Your browser is old and dusty. Try Google Chrome!

Details for slr0981

ORF slr0981
Accession NP_440219.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_4 Forward -378 -364 17.1085 0.295
NP_440795.1_7 Forward -59 -52 14.6904 0.0123
NP_440795.1_7 Reverse -52 -59 14.6904 0.0123
NP_440795.1_7 Forward -369 -362 11.3472 0.0978
NP_440795.1_7 Reverse -362 -369 5.74231 0.279
NP_441418.1_6 Reverse -51 -70 -21.83 0.16
NP_441418.1_6 Forward -173 -154 -30.1882 0.262
NP_442291.1_5 Reverse -50 -66 -3.38305 0.239
NP_440897.1_6 Reverse -51 -70 4.62021 0.134
NP_440897.1_6 Forward -60 -41 1.47364 0.17
NP_440897.1_6 Forward -167 -148 0.883656 0.175
NP_441453.1_4 Reverse -51 -59 16.539 0.00633
NP_441453.1_4 Forward -60 -52 16.539 0.00633
NP_441453.1_4 Forward -370 -362 6.90259 0.121
NP_441453.1_4 Reverse -361 -369 6.70593 0.121
NP_442151.1_6 Forward -60 -46 17.8958 0.00866
NP_442151.1_6 Reverse -51 -65 12.4876 0.0722
NP_441818.1_1 Reverse -52 -63 16.7744 0.0118
NP_441818.1_1 Forward -369 -358 8.90795 0.271
NP_441818.1_9 Reverse -292 -311 -3.54046 0.227
NP_440226.1_1 Reverse -361 -380 13.6675 0.0352
NP_441630.1_3 Reverse -43 -62 10.5209 0.0907
NP_442655.1_2 Reverse -294 -313 1.37609 0.288
NP_442173.1_1 Forward -59 -51 15.4574 0.00633
NP_442173.1_1 Reverse -52 -60 15.4574 0.00633
NP_442173.1_1 Reverse -362 -370 7.49257 0.171
NP_442173.1_1 Forward -369 -361 5.82095 0.2
NP_442752.1_4 Forward -60 -53 13.8055 0.0199
NP_442752.1_4 Reverse -51 -58 13.8055 0.0199
NP_442752.1_4 Reverse -361 -368 10.8555 0.0846
NP_442752.1_4 Forward -370 -363 5.34899 0.221
NP_443027.1_4 Forward -372 -362 15.8113 0.0437
NP_443027.1_4 Reverse -359 -369 7.84651 0.228
NP_443027.1_4 Forward -62 -52 7.35486 0.24
NP_441812.1_3 Reverse -50 -64 10.3243 0.222
NP_442975.1_10 Forward -64 -50 12.5853 0.0477
NP_442975.1_10 Reverse -357 -371 9.14375 0.0771
NP_442975.1_10 Forward -374 -360 1.76896 0.291
NP_442975.1_10 Reverse -47 -61 1.37564 0.299
NP_440784.1_7 Forward -59 -52 15.9687 0.0123
NP_440784.1_7 Reverse -52 -59 15.9687 0.0123
NP_440784.1_7 Forward -369 -362 6.43063 0.218
NP_440784.1_7 Reverse -362 -369 6.23397 0.241
NP_442861.1_1 Reverse -117 -136 10.3242 0.295
NP_440061.1_9 Reverse -49 -63 13.9619 0.0735
NP_440061.1_9 Reverse -162 -176 7.47213 0.205
NP_440061.1_9 Forward -321 -307 6.98048 0.223
NP_440110.1_4 Reverse -40 -59 1.17943 0.294
NP_440631.1_9 Reverse -119 -138 18.4959 0.262
NP_442062.1_3 Forward -46 -27 8.35759 0.153
NP_442062.1_8 Reverse -51 -61 17.6796 0.00193
NP_442062.1_8 Forward -60 -50 17.3846 0.00193
NP_442062.1_8 Forward -370 -360 4.50326 0.212
NP_440304.1_4 Forward -62 -52 18.9579 0.00406
NP_440304.1_4 Reverse -359 -369 10.4031 0.051
NP_440304.1_4 Reverse -49 -59 1.84832 0.299
NP_442242.1_4 Forward -59 -52 14.3954 0.0124
NP_442242.1_4 Reverse -52 -59 14.3954 0.0124
NP_440044.1_8 Forward -59 -40 15.6341 0.025
NP_442181.1_1 Reverse -156 -175 13.0775 0.174
NP_439918.1_2 Reverse -292 -311 -5.11376 0.298
NP_439918.1_3 Reverse -48 -67 4.22769 0.264
NP_439923.1_5 Reverse -303 -322 10.3242 0.161
NP_441594.1_6 Forward -170 -151 5.70265 0.209
NP_440856.1_7 Forward -220 -201 3.73603 0.153
NP_441083.1_3 Forward -174 -164 11.9759 0.296
NP_441083.1_5 Forward -60 -50 20.3345 0.00053
NP_441083.1_5 Reverse -51 -61 19.3512 0.000718
NP_441083.1_5 Reverse -361 -371 -0.806614 0.28
NP_441738.1_2 Forward -58 -51 15.28 0.0102
NP_441738.1_2 Reverse -53 -60 15.28 0.0102
NP_441738.1_2 Reverse -363 -370 8.00357 0.235
NP_441558.1_5 Forward -62 -43 3.73603 0.299
NP_440209.1_1 Reverse -51 -59 18.1123 0.00295
NP_440209.1_1 Forward -60 -52 18.1123 0.00295
NP_440209.1_1 Reverse -361 -369 8.27922 0.0687
NP_442889.1_8 Forward -63 -49 11.4053 0.0733
NP_441713.1_1 Reverse -355 -374 -4.6221 0.113
NP_440178.1_7 Reverse -50 -69 -12.4886 0.121
NP_440178.1_7 Forward -61 -42 -21.4367 0.223
NP_442570.1_3 Reverse -150 -169 -4.81876 0.235
NP_442570.1_3 Forward -392 -373 -8.06369 0.279
NP_441716.1_1 Reverse -51 -65 20.6491 0.00829
NP_441327.1_1 Reverse -26 -45 3.54061 0.277
NP_442111.1_4 Reverse -50 -64 8.55439 0.0729
NP_440906.1_5 Forward -59 -52 15.8704 0.0124
NP_440906.1_5 Reverse -52 -59 15.8704 0.0124
NP_440906.1_5 Forward -369 -362 12.6255 0.0384
NP_440906.1_5 Reverse -362 -369 6.0373 0.262
NP_440747.1_10 Reverse -48 -60 14.887 0.00223
NP_440747.1_10 Forward -63 -51 -1.92764 0.0192
