1_8 Reverse -49 -66 0.628827 0.191
NP_439960.1_10 Reverse -356 -374 -3.81576 0.282
NP_441124.1_5 Reverse -42 -52 11.4803 0.254
NP_440431.1_3 Forward -106 -87 -0.590531 0.144
NP_442450.1_5 Forward -146 -136 6.56821 0.167
NP_442450.1_5 Forward -212 -202 5.68323 0.231
NP_442168.1_6 Forward -22 -3 7.47261 0.23
NP_441003.1_9 Reverse -242 -261 7.7676 0.227
NP_440526.1_3 Reverse -97 -108 4.58141 0.267
NP_441432.1_8 Reverse -348 -357 3.24465 0.252
NP_441432.1_9 Forward -396 -383 12.7675 0.197
NP_441732.1_2 Reverse -345 -361 -17.7394 0.292
NP_440629.1_6 Reverse -129 -148 12.7982 0.282
NP_440461.1_3 Forward -166 -147 17.6007 0.145
NP_442489.1_7 Forward -105 -96 -1.77023 0.247
NP_440559.1_1 Reverse -97 -106 4.71961 0.217
NP_441659.2_8 Reverse -96 -106 3.12662 0.172
NP_440786.1_9 Reverse -34 -53 13.3725 0.288
NP_441022.1_1 Reverse -83 -92 15.0954 0.183
NP_441022.1_1 Forward -93 -84 12.4095 0.232
NP_439912.1_6 Forward -304 -286 12.7038 0.255
NP_442346.1_5 Reverse -155 -165 5.78156 0.229
NP_440025.1_3 Forward -86 -72 9.64265 0.294
NP_440010.1_6 Reverse -210 -229 18.6823 0.0621
NP_440449.1_6 Forward -366 -348 5.4352 0.276
NP_441502.1_3 Forward -323 -304 9.3409 0.212
NP_440671.1_4 Reverse -206 -220 5.70279 0.275
NP_442943.1_1 Reverse -36 -51 14.303 0.0893
NP_442943.1_1 Forward -52 -37 3.67984 0.26
NP_441671.1_1 Forward -217 -198 -0.295539 0.273
NP_440590.1_4 Reverse -366 -379 1.9859 0.105
NP_442568.1_8 Reverse -385 -399 7.76774 0.296
NP_441874.1_1 Reverse -323 -337 9.34103 0.277
NP_442216.1_5 Reverse -35 -54 13.3725 0.288
NP_440212.1_9 Reverse -76 -95 7.96164 0.146
NP_440546.1_6 Forward -216 -197 9.0459 0.253
NP_442611.1_1 Forward -374 -355 -0.787193 0.271
NP_442611.1_1 Forward -221 -202 -3.14714 0.298
NP_440868.1_1 Reverse -328 -347 17.6007 0.0983
NP_440868.1_4 Reverse -137 -149 -0.452677 0.269
NP_442402.1_4 Reverse -185 -204 -8.94939 0.285
NP_442039.1_4 Reverse -213 -220 7.02061 0.269
NP_442322.1_4 Reverse -277 -294 -9.7949 0.297
NP_442202.1_10 Forward -359 -345 5.21113 0.255
NP_441680.1_4 Forward -376 -357 6.98095 0.175
NP_441602.1_3 Forward -379 -360 -3.73712 0.252
NP_441972.1_5 Forward -376 -357 -7.57203 0.25
NP_441106.1_3 Forward -49 -30 9.93088 0.29
NP_440429.1_9 Forward -375 -356 4.916 0.215
NP_441809.1_10 Reverse -32 -50 19.3903 0.185
NP_440670.1_8 Forward -105 -96 3.83464 0.219
NP_440886.1_7 Reverse -155 -165 6.17443 0.141
NP_440886.1_7 Forward -375 -365 3.61784 0.272
NP_440886.1_10 Reverse -188 -207 10.0284 0.215
NP_439899.1_1 Reverse -12 -30 10.0275 0.165
NP_442221.1_4 Reverse -359 -378 8.35759 0.296
NP_441205.1_5 Forward -89 -70 17.5015 0.222
NP_441993.1_1 Reverse -349 -368 2.43397 0.259
NP_442090.1_2 Reverse -21 -40 18.6683 0.119
NP_442090.1_2 Forward -40 -21 5.39487 0.3
NP_440293.1_3 Forward -296 -277 -3.44213 0.244
NP_440766.1_4 Reverse -208 -222 10.816 0.0841
NP_440766.1_4 Reverse -361 -375 3.8345 0.141
NP_440457.1_1 Reverse -361 -373 -0.0593532 0.25
NP_440942.1_9 Reverse -289 -308 13.3716 0.106
NP_442561.1_1 Forward -49 -30 19.174 0.172
NP_442561.1_1 Reverse -28 -47 17.994 0.177
NP_441332.1_4 Forward -280 -261 3.83436 0.293
NP_441332.1_6 Forward -376 -366 14.5511 0.144
NP_442936.1_10 Reverse -82 -96 18.8343 0.216
NP_440478.1_10 Forward -214 -200 9.93102 0.215
NP_442341.1_7 Forward -222 -208 6.88276 0.116
NP_442395.2_4 Forward -222 -203 8.75009 0.121
NP_440275.1_3 Reverse -286 -296 1.84832 0.282
NP_442638.1_3 Reverse -68 -87 12.3658 0.298
NP_439962.1_4 Forward -377 -358 -5.31042 0.278
NP_439962.1_4 Reverse -204 -223 -6.49039 0.283
NP_439962.1_6 Forward -169 -151 8.96727 0.23
NP_440175.1_7 Reverse -203 -221 15.121 0.128
NP_440175.1_7 Forward -298 -280 11.9005 0.23
NP_440216.1_9 Reverse -254 -263 5.3096 0.298
NP_441844.1_1 Forward -47 -28 15.0441 0.146
NP_441045.1_4 Forward -177 -158 12.8808 0.274
NP_441226.1_7 Forward -374 -367 5.64364 0.286
NP_443052.1_8 Reverse -355 -374 -9.93197 0.198
NP_442154.1_1 Reverse -358 -376 -14.1405 0.217
NP_440261.1_5 Reverse -97 -110 -11.0921 0.237
NP_440261.1_5 Reverse -350 -363 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTATTAGCTTATTTTTGCTACTCCGCCGACCCCAGCTGGGCGCTAAAGCCTTCAGCATTAAACACCCTGGTCAAAGTGAAACTAGCTCAGGGAAGCATTACTGCGGTCATAGGTTGTGCGGAAACTGGATTGAGGTTTGCCCTGCACAGTGGTCCAAAAATCCTTTTCTGCTTCCACGCCAATCTCAGCGGCAGCGCGGGACAACATGGATTGTTGACGGTTTTTGATGAATTGGTGGTGGCGCATCATGAGAGCGCGAGCCTGTTGTTGAGTAGACATAGTTAATACCTCTTGACGATTGCTGAAAAAAGTTTTGGTTAATTACCCTCTTTAATATTTATAGCACAAATTCTGTAACATTTTATACAGAAACAAAAATTTACATCCCCTTCTTCCCT

