Your browser is old and dusty. Try Google Chrome!

Details for slr0983

ORF slr0983
Accession NP_440221.1
Symbol rfbF
Category Surface polysaccharides, lipopolysaccharides and antigens
Definition glucose-1-phosphate cytidylyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -169 -183 3.14618 0.168
NP_440795.1_7 Forward -170 -163 10.6589 0.143
NP_441418.1_6 Forward -282 -263 -22.5183 0.179
NP_442655.1_1 Forward -89 -70 1.47442 0.238
NP_441812.1_1 Forward -350 -336 14.0603 0.229
NP_442975.1_10 Reverse -136 -150 4.71887 0.241
NP_440061.1_9 Forward -106 -92 6.48882 0.244
NP_440061.1_9 Reverse -61 -75 6.48882 0.244
NP_441619.1_8 Forward -177 -163 11.307 0.184
NP_442742.1_9 Reverse -25 -44 -12.4886 0.269
NP_441738.1_2 Reverse -171 -178 6.52862 0.261
NP_440655.1_2 Reverse -1 -20 0.982764 0.293
NP_442765.1_2 Forward -357 -338 7.47261 0.212
NP_442111.1_4 Forward -97 -83 6.3911 0.127
NP_442111.1_4 Forward -85 -71 4.91614 0.185
NP_442111.1_4 Forward -55 -41 4.71948 0.194
NP_440747.1_10 Reverse -72 -84 -12.2524 0.254
NP_442973.1_5 Reverse -16 -35 10.6192 0.276
NP_443018.1_3 Forward -95 -88 6.62729 0.168
NP_441634.1_8 Reverse -135 -149 -2.95034 0.295
NP_440376.1_1 Forward -178 -169 -0.0986038 0.285
NP_442687.1_7 Forward -85 -75 4.79825 0.234
NP_441077.1_6 Reverse -305 -321 2.12702 0.289
NP_441846.1_10 Forward -83 -64 -22.125 0.257
NP_441422.1_7 Reverse -70 -87 -6.15601 0.248
NP_441950.1_7 Forward -183 -164 -7.4737 0.278
NP_441256.1_2 Forward -76 -57 8.84924 0.198
NP_440203.1_5 Reverse -171 -181 9.22267 0.268
NP_440153.1_8 Reverse -168 -181 -2.53732 0.244
NP_440934.1_2 Reverse -163 -182 3.04771 0.239
NP_441099.1_5 Reverse -65 -84 -9.44032 0.223
NP_440147.1_4 Reverse -73 -86 5.82081 0.112
NP_441547.1_3 Forward -172 -153 20.6481 0.146
NP_439966.1_7 Reverse -167 -177 6.96107 0.16
NP_439966.1_9 Forward -180 -171 3.83464 0.253
NP_440289.1_2 Forward -87 -74 1.59258 0.122
NP_441678.1_9 Forward -83 -64 -0.983855 0.238
NP_442281.1_1 Reverse -58 -72 8.16044 0.0845
NP_441079.1_7 Reverse -281 -300 -2.36125 0.217
NP_440437.1_1 Reverse -69 -88 -3.44213 0.236
NP_442215.1_2 Forward -86 -70 -6.43131 0.271
NP_442177.1_5 Forward -180 -166 10.9143 0.223
NP_442177.1_5 Reverse -318 -332 9.2427 0.24
NP_441762.1_7 Reverse -263 -275 -3.89426 0.14
NP_443009.1_5 Reverse -168 -179 3.99143 0.268
NP_440279.1_2 Forward -176 -157 4.32602 0.299
NP_441448.1_1 Forward -20 -1 4.52268 0.278
NP_442808.1_1 Forward -338 -328 1.65123 0.282
NP_440918.1_9 Forward -364 -345 18.8944 0.105
NP_442050.1_5 Reverse -167 -177 8.3377 0.234
NP_440558.1_2 Forward -181 -162 -1.7705 0.218
NP_441878.1_6 Forward -85 -75 -7.49312 0.231