NP_440747.1_10 Forward -176 -164 -11.8591 0.161
NP_441486.1_1 Forward -63 -49 14.4542 0.00637
NP_441486.1_1 Reverse -48 -62 12.8809 0.00979
NP_441486.1_1 Reverse -358 -372 -5.21195 0.226
NP_442634.1_4 Reverse -359 -373 -1.5737 0.149
NP_441265.1_3 Forward -66 -52 3.24451 0.181
NP_442848.1_9 Reverse -159 -178 5.11266 0.202
NP_443018.1_3 Forward -59 -52 14.8871 0.0123
NP_443018.1_3 Reverse -52 -59 14.8871 0.0123
NP_443018.1_3 Forward -369 -362 5.15232 0.226
NP_443018.1_3 Reverse -362 -369 5.05399 0.238
NP_441634.1_8 Forward -175 -161 -2.55701 0.295
NP_441634.1_8 Reverse -49 -63 -4.03198 0.295
NP_440376.1_1 Forward -60 -51 19.4693 0.000692
NP_440376.1_1 Reverse -51 -60 19.4693 0.000692
NP_440376.1_1 Forward -370 -361 7.17789 0.0829
NP_440376.1_1 Reverse -158 -167 2.26134 0.228
NP_440376.1_1 Reverse -361 -370 -0.196935 0.285
NP_441857.1_5 Reverse -44 -62 4.83737 0.221
NP_441588.1_4 Forward -58 -48 15.9097 0.0369
NP_442687.1_7 Forward -61 -51 18.5646 0.0028
NP_442687.1_7 Reverse -50 -60 8.92815 0.0994
NP_441077.1_6 Forward -42 -26 1.74139 0.298
NP_440642.1_10 Forward -87 -73 6.88214 0.225
NP_440642.1_10 Reverse -42 -56 5.21053 0.241
NP_440642.1_10 Reverse -364 -378 1.47397 0.293
NP_441422.1_7 Reverse -150 -167 -2.81276 0.223
NP_442296.1_5 Forward -69 -50 4.12936 0.251
NP_442720.1_9 Forward -178 -159 17.6007 0.0914
NP_442658.1_1 Forward -62 -52 14.8275 0.0188
NP_442658.1_1 Reverse -359 -369 8.82935 0.177
NP_442658.1_1 Reverse -49 -59 6.76441 0.214
NP_440141.1_8 Forward -69 -50 4.42435 0.289
NP_442782.1_2 Reverse -361 -375 3.44117 0.265
NP_442205.1_9 Forward -376 -360 13.1366 0.0554
NP_442205.1_9 Forward -66 -50 -2.79306 0.272
NP_441414.1_9 Forward -60 -41 5.89931 0.0437
NP_441414.1_9 Forward -268 -249 4.12936 0.0552
NP_441414.1_9 Reverse -51 -70 -4.72043 0.161
NP_442937.1_5 Reverse -46 -65 9.0459 0.204
NP_441958.1_5 Forward -61 -51 20.5312 0.000966
NP_441958.1_5 Reverse -50 -60 12.2714 0.00183
NP_441958.1_5 Reverse -360 -370 10.1081 0.0166
NP_441958.1_5 Forward -371 -361 1.74999 0.0765
NP_440984.1_7 Reverse -46 -60 17.3058 0.0267
NP_442690.1_1 Forward -45 -26 -11.0136 0.221
NP_442690.1_1 Reverse -20 -39 -13.5702 0.264
NP_442911.1_2 Forward -70 -51 -2.16383 0.0946
NP_442911.1_2 Reverse -41 -60 -2.16383 0.0946
NP_442911.1_2 Forward -380 -361 -3.14714 0.109
NP_441580.1_6 Forward -311 -292 -8.26035 0.254
NP_442064.1_4 Forward -335 -316 9.53674 0.204
NP_442002.1_9 Forward -61 -54 14.1004 0.074
NP_440809.1_9 Forward -69 -51 1.88744 0.118
NP_440809.1_9 Forward -379 -361 -6.66736 0.225
NP_441294.1_7 Forward -64 -50 16.0658 0.0176
NP_441646.1_1 Reverse -157 -176 6.29264 0.173
NP_441646.1_1 Forward -174 -155 3.14605 0.208
NP_442438.1_10 Forward -375 -361 3.24451 0.165
NP_441000.1_6 Forward -61 -47 -4.22864 0.231
NP_441000.1_6 Reverse -50 -64 -5.50694 0.279
NP_440147.1_4 Reverse -49 -62 11.6223 0.0326
NP_440147.1_4 Forward -62 -49 4.05085 0.173
NP_440147.1_4 Reverse -119 -132 2.18257 0.209
NP_441550.1_8 Forward -62 -52 15.4175 0.0132
NP_441550.1_8 Reverse -49 -59 14.6309 0.0132
NP_441916.1_7 Reverse -51 -61 16.893 0.00407
NP_441916.1_7 Forward -60 -50 10.3048 0.0261
NP_441916.1_7 Forward -370 -360 9.91146 0.03
NP_441916.1_7 Reverse -361 -371 7.05986 0.0779
NP_440206.1_4 Reverse -362 -381 -0.984623 0.29
NP_440206.1_9 Forward -85 -66 7.7676 0.288
NP_441041.1_4 Forward -370 -351 -10.227 0.228
NP_441041.1_4 Reverse -51 -70 -10.227 0.228
NP_441041.1_7 Forward -164 -152 6.64018 0.2
NP_441041.1_7 Reverse -358 -370 5.18252 0.272
NP_441041.1_7 Forward -133 -121 5.18252 0.272
NP_442396.1_5 Reverse -47 -60 12.2123 0.0913
NP_442004.1_6 Reverse -361 -375 16.5192 0.0577
NP_442004.1_6 Reverse -51 -65 3.14618 0.248
NP_441725.1_5 Reverse -52 -62 21.0229 0.00533
NP_441725.1_5 Forward -59 -49 2.04498 0.115
NP_441725.1_5 Forward -369 -359 1.455 0.135
NP_439966.1_7 Reverse -359 -369 12.2709 0.0464
NP_439966.1_7 Forward -62 -52 9.12434 0.119
NP_439966.1_7 Reverse -49 -59 7.25606 0.15
NP_442941.1_3 Forward -369 -359 17.6796 0.00404
NP_442941.1_3 Reverse -52 -62 11.3864 0.0116
NP_442941.1_3 Forward -59 -49 11.0914 0.0116
NP_442941.1_3 Reverse -362 -372 7.84651 0.0564
NP_440289.1_2 Forward -63 -50 13.1956 0.0132
NP_440289.1_2 Reverse -48 -61 -2.144 0.251
NP_440260.1_8 Reverse -155 -173 -4.40575 0.272
NP_442281.1_1 Reverse -46 -60 9.24208 0.0726
NP_442281.1_1 Forward -65 -51 4.03056 0.21