CDS

GTGTTCAATTCCCCAGTTAGACCTATGCGCTATGGCTTCTATACCCTTGACGTGTTCACTGACCAACTTTTTGGCGGTAATCCCCTGGCGGTTTTTCCCGATGCTGAGGGTTTGACCGATGGACAAATGCAAAAAATTGCAGCGGAAATCAATTATTCCGAAACGGTGTTTGTTTTGCCCCCAGTGACGGAAACGGGGAATTTTCGCCTAAGAATTTTTACCCCCAAAAGGGAATTGGATTTTGCAGGGCATCCCACCATTGGGACCACCTATCTGTTGGGTTTGCTCCAGCCCCCCAGCCCTTTAGTTACCACCACTTGGCAGTTGGAAGAGCCGGTGGGCCTAGTGCCCGTTACCCTCCACTACAAGCAAGGACAACTGGTGCAAACAGAATTAACCGTGGCCCAGCTTCCCCAAACCAAGGATTCTGCCCCATCTTGTGAAGATTTGGCCTTGCTTTTGGGATTATCCATTGATCAGCTACAGCAAGGAGAATATGAACCCCAAGCCTATTCCTGTGGATTGCCCTTTTTATTTATTCCACTGATAAATGAGGAGGCGTTAAATCGGATTAGTTTTAATCCATCGGTTTGGCAAAATCTCTTGGCGGGTCAATGGGCCGATTGCGTTTACTGCCTGGCCCCAGGAGATCCTTCACTGGGTTTGTCCGATAACAAGTTGATCCATGGGCGGATGTTTGCCCCTGGTTTGGGCATTGCGGAAGATCCGGCCACTGGCTCCGGGGTAGCGGCATTGGGAGGTTATTTAGACGATCGCCTAGACACTCCAGGCTCACACCATTGGCAAATTGAACAGGGCAAAGCCTTGGGAAGGCCCAGCCAATTACAGTTAACTGTGGTAAAAGACGGTCAGGGGATTAGGGCAGTGAAAGTGGCCGGGCGATCCGTTTTAGTCTCGGAGGGCTTCATGAACCTGGGGAATTAG

Protein

MFNSPVRPMRYGFYTLDVFTDQLFGGNPLAVFPDAEGLTDGQMQKIAAEINYSETVFVLPPVTETGNFRLRIFTPKRELDFAGHPTIGTTYLLGLLQPPSPLVTTTWQLEEPVGLVPVTLHYKQGQLVQTELTVAQLPQTKDSAPSCEDLALLLGLSIDQLQQGEYEPQAYSCGLPFLFIPLINEEALNRISFNPSVWQNLLAGQWADCVYCLAPGDPSLGLSDNKLIHGRMFAPGLGIAEDPATGSGVAALGGYLDDRLDTPGSHHWQIEQGKALGRPSQLQLTVVKDGQGIRAVKVAGRSVLVSEGFMNLGN