NP_441445.1_1 Forward -93 -74 0.491109 0.275
NP_441433.1_8 Forward -23 -4 5.30933 0.178
NP_441819.1_5 Reverse -288 -307 9.02356 0.283
NP_441037.1_4 Forward -84 -74 6.05075 0.283
NP_442594.1_8 Reverse -312 -331 5.30933 0.247
NP_442594.1_8 Forward -73 -54 4.52268 0.26
NP_442317.1_6 Reverse -70 -89 1.86774 0.296
NP_441633.1_3 Reverse -73 -86 1.78924 0.109
NP_441633.1_3 Forward -284 -271 -1.55401 0.159
NP_441633.1_3 Reverse -43 -56 -1.65234 0.16
NP_442590.1_10 Reverse -162 -181 10.1275 0.183
NP_442590.1_10 Forward -84 -65 5.60432 0.258
NP_442998.1_5 Reverse -311 -321 8.63316 0.261
NP_440299.1_1 Forward -225 -212 4.05029 0.221
NP_440256.1_1 Forward -37 -18 -10.3253 0.299
NP_441559.1_8 Reverse -206 -220 0.491246 0.166
NP_441559.1_8 Reverse -164 -178 -7.17857 0.287
NP_441559.1_8 Forward -182 -168 -7.57189 0.295
NP_440915.1_6 Forward -76 -62 -1.18038 0.224
NP_440915.1_6 Reverse -41 -55 -1.77037 0.246
NP_441179.1_2 Reverse -365 -384 -0.787193 0.272
NP_441179.1_9 Reverse -262 -272 8.73102 0.284
NP_442785.1_1 Reverse -222 -241 15.4374 0.298
NP_441494.1_6 Forward -14 -1 7.98409 0.242
NP_440677.1_1 Reverse -264 -283 7.66927 0.232
NP_442386.1_10 Reverse -330 -343 8.86907 0.217
NP_440586.1_1 Forward -181 -162 -3.3438 0.265
NP_440027.1_8 Forward -339 -320 4.12856 0.292
NP_440439.1_1 Reverse -42 -55 -1.55401 0.273
NP_440171.1_3 Forward -87 -68 5.80098 0.284
NP_441138.1_5 Reverse -341 -354 2.92653 0.297
NP_441789.1_7 Reverse -54 -73 -4.1312 0.28
NP_441245.1_3 Forward -46 -27 17.7974 0.129
NP_442384.1_10 Forward -84 -71 8.08242 0.0692
NP_442384.1_10 Reverse -63 -76 5.23083 0.134
NP_440221.1_4 Forward -189 -170 21.9273 0.0272
NP_440221.1_8 Forward -220 -201 22.9106 0.0451
NP_441877.1_7 Reverse -268 -287 7.57013 0.218
NP_442790.1_4 Forward -158 -139 -6.09707 0.144
NP_442262.1_10 Forward -95 -88 10.1672 0.162
NP_440562.1_1 Reverse -49 -68 9.93006 0.297
NP_440894.1_10 Reverse -29 -48 2.65439 0.286
NP_440937.1_5 Forward -276 -257 10.2259 0.275
NP_440999.1_9 Forward -340 -326 -0.688726 0.214
NP_442077.1_9 Reverse -283 -302 -5.80207 0.283
NP_442710.1_7 Forward -299 -280 5.75208 0.129
NP_441469.1_8 Reverse -272 -281 8.55452 0.227
NP_440519.1_8 Forward -57 -41 6.9417 0.21
NP_442204.1_5 Forward -64 -45 0.687771 0.256
NP_440544.1_5 Reverse -5 -12 14.5681 0.264
NP_441351.1_8 Reverse -271 -290 7.17762 0.192
NP_440865.1_9 Forward -90 -71 2.0644 0.117
NP_441052.1_2 Reverse -75 -85 1.84832 0.225
NP_441052.1_2 Reverse -162 -172 -0.806614 0.299
NP_441004.1_4 Forward -276 -266 12.3697 0.245
NP_440129.1_10 Reverse -80 -94 3.93283 0.187
NP_442206.1_10 Forward -54 -39 4.30646 0.178
NP_440328.1_4 Reverse -69 -88 1.17943 0.232