NP_442281.1_1 Reverse -356 -370 1.86729 0.285
NP_442256.1_2 Reverse -49 -67 0.904127 0.115
NP_442256.1_2 Forward -62 -44 -7.749 0.215
NP_440437.1_1 Forward -376 -357 -5.40875 0.282
NP_442012.1_1 Forward -244 -225 3.14605 0.186
NP_440723.1_8 Reverse -164 -178 9.93102 0.286
NP_441556.1_10 Forward -172 -158 11.0978 0.242
NP_441644.1_6 Forward -60 -50 17.3841 0.00127
NP_441644.1_6 Reverse -51 -61 15.7125 0.0048
NP_441644.1_6 Forward -370 -360 6.96107 0.141
NP_442215.1_2 Reverse -49 -65 -1.51476 0.186
NP_442215.1_2 Reverse -162 -178 -6.33298 0.268
NP_442029.1_6 Reverse -46 -65 3.93269 0.274
NP_442247.1_8 Reverse -359 -373 8.45605 0.272
NP_442247.1_8 Reverse -49 -63 8.45605 0.272
NP_440253.1_2 Forward -60 -42 -2.43913 0.268
NP_440929.1_8 Forward -60 -51 19.2726 0.000701
NP_440929.1_8 Reverse -51 -60 19.2726 0.000701
NP_442933.1_10 Forward -60 -51 17.601 0.00325
NP_442933.1_10 Reverse -51 -60 17.601 0.00325
NP_442933.1_10 Forward -370 -361 7.96454 0.0937
NP_442933.1_10 Reverse -361 -370 7.76787 0.11
NP_441751.2_8 Reverse -52 -66 -4.03198 0.158
NP_441751.2_8 Forward -369 -355 -5.70361 0.231
NP_442554.1_8 Forward -59 -49 15.3197 0.00882
NP_442554.1_8 Reverse -52 -62 14.828 0.0108
NP_442554.1_8 Forward -369 -359 7.55152 0.0893
NP_441762.1_7 Forward -61 -49 8.9871 0.0142
NP_441762.1_7 Forward -271 -259 -6.45087 0.284
NP_441762.1_7 Reverse -50 -62 -6.94252 0.284
NP_442142.1_4 Forward -63 -50 6.0169 0.175
NP_442142.1_4 Reverse -358 -371 2.87033 0.273
NP_442292.1_1 Forward -59 -50 18.486 0.00229
NP_442292.1_1 Reverse -52 -61 9.53783 0.0183
NP_442292.1_1 Forward -369 -360 8.1612 0.0478
NP_442476.1_6 Forward -59 -45 4.12949 0.149
NP_442381.1_8 Forward -303 -284 -14.4552 0.28
NP_443009.1_5 Reverse -50 -61 15.7911 0.0107
NP_443009.1_5 Reverse -360 -371 13.3328 0.0346
NP_443009.1_5 Forward -61 -50 11.1696 0.066
NP_443009.1_5 Forward -371 -360 9.89126 0.0866
NP_443009.1_5 Forward -236 -225 4.77807 0.23
NP_442408.2_1 Reverse -51 -70 -7.37537 0.299
NP_441715.1_4 Forward -59 -49 7.94484 0.107
NP_441715.1_4 Reverse -52 -62 7.25653 0.108
NP_441715.1_4 Forward -369 -359 5.09324 0.233
NP_441715.1_4 Reverse -362 -372 4.40493 0.281
NP_440357.1_3 Forward -327 -308 4.71934 0.242
NP_441198.1_8 Reverse -359 -369 13.076 0.108
NP_441198.1_8 Forward -372 -362 13.076 0.108
NP_441198.1_8 Forward -62 -52 13.076 0.108
NP_440464.1_10 Forward -59 -49 13.0082 0.169
NP_441758.1_10 Reverse -16 -35 2.16195 0.189
NP_441468.1_1 Forward -59 -52 15.8704 0.0124
NP_441468.1_1 Reverse -52 -59 15.8704 0.0124
NP_441468.1_1 Forward -369 -362 12.3305 0.0592
NP_441468.1_1 Reverse -362 -369 6.0373 0.223
NP_441015.1_10 Forward -172 -153 -4.91709 0.214
NP_441015.1_10 Reverse -159 -178 -5.50708 0.226
NP_441673.1_1 Forward -60 -51 20.8459 0.000698
NP_441673.1_1 Reverse -51 -60 20.8459 0.000698
NP_441673.1_1 Forward -370 -361 1.37636 0.114
NP_441673.1_1 Reverse -361 -370 1.1797 0.163
NP_441673.1_1 Forward -173 -164 -7.86675 0.187
NP_441673.1_1 Reverse -164 -173 -7.96508 0.206
NP_441764.1_1 Reverse -19 -38 9.63589 0.224
NP_442868.1_6 Reverse -49 -59 9.81313 0.038
NP_442868.1_6 Forward -62 -52 9.22315 0.0527
NP_442719.1_2 Forward -140 -122 -8.53634 0.251
NP_441612.1_2 Forward -60 -50 8.54929 0.21
NP_442427.1_8 Reverse -42 -61 8.45592 0.203
NP_442808.1_1 Forward -61 -51 8.73102 0.0481
NP_442808.1_1 Reverse -50 -60 8.63269 0.0481
NP_442808.1_1 Reverse -151 -161 7.15773 0.086
NP_442542.1_2 Forward -294 -281 7.6891 0.173
NP_442050.1_5 Forward -62 -52 15.8108 0.0091
NP_442050.1_5 Reverse -359 -369 15.1225 0.0138
NP_442050.1_5 Forward -372 -362 7.74772 0.243
NP_442050.1_5 Reverse -49 -59 7.64939 0.243
NP_440385.1_6 Reverse -19 -38 10.8379 0.299
NP_442593.1_2 Reverse -159 -178 16.8141 0.257
NP_441878.1_6 Forward -61 -51 20.2362 0.0046
NP_441878.1_6 Reverse -50 -60 10.4031 0.0176
NP_441878.1_6 Forward -174 -164 1.25834 0.108
NP_441878.1_6 Reverse -163 -173 -0.708283 0.179
NP_441036.1_8 Forward -371 -361 14.6313 0.0205
NP_441036.1_8 Forward -61 -51 8.4365 0.174
NP_441036.1_8 Reverse -50 -60 8.33817 0.174
NP_441557.1_4 Reverse -127 -141 8.45605 0.299
NP_441557.1_5 Forward -60 -51 19.9609 0.000699
NP_441557.1_5 Reverse -51 -60 19.9609 0.000699
NP_441557.1_5 Reverse -361 -370 8.84951 0.0343
NP_441557.1_5 Forward -370 -361 0.786375 0.106
NP_441557.1_8 Forward -312 -302 15.1225 0.183
NP_441445.1_1 Forward -69 -50 19.764 0.0276
NP_441308.1_8 Reverse -359 -369 16.893 0.218
NP_442183.1_1 Reverse -51 -65 7.07942 0.149
NP_442183.1_1 Forward -370 -356 5.50613 0.215
NP_442347.1_2 Forward -59 -50 12.4878 0.056
NP_442347.1_2 Reverse -52 -61 3.34298 0.284
NP_442645.1_2 Reverse -191 -210 -18.9784 0.282
NP_442645.1_2 Forward -181 -162 -21.24 0.29
NP_442645.1_2 Forward -205 -186 -21.6334 0.29
NP_441037.1_4 Forward -62 -52 9.65667 0.21
NP_441037.1_4 Reverse -49 -59 7.9999 0.237
NP_441633.1_3 Reverse -49 -62 10.5407 0.0286
NP_440136.1_2 Forward -59 -52 15.9687 0.0123
NP_440136.1_2 Reverse -52 -59 15.9687 0.0123
NP_440136.1_2 Forward -369 -362 13.7071 0.0244
NP_440136.1_2 Reverse -362 -369 6.13563 0.193
NP_442998.1_5 Reverse -130 -140 14.7297 0.149
NP_442998.1_10 Forward -58 -51 15.5754 0.0102
NP_442998.1_10 Reverse -53 -60 15.5754 0.0102
NP_442998.1_10 Forward -128 -121 9.28223 0.117
NP_442998.1_10 Forward -368 -361 6.0373 0.205
NP_440899.1_8 Forward -352 -333 -7.96535 0.246
NP_440299.1_1 Reverse -47 -60 13.0967 0.0319
NP_440299.1_1 Forward -64 -51 7.09854 0.121
NP_441799.1_1 Forward -64 -50 14.7486 0.0222
NP_441799.1_1 Reverse -47 -61 6.98048 0.155
NP_441799.1_1 Forward -374 -360 6.88214 0.158
NP_441799.1_9 Reverse -50 -69 -3.44213 0.233
NP_441007.1_10 Reverse -46 -59 -0.865694 0.295
NP_442201.1_10 Reverse -40 -59 4.22769 0.0949
NP_442201.1_10 Forward -178 -159 -7.86702 0.205
NP_440256.1_1 Reverse -358 -377 2.55606 0.0625
NP_440256.1_1 Reverse -48 -67 -4.72043 0.164
NP_440256.1_1 Forward -373 -354 -5.99873 0.198
NP_441559.1_8 Forward -65 -51 -6.58858 0.279
NP_441559.1_8 Forward -134 -120 -7.08024 0.283
NP_440525.1_1 Forward -38 -19 8.94757 0.265
NP_440915.1_6 Reverse -47 -61 1.67122 0.132
NP_440915.1_6 Forward -165 -151 -0.393733 0.193
NP_440915.1_6 Forward -374 -360 -2.26202 0.265
NP_441296.1_9 Reverse -362 -375 9.06515 0.286
NP_441704.1_8 Forward -71 -52 9.7334 0.173
NP_440748.1_5 Reverse -357 -376 -0.590531 0.26
NP_441464.1_8 Reverse -51 -65 10.6193 0.178
NP_442993.1_1 Reverse -51 -67 -8.10294 0.153
NP_442993.1_1 Forward -370 -354 -10.4629 0.22
NP_442386.1_9 Reverse -50 -59 13.8639 0.0289
NP_442386.1_9 Reverse -151 -160 12.2907 0.0676
NP_442386.1_9 Forward -61 -52 6.39082 0.219
NP_442386.1_9 Forward -371 -362 5.80084 0.237
NP_441340.1_5 Forward -59 -52 15.6737 0.0124
NP_441340.1_5 Reverse -52 -59 15.6737 0.0124
NP_441340.1_5 Forward -369 -362 5.93897 0.198
NP_441340.1_5 Reverse -362 -369 5.84064 0.208
NP_441947.1_4 Forward -71 -52 12.0942 0.236
NP_440327.1_6 Reverse -40 -59 11.5042 0.182
NP_440251.1_4 Forward -100 -83 19.0167 0.0897
NP_442240.1_1 Reverse -149 -168 9.63507 0.216
NP_440161.1_3 Forward -132 -113 7.7676 0.287
NP_440586.1_8 Forward -59 -52 13.2151 0.026
NP_440586.1_8 Reverse -52 -59 13.2151 0.026
NP_442251.1_6 Forward -59 -52 15.2804 0.0124
NP_442251.1_6 Reverse -52 -59 15.2804 0.0124
NP_442251.1_6 Forward -129 -122 6.43063 0.298
NP_441262.1_3 Reverse -51 -58 14.7888 0.0223
NP_441262.1_3 Forward -60 -53 14.7888 0.0223
NP_440027.1_3 Reverse -158 -176 4.24662 0.262
NP_443051.1_1 Forward -61 -52 18.0926 0.00402
NP_443051.1_1 Reverse -50 -59 10.4228 0.00754
NP_443051.1_1 Reverse -360 -369 9.73449 0.0265
NP_443051.1_1 Forward -371 -362 0.491382 0.151
NP_439984.1_2 Forward -176 -163 12.704 0.252
NP_439937.1_8 Forward -172 -153 -5.11376 0.286
NP_439937.1_9 Reverse -50 -67 -5.17337 0.157
NP_439937.1_9 Forward -61 -44 -14.7114 0.287
NP_440439.1_1 Forward -373 -360 9.45906 0.0462
NP_440439.1_1 Forward -63 -50 2.47756 0.133
NP_440439.1_1 Reverse -358 -371 -0.37404 0.215
NP_440372.1_2 Forward -59 -52 16.3621 0.0124
NP_440372.1_2 Reverse -52 -59 16.3621 0.0124
NP_440372.1_2 Forward -369 -362 6.62729 0.151
NP_440372.1_2 Reverse -362 -369 6.52896 0.188
NP_442783.1_10 Forward -233 -223 17.4824 0.149
NP_442384.1_10 Reverse -51 -64 10.639 0.0428
NP_442384.1_10 Forward -60 -47 8.77074 0.0608
NP_442384.1_10 Reverse -361 -374 4.24752 0.163
NP_441877.1_9 Reverse -343 -360 3.38209 0.284
NP_441018.1_7 Reverse -300 -319 13.9625 0.131
NP_440399.1_1 Reverse -286 -305 6.39097 0.3
NP_442262.1_10 Forward -59 -52 14.1988 0.0123
NP_442262.1_10 Reverse -52 -59 14.1988 0.0123
NP_441689.1_5 Forward -372 -362 17.8758 0.0158
NP_441689.1_5 Reverse -359 -369 15.3192 0.0403
NP_441689.1_5 Forward -62 -52 8.63269 0.132