NP_442689.1_8 Forward -269 -252 -7.43431 0.292
NP_442843.1_4 Forward -292 -274 15.4571 0.194
NP_441596.1_7 Reverse -305 -324 8.84924 0.258
NP_440431.1_3 Reverse -187 -206 7.47261 0.0886
NP_440588.1_2 Reverse -66 -85 0.982764 0.141
NP_440195.1_5 Forward -90 -71 7.27595 0.181
NP_440078.1_10 Forward -54 -35 2.65439 0.269
NP_441078.1_4 Reverse -75 -84 -1.27858 0.246
NP_442443.1_1 Reverse -67 -86 -5.80207 0.285
NP_440526.1_3 Reverse -170 -181 4.97473 0.261
NP_441432.1_8 Forward -172 -163 3.24465 0.252
NP_441432.1_8 Forward -178 -169 2.55633 0.298
NP_440313.1_5 Forward -332 -314 12.3097 0.235
NP_440713.1_4 Reverse -82 -101 1.47442 0.286
NP_442776.1_10 Forward -257 -238 18.2882 0.147
NP_442346.1_5 Reverse -74 -84 6.46988 0.201
NP_440545.1_3 Forward -88 -71 -6.05768 0.268
NP_441653.1_2 Forward -83 -64 2.56328 0.291
NP_441888.1_7 Reverse -40 -54 5.50613 0.225
NP_441888.1_7 Reverse -82 -96 1.67122 0.241
NP_440449.1_6 Reverse -132 -150 6.21331 0.255
NP_441329.1_6 Reverse -197 -216 0.142815 0.264
NP_440671.1_4 Reverse -112 -126 6.58777 0.243
NP_440772.1_6 Forward -281 -262 18.584 0.142
NP_442140.1_3 Forward -272 -262 3.71661 0.283
NP_442028.1_1 Forward -319 -306 6.55523 0.299
NP_440821.1_6 Forward -22 -4 22.4386 0.0438
NP_442193.1_1 Forward -72 -54 8.37728 0.272
NP_440573.1_3 Forward -136 -123 15.7225 0.227
NP_440212.1_9 Reverse -282 -301 4.88614 0.187
NP_440212.1_9 Reverse -280 -299 2.67563 0.243
NP_440212.1_9 Forward -301 -282 2.09897 0.252
NP_440546.1_4 Forward -72 -62 10.6277 0.109
NP_441509.1_2 Reverse -36 -54 7.68896 0.252
NP_440462.1_6 Forward -98 -88 2.43831 0.287
NP_442340.1_3 Reverse -170 -189 -7.4737 0.236
NP_440653.1_10 Forward -251 -232 2.75272 0.288
NP_442696.1_6 Reverse -164 -183 -10.7186 0.235
NP_441102.1_10 Forward -285 -266 7.66927 0.229
NP_442532.1_1 Reverse -305 -319 9.91926 0.262
NP_442533.1_6 Reverse -63 -72 3.14632 0.224
NP_439944.1_9 Forward -119 -109 6.37155 0.184
NP_441697.1_5 Forward -323 -304 -10.3613 0.278
NP_441028.1_6 Reverse -6 -16 5.19112 0.265
NP_441527.1_4 Reverse -219 -238 -11.8892 0.284
NP_442716.1_5 Forward -280 -261 20.8516 0.152
NP_440903.1_2 Forward -13 -3 16.303 0.247
NP_442249.1_5 Reverse -37 -56 13.2741 0.13
NP_442928.1_6 Forward -84 -71 16.4406 0.275
NP_442674.1_3 Forward -274 -255 4.12856 0.294
NP_441479.1_1 Forward -87 -68 9.0459 0.223
NP_439955.1_10 Reverse -268 -287 10.7167 0.299
NP_442072.1_9 Forward -128 -110 -16.2055 0.198
NP_442072.1_9 Forward -179 -161 -22.6953 0.253
NP_442072.1_9 Reverse -226 -244 -23.0886 0.277
NP_442072.1_9 Forward -85 -67 -23.3836 0.292
NP_442125.1_2 Forward -23 -4 8.06259 0.179
NP_440907.2_8 Reverse -170 -180 5.28945 0.209