NP_441689.1_5 Reverse -49 -59 5.78111 0.197
NP_440344.1_10 Forward -67 -50 8.20031 0.0113
NP_440344.1_10 Reverse -157 -174 -10.0892 0.166
NP_440344.1_10 Reverse -354 -371 -10.8759 0.194
NP_440282.1_10 Reverse -154 -173 -2.55715 0.232
NP_440531.1_6 Forward -68 -49 7.07928 0.102
NP_442910.1_1 Reverse -44 -63 -5.40875 0.254
NP_441965.1_3 Reverse -41 -60 -0.885524 0.273
NP_441965.1_10 Reverse -358 -374 2.22182 0.289
NP_440297.1_9 Reverse -52 -62 19.0562 0.0359
NP_440297.1_9 Forward -59 -49 -0.118297 0.282
NP_440297.1_9 Forward -369 -359 -0.511621 0.289
NP_442280.1_10 Reverse -41 -59 5.55182 0.283
NP_441592.1_10 Forward -306 -292 12.2903 0.298
NP_442129.1_6 Reverse -124 -143 13.0738 0.29
NP_440834.1_2 Reverse -36 -55 11.995 0.275
NP_440888.1_2 Forward -60 -46 10.717 0.0861
NP_440888.1_2 Forward -370 -356 10.0287 0.107
NP_440888.1_2 Reverse -361 -375 9.93039 0.11
NP_440888.1_2 Reverse -51 -65 7.3738 0.198
NP_440888.1_2 Reverse -164 -178 5.70218 0.267
NP_440052.1_5 Reverse -40 -59 -3.44213 0.235
NP_442033.1_10 Forward -173 -154 -1.08219 0.132
NP_441543.1_2 Forward -59 -50 16.9127 0.00359
NP_441543.1_2 Reverse -52 -61 9.34117 0.0818
NP_441543.1_2 Forward -369 -360 6.19458 0.153
NP_442845.1_2 Forward -167 -153 12.586 0.107
NP_442845.1_2 Reverse -45 -59 12.291 0.114
NP_442845.1_2 Forward -376 -362 9.2427 0.178
NP_442845.1_2 Reverse -355 -369 6.78443 0.202
NP_440739.1_1 Reverse -183 -202 8.94757 0.284
NP_441469.1_8 Forward -61 -52 13.3727 0.073
NP_441469.1_8 Reverse -50 -59 6.48957 0.227
NP_441469.1_8 Reverse -360 -369 6.39124 0.227
NP_443064.1_6 Reverse -51 -61 13.8273 0.0796
NP_443064.1_6 Forward -60 -50 12.5669 0.0796
NP_443064.1_6 Reverse -361 -371 8.78555 0.271
NP_442578.1_7 Forward -59 -52 14.5921 0.026
NP_442578.1_7 Reverse -52 -59 14.5921 0.026
NP_442578.1_7 Reverse -362 -369 5.15232 0.291
NP_441462.1_2 Reverse -51 -61 20.1379 0.000967
NP_441462.1_2 Forward -60 -50 11.5831 0.00406
NP_441462.1_2 Reverse -361 -371 9.41981 0.021
NP_441462.1_2 Forward -370 -360 0.766681 0.125
NP_441462.1_4 Reverse -159 -178 7.37428 0.0975
NP_441621.1_7 Reverse -150 -164 -4.03198 0.203
NP_440519.1_8 Reverse -292 -308 4.97508 0.21
NP_441560.1_10 Forward -68 -49 6.98095 0.287
NP_440516.1_8 Forward -60 -51 16.9127 0.00442
NP_440516.1_8 Reverse -51 -60 16.9127 0.00442
NP_440516.1_8 Reverse -361 -370 -0.393597 0.255
NP_440516.1_8 Forward -161 -152 -0.68859 0.297
NP_441033.1_2 Reverse -41 -60 -7.37537 0.293
NP_442428.1_5 Forward -59 -52 15.8704 0.0124
NP_442428.1_5 Reverse -52 -59 15.8704 0.0124
NP_442428.1_5 Reverse -362 -369 12.3305 0.0493
NP_442428.1_5 Forward -369 -362 6.3323 0.193
NP_441353.1_7 Reverse -357 -375 21.5528 0.0435
NP_442859.1_2 Reverse -362 -381 6.68596 0.199
NP_440673.1_3 Forward -58 -51 12.4288 0.0426
NP_440673.1_3 Reverse -53 -60 12.4288 0.0426
NP_441052.1_2 Forward -60 -50 19.9412 0.00106
NP_441052.1_2 Reverse -51 -61 10.4031 0.0285
NP_442219.1_8 Forward -64 -45 9.13344 0.234
NP_442219.1_9 Forward -59 -50 17.7976 0.00718
NP_442219.1_9 Reverse -52 -61 8.25953 0.0681
NP_442219.1_9 Reverse -362 -371 5.99792 0.0904
NP_440436.1_4 Forward -59 -50 17.2072 0.00233
NP_440436.1_4 Reverse -52 -61 15.9289 0.00508
NP_440436.1_4 Reverse -362 -371 5.0142 0.227
NP_442864.1_3 Reverse -45 -64 19.764 0.0777
NP_440314.1_9 Forward -59 -40 -9.14533 0.26
NP_441719.1_2 Reverse -30 -44 14.9822 0.278
NP_441719.1_4 Forward -59 -52 16.3621 0.0124
NP_441719.1_4 Reverse -52 -59 16.3621 0.0124
NP_441719.1_4 Forward -369 -362 6.62729 0.151
NP_441719.1_4 Reverse -362 -369 6.52896 0.188
NP_441733.1_10 Forward -164 -151 13.4906 0.0945
NP_441733.1_10 Reverse -48 -61 5.32916 0.218
NP_441004.1_1 Reverse -310 -329 -14.8485 0.271
NP_442366.1_3 Forward -61 -43 1.39578 0.151
NP_442366.1_5 Reverse -48 -58 15.4175 0.0374
NP_443054.1_2 Forward -62 -48 3.44117 0.24
NP_442308.1_8 Reverse -158 -177 9.3409 0.232
NP_441851.1_10 Forward -61 -51 17.4829 0.0027
NP_441851.1_10 Reverse -50 -60 15.8113 0.00552
NP_441851.1_10 Reverse -360 -370 7.84651 0.13
NP_442622.1_8 Reverse -51 -69 -8.92897 0.138
NP_441668.1_4 Reverse -41 -60 5.01433 0.173
NP_442515.1_1 Reverse -50 -64 19.3708 0.0192
NP_442515.1_1 Forward -61 -47 11.996 0.0362
NP_440593.1_3 Forward -178 -159 -0.39387 0.203
NP_441349.1_10 Reverse -41 -60 19.8623 0.00739
NP_441349.1_10 Forward -70 -51 1.67108 0.0817
NP_441349.1_10 Forward -183 -164 -9.53865 0.294
NP_441409.1_6 Forward -66 -47 -6.58872 0.13
NP_440432.1_9 Forward -59 -44 -2.38005 0.17
NP_440432.1_9 Forward -369 -354 -3.36336 0.179
NP_441124.1_5 Reverse -130 -140 13.0082 0.215
NP_442450.1_5 Forward -62 -52 19.1546 0.0103
NP_442450.1_5 Reverse -359 -369 7.64985 0.13
NP_442450.1_5 Reverse -49 -59 7.55152 0.13
NP_440588.1_2 Reverse -42 -61 6.39097 0.0574
NP_440195.1_5 Forward -66 -47 2.16274 0.276
NP_441570.1_1 Reverse -51 -69 2.57575 0.0243
NP_441570.1_1 Forward -217 -199 -10.7973 0.18
NP_441570.1_1 Reverse -361 -379 -16.8938 0.257
NP_441570.1_1 Forward -167 -149 -16.8938 0.257
NP_441570.1_1 Reverse -289 -307 -17.8771 0.295
NP_441078.1_4 Forward -60 -51 19.6659 0.0007
NP_441078.1_4 Reverse -51 -60 19.6659 0.0007
NP_441078.1_4 Reverse -361 -370 7.27622 0.0764
NP_441078.1_4 Forward -370 -361 0.196389 0.205
NP_441078.1_4 Forward -173 -164 -1.57357 0.266
NP_442348.1_2 Forward -391 -382 13.8644 0.175
NP_440526.1_3 Reverse -52 -63 1.53316 0.267
NP_440526.1_3 Forward -59 -48 1.04151 0.267
NP_441432.1_8 Reverse -50 -59 16.8143 0.00595
NP_441432.1_8 Forward -61 -52 8.35786 0.0755
NP_441432.1_8 Reverse -360 -369 7.17789 0.102
NP_442320.1_8 Reverse -45 -59 13.4709 0.0144
NP_442320.1_8 Reverse -355 -369 -3.54032 0.124
NP_442320.1_9 Reverse -300 -314 12.6843 0.249
NP_441732.1_2 Forward -64 -48 -7.61128 0.0861
NP_441732.1_2 Reverse -47 -63 -16.4611 0.167
NP_441732.1_2 Reverse -160 -176 -17.0511 0.231
NP_442797.1_7 Reverse -151 -169 0.117479 0.278
NP_440199.1_10 Forward -63 -53 6.46988 0.299
NP_442353.1_4 Reverse -158 -177 -1.08295 0.298
NP_441072.1_2 Forward -177 -158 13.4708 0.163
NP_440713.1_4 Forward -70 -51 4.32602 0.231
NP_442489.1_7 Forward -60 -51 20.1576 0.000695
NP_442489.1_7 Reverse -51 -60 20.1576 0.000695
NP_442489.1_7 Forward -370 -361 0.688044 0.152
NP_442489.1_7 Reverse -361 -370 0.491382 0.178
NP_442489.1_7 Forward -173 -164 -1.08191 0.179
NP_442079.1_7 Reverse -52 -71 5.60432 0.172
NP_440559.1_1 Forward -59 -50 17.4043 0.00658
NP_440559.1_1 Reverse -52 -61 17.306 0.00658
NP_441659.2_8 Reverse -51 -61 19.3512 0.000966
NP_441659.2_8 Forward -60 -50 18.1713 0.00133
NP_441659.2_8 Forward -370 -360 8.92815 0.0381
NP_441659.2_8 Reverse -361 -371 1.455 0.24
NP_442913.1_10 Forward -69 -50 -0.197208 0.157
NP_440779.1_5 Reverse -51 -68 -14.4158 0.246
NP_442346.1_5 Forward -61 -51 17.9746 0.00128
NP_442346.1_5 Reverse -50 -60 16.6963 0.00248
NP_442346.1_5 Reverse -360 -370 6.17489 0.212
NP_442346.1_5 Forward -371 -361 4.50326 0.286
NP_440352.1_5 Forward -272 -253 14.2131 0.16
NP_440545.1_3 Reverse -47 -64 2.30045 0.103
NP_440545.1_3 Forward -170 -153 -5.36936 0.247
NP_441786.1_10 Forward -69 -50 5.70265 0.291
NP_440459.1_2 Forward -182 -165 10.0686 0.21
NP_441653.1_2 Reverse -209 -228 3.62625 0.264
NP_441943.1_8 Forward -88 -69 -3.63879 0.183
NP_442603.1_7 Reverse -51 -65 10.2254 0.132
NP_440449.1_6 Reverse -299 -317 10.6874 0.149
NP_441948.1_4 Forward -67 -49 7.39397 0.0623
NP_442070.1_1 Reverse -288 -307 26.5488 0.00426
NP_441833.1_4 Forward -59 -52 15.9687 0.0124
NP_441833.1_4 Reverse -52 -59 15.9687 0.0124
NP_441833.1_4 Forward -369 -362 6.43063 0.125
NP_441833.1_4 Reverse -362 -369 6.13563 0.198
NP_441329.1_3 Forward -386 -376 12.0145 0.273
NP_442162.1_9 Forward -59 -52 16.2637 0.0124
NP_442162.1_9 Reverse -52 -59 16.2637 0.0124
NP_442162.1_9 Forward -369 -362 6.52896 0.178
NP_442162.1_9 Reverse -362 -369 6.43063 0.208
NP_440224.1_1 Reverse -350 -369 -1.08219 0.157
NP_440204.1_5 Reverse -26 -45 14.5603 0.23
NP_442199.1_5 Forward -68 -49 -3.83545 0.214
NP_442199.1_5 Reverse -320 -339 -6.78538 0.281
NP_442140.1_3 Forward -59 -49 12.2714 0.0632
NP_442140.1_3 Reverse -52 -62 5.68323 0.198
NP_442021.1_6 Reverse -288 -307 5.70265 0.268
NP_441813.1_5 Forward -62 -52 16.1063 0.01
NP_441813.1_5 Reverse -49 -59 8.63316 0.0367
NP_441813.1_5 Reverse -359 -369 6.07655 0.104
NP_441813.1_5 Forward -372 -362 5.38824 0.13
NP_440590.1_4 Forward -59 -46 7.78743 0.0494
NP_440590.1_4 Reverse -52 -65 -3.52063 0.255
NP_440590.1_4 Forward -369 -356 -5.09393 0.274
NP_440567.1_1 Reverse -362 -376 8.94771 0.0517
NP_440567.1_1 Forward -59 -45 6.88276 0.08
NP_440567.1_1 Reverse -52 -66 0.0979218 0.256
NP_442497.1_10 Reverse -52 -61 19.8626 0.00532
NP_442497.1_10 Forward -59 -50 10.4228 0.0087
NP_442497.1_10 Forward -369 -360 7.86621 0.0695