NP_441463.1_3 Forward -94 -75 -4.13045 0.195
NP_442615.1_1 Forward -93 -75 0.412472 0.103
NP_441962.1_4 Forward -287 -268 -0.688862 0.117
NP_440387.1_1 Reverse -227 -243 -6.03799 0.262
NP_441431.1_7 Reverse -322 -341 15.5124 0.231
NP_440814.1_8 Reverse -212 -231 -1.47551 0.299
NP_441858.1_6 Forward -71 -52 16.9124 0.0751
NP_439988.1_3 Reverse -41 -55 4.42448 0.295
NP_441237.1_9 Reverse -46 -56 11.8781 0.153
NP_440457.1_1 Forward -76 -64 4.75886 0.154
NP_442509.1_9 Reverse -169 -179 7.15773 0.234
NP_442936.1_10 Reverse -286 -300 9.16816 0.269
NP_441173.1_9 Reverse -7 -15 9.75379 0.284
NP_442395.2_4 Reverse -272 -291 2.6536 0.22
NP_443000.1_7 Forward -151 -141 5.38824 0.134
NP_443010.1_7 Reverse -7 -26 10.0284 0.278
NP_441207.1_7 Reverse -251 -265 13.8056 0.201
NP_440216.1_1 Forward -84 -70 -11.8985 0.228
NP_442015.1_10 Reverse -71 -84 6.80412 0.106
NP_442015.1_10 Reverse -41 -54 2.08423 0.202
NP_442417.1_5 Forward -96 -82 5.60446 0.255
NP_440416.1_9 Forward -228 -209 -9.83364 0.135
NP_442154.1_1 Forward -193 -175 -17.9754 0.273
NP_440261.1_5 Reverse -170 -183 -11.5838 0.264
NP_440261.1_5 Forward -83 -70 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGATGTTCGGATTGATGAGCCCCTAACGGTTTATATGGAATATGAAGTTCAACAAAAAACACCAGGCACCCCCTATCCAAATTTTCACTTTTATGATGATAAAAATAATTGTGCTTTTGTGACTGCCGCTATGGTTGATATAAATTCTCCTCTAGAAGAGGGAGTTTATCGTGCCCTTTGTCATATCCCGGCCAATTTTTTGAACGACGGTGTTTACTCGGTGGGATTGGCTGTCACGTTTATGCACTCAGGCGTCCACGTCAGTTTTTATGATCAATCTGCTTTGGTTTTTAATGTGACTGACCCGATTGAAGGGGTGATAACCCGGGGCATGGGTTATGTAGGGCCGATACCAGGGGTTTTAAGGCCAGTACTTGACTGGAATGTGGAGAAAATTGC

CDS

ATGAAAGCTGTAATTCTTGCCGGTGGCTTGGGGACTAGAATTTCCGAAGAAACTCATCTTCGACCTAAGCCGATGATTGACATTGGCGGGCGACCCATTCTCTGGCACATCCTTAAACTCTATTCTGCCTACGGTGTAAATGATTTTATTATTTGCTGTGGTTATAAAGGCTATGTTATTAAGGAATATTTTGCCAATTATTTTCTACATATGTCCGATGTAACCTTTGACATGGTTTCCAATGAAATGATTGTCCATCAGAGAAAGGCAGAGCCATGGAAAGTGACCTTAGTGGATACCGGGGAAAATTCCCTTACAGGGGGAAGATTAAAGCGGATTAAAACTTTTATTGAAAATGACAATGCTTTTTGTTTTACCTATGGTGATGGTTTGGCAAATATTAATATTCAAGAATTAATTGCTTTTCATCAAAGTCATGGTAGGTTGGCTACGGTCACAGCAGTTGTGCCCCCCGGTCGATACGGCGCACTGAAATTAGAAAACTCTAAGGTTTTCGGGTTTACGGAAAAGCCTCCCGGTGATGGCGGTCTAATTAACGGCGGTTTCTTTGTTTTATCTCCCCGTTGCTTGGATTTTATTGGGGGGGATATGGATAGTTGGGAGGGTGAGCCCCTAACTGAATTGTCTGGTAAGGGGGAGTTGATGGCATTTGAGCATAGGGGTTTTTGGCAACCAATGGATACTTTACGGGATAAGAATCATCTAGAAGAGTTGTGGCAATCTGGTCAGGCTCCTTGGAAGGTATGGTAA

Protein

MKAVILAGGLGTRISEETHLRPKPMIDIGGRPILWHILKLYSAYGVNDFIICCGYKGYVIKEYFANYFLHMSDVTFDMVSNEMIVHQRKAEPWKVTLVDTGENSLTGGRLKRIKTFIENDNAFCFTYGDGLANINIQELIAFHQSHGRLATVTAVVPPGRYGALKLENSKVFGFTEKPPGDGGLINGGFFVLSPRCLDFIGGDMDSWEGEPLTELSGKGELMAFEHRGFWQPMDTLRDKNHLEELWQSGQAPWKVW