NP_442497.1_10 Reverse -362 -371 5.89959 0.109
NP_440821.1_4 Forward -62 -52 19.8429 0.00399
NP_440821.1_4 Reverse -49 -59 9.41981 0.0286
NP_440821.1_4 Reverse -359 -369 1.25834 0.139
NP_440821.1_4 Forward -372 -362 -0.806614 0.296
NP_441239.1_9 Forward -62 -50 11.7404 0.0551
NP_441239.1_9 Reverse -49 -61 6.92215 0.173
NP_441239.1_9 Forward -372 -360 6.72548 0.178
NP_441727.1_3 Reverse -44 -63 4.12936 0.272
NP_441892.1_1 Forward -69 -52 14.1002 0.034
NP_441892.1_1 Forward -176 -159 -2.3211 0.22
NP_440604.1_6 Reverse -51 -70 -0.0988766 0.171
NP_440796.1_1 Forward -63 -44 8.55425 0.257
NP_440796.1_3 Forward -67 -49 7.49153 0.289
NP_442193.1_1 Reverse -292 -310 18.0137 0.113
NP_440219.1_3 Forward -206 -187 25.5814 0.00176
NP_441017.1_6 Forward -64 -50 10.8154 0.298
NP_440833.1_6 Forward -132 -118 7.96378 0.277
NP_440354.1_7 Forward -92 -74 8.96727 0.231
NP_440546.1_4 Reverse -51 -61 12.8578 0.0572
NP_440546.1_4 Forward -370 -360 11.0156 0.0991
NP_440546.1_4 Forward -60 -50 10.046 0.109
NP_440462.1_6 Forward -372 -362 14.4347 0.0209
NP_440462.1_6 Forward -62 -52 7.84651 0.0699
NP_440462.1_6 Reverse -359 -369 7.05986 0.0915
NP_440462.1_6 Reverse -150 -160 3.32329 0.25
NP_440462.1_6 Reverse -49 -59 1.35667 0.294
NP_440868.1_4 Forward -64 -52 8.79043 0.0582
NP_440868.1_4 Reverse -47 -59 5.84051 0.0879
NP_442402.1_10 Forward -139 -129 10.501 0.288
NP_441848.1_4 Reverse -26 -42 9.74698 0.275
NP_441084.1_6 Forward -62 -48 14.4828 0.0972
NP_440696.1_3 Forward -183 -165 1.98577 0.217
NP_440696.1_6 Forward -178 -159 4.52268 0.288
NP_442923.1_6 Reverse -15 -29 11.0887 0.257
NP_442039.1_4 Forward -59 -52 15.1821 0.0124
NP_442039.1_4 Reverse -52 -59 15.1821 0.0124
NP_442039.1_4 Reverse -362 -369 11.6422 0.0747
NP_442039.1_4 Forward -160 -153 8.10225 0.221
NP_442039.1_7 Forward -289 -279 12.6647 0.222
NP_441811.1_8 Forward -66 -52 6.3911 0.273
NP_442380.1_5 Reverse -358 -377 18.1492 0.142
NP_440825.1_7 Forward -59 -49 12.9096 0.152
NP_442837.1_3 Forward -59 -52 15.7721 0.0124
NP_442837.1_3 Reverse -52 -59 15.7721 0.0124
NP_442837.1_3 Forward -369 -362 12.8221 0.0384
NP_442837.1_3 Reverse -362 -369 12.4288 0.0594
NP_440805.1_2 Forward -52 -33 10.9134 0.161
NP_442053.1_1 Forward -60 -51 18.3876 0.0007
NP_442053.1_1 Reverse -51 -60 18.3876 0.0007
NP_442053.1_1 Reverse -152 -161 10.3245 0.0537
NP_442053.1_1 Forward -370 -361 5.60459 0.176
NP_440505.1_3 Reverse -359 -369 11.7798 0.0676
NP_440505.1_3 Reverse -49 -59 9.22315 0.122
NP_440505.1_3 Forward -62 -52 7.55152 0.151
NP_440505.1_3 Forward -372 -362 4.60159 0.277
NP_441203.1_1 Forward -59 -40 -11.5053 0.139
NP_442255.1_10 Forward -169 -150 19.2723 0.235
NP_440914.1_1 Forward -60 -50 17.5935 0.000537
NP_440914.1_1 Forward -370 -360 10.8597 0.118
NP_440914.1_1 Reverse -51 -61 8.51751 0.186
NP_440914.1_1 Reverse -361 -371 6.66328 0.269
NP_440914.1_1 Reverse -152 -162 6.3705 0.283
NP_441699.1_7 Forward -137 -118 1.17865 0.291
NP_441011.1_8 Reverse -362 -371 14.356 0.0249
NP_441011.1_8 Reverse -52 -61 14.356 0.0249
NP_441011.1_8 Forward -160 -151 8.25953 0.144
NP_441011.1_8 Forward -59 -50 8.25953 0.144
NP_441011.1_8 Forward -369 -360 7.07956 0.179
NP_442101.1_10 Reverse -43 -62 3.44104 0.0705
NP_442533.1_6 Forward -60 -51 17.2076 0.00137
NP_442533.1_6 Reverse -51 -60 17.2076 0.00137
NP_442533.1_6 Reverse -361 -370 14.4544 0.013
NP_442533.1_6 Reverse -164 -173 5.50626 0.14
NP_442533.1_6 Forward -173 -164 4.22796 0.186
NP_441089.1_5 Reverse -290 -309 16.5191 0.281
NP_442541.1_10 Reverse -164 -178 13.6669 0.182
NP_441482.1_7 Forward -66 -52 -9.04686 0.193
NP_439944.1_9 Reverse -52 -62 17.3846 0.00516
NP_439944.1_9 Forward -59 -49 10.5014 0.0887
NP_439944.1_9 Forward -369 -359 7.94484 0.123
NP_439944.1_9 Reverse -362 -372 6.27322 0.188
NP_441697.1_5 Forward -41 -22 -8.16498 0.256
NP_441697.1_5 Forward -42 -23 -9.31089 0.268
NP_440816.1_2 Reverse -321 -340 6.53177 0.277
NP_441028.1_6 Forward -87 -77 3.51951 0.292
NP_441527.1_4 Reverse -323 -342 -10.6478 0.272
NP_440115.1_6 Forward -63 -53 8.73149 0.128
NP_440115.1_6 Forward -164 -154 6.17489 0.197
NP_440007.1_9 Reverse -357 -371 4.03116 0.267
NP_441972.1_5 Forward -59 -40 1.37609 0.135
NP_441106.1_1 Forward -61 -52 9.73449 0.0311
NP_441106.1_1 Reverse -50 -59 9.63616 0.0311
NP_441106.1_1 Reverse -360 -369 8.65285 0.0522
NP_441106.1_1 Forward -371 -362 7.86621 0.0699
NP_441106.1_3 Forward -39 -20 11.0125 0.236
NP_442306.1_10 Forward -65 -46 -18.7818 0.197
NP_441286.1_1 Reverse -50 -62 23.9334 0.000767
NP_441286.1_1 Forward -61 -49 3.48056 0.0467
NP_440670.1_8 Forward -60 -51 18.3876 0.000699
NP_440670.1_8 Reverse -51 -60 18.3876 0.000699
NP_440886.1_7 Forward -61 -51 8.04271 0.0805
NP_440886.1_7 Reverse -50 -60 7.94438 0.0805
NP_440886.1_7 Reverse -151 -161 5.48612 0.181
NP_442614.1_2 Forward -167 -153 11.2093 0.206
NP_442614.1_2 Reverse -51 -65 8.25939 0.255
NP_442213.1_5 Reverse -293 -312 -0.590531 0.292
NP_441753.1_10 Forward -69 -50 6.19431 0.186
NP_440907.2_8 Reverse -52 -62 9.81266 0.103
NP_440907.2_8 Forward -59 -49 7.64939 0.117
NP_440907.2_8 Forward -369 -359 6.56775 0.161
NP_440907.2_8 Reverse -362 -372 5.68278 0.191
NP_440907.2_8 Reverse -153 -163 5.28945 0.209
NP_440326.1_5 Reverse -49 -62 15.2606 0.179
NP_440841.1_4 Forward -62 -43 21.2389 0.0183
NP_440962.1_5 Reverse -40 -50 18.0729 0.248
NP_440962.1_6 Forward -144 -127 11.6411 0.288
NP_441463.1_3 Forward -70 -51 9.83255 0.0481
NP_441626.1_2 Forward -59 -52 15.7721 0.0124
NP_441626.1_2 Reverse -52 -59 15.7721 0.0124
NP_441626.1_2 Forward -369 -362 6.0373 0.212
NP_441626.1_2 Reverse -362 -369 5.93897 0.231
NP_442794.1_1 Reverse -47 -59 9.38042 0.0795
NP_442615.1_1 Reverse -42 -60 20.6687 0.00391
NP_442615.1_1 Reverse -112 -130 -6.56903 0.252
NP_440387.1_1 Reverse -361 -377 3.89344 0.0503
NP_440855.1_5 Reverse -156 -175 6.58682 0.285
NP_441431.1_2 Reverse -165 -179 10.8154 0.153
NP_441431.1_2 Forward -63 -49 9.14375 0.192
NP_441836.1_2 Forward -298 -279 -3.44213 0.238
NP_440467.1_3 Reverse -110 -129 10.8656 0.296
NP_440114.1_10 Forward -370 -356 14.2576 0.0429
NP_440114.1_10 Reverse -51 -65 14.2576 0.0429
NP_440114.1_10 Forward -60 -46 6.09611 0.285
NP_440114.1_10 Reverse -361 -375 5.70279 0.296
NP_440293.1_3 Reverse -220 -239 -4.22878 0.26
NP_440293.1_9 Forward -178 -164 11.7308 0.257
NP_440766.1_4 Forward -165 -151 10.7177 0.0853
NP_441237.1_9 Forward -59 -49 14.828 0.0242
NP_441133.1_3 Forward -170 -151 13.4708 0.272
NP_439910.1_2 Reverse -353 -370 -13.3342 0.162
NP_439910.1_2 Forward -68 -51 -21.594 0.183
NP_439910.1_2 Forward -378 -361 -21.6923 0.184
NP_442867.1_8 Reverse -367 -386 10.6192 0.206
NP_440457.1_1 Forward -64 -52 11.7404 0.092
NP_440457.1_1 Forward -374 -362 -0.551008 0.268
NP_440798.1_6 Forward -59 -46 5.62415 0.14
NP_440798.1_6 Reverse -52 -65 4.24752 0.147
NP_441436.1_8 Reverse -50 -69 10.7175 0.262
NP_442509.1_9 Reverse -51 -61 17.3841 0.00128
NP_442509.1_9 Forward -60 -50 8.14104 0.192
NP_442509.1_9 Forward -161 -151 7.55106 0.214
NP_442514.1_5 Reverse -156 -175 0.392004 0.178
NP_440554.1_4 Reverse -362 -372 8.33817 0.0773
NP_440554.1_4 Reverse -52 -62 6.96153 0.107
NP_440554.1_4 Forward -369 -359 6.56821 0.121
NP_441885.1_5 Forward -60 -50 20.9245 0.000538
NP_441885.1_5 Reverse -51 -61 11.3864 0.00668
NP_441885.1_5 Reverse -361 -371 7.84651 0.0419
NP_441885.1_5 Forward -197 -187 -1.00328 0.248
NP_440649.2_5 Reverse -50 -69 14.3558 0.232
NP_442341.1_7 Reverse -50 -64 6.6861 0.12
NP_442341.1_7 Forward -61 -47 5.40779 0.157
NP_442341.1_9 Reverse -49 -63 8.16044 0.178
NP_442341.1_9 Forward -169 -155 4.62054 0.296
NP_441173.1_9 Forward -137 -129 14.3753 0.161
NP_441173.1_9 Reverse -279 -287 12.1137 0.21
NP_441173.1_9 Forward -136 -128 10.2454 0.261
NP_443000.1_7 Reverse -49 -59 10.3048 0.0345
NP_443000.1_7 Forward -62 -52 8.82982 0.0437
NP_443000.1_7 Reverse -359 -369 7.84651 0.0617
NP_443000.1_7 Forward -372 -362 7.25653 0.0927
NP_440507.2_3 Forward -69 -50 13.3716 0.145
NP_441842.1_10 Reverse -44 -58 11.0127 0.145
NP_441842.1_10 Forward -67 -53 9.43936 0.192
NP_440275.1_3 Forward -62 -52 10.0098 0.0454
NP_440275.1_3 Reverse -49 -59 8.04317 0.0602
NP_440091.1_1 Forward -64 -52 6.52882 0.095
NP_440091.1_1 Forward -374 -362 0.923956 0.225
NP_440091.1_1 Reverse -47 -59 -0.452677 0.273
NP_440091.1_1 Reverse -357 -369 -0.649339 0.282
NP_443010.1_10 Forward -373 -356 2.96406 0.267
NP_441207.1_7 Reverse -133 -147 12.3534 0.241
NP_440149.1_8 Forward -60 -41 -6.58872 0.255
NP_441105.1_3 Forward -178 -159 8.35759 0.049
NP_441105.1_3 Reverse -153 -172 2.26107 0.106
NP_441105.1_3 Forward -71 -52 -9.14533 0.284
NP_441105.1_3 Reverse -46 -65 -9.93197 0.298
NP_440216.1_1 Forward -60 -46 7.07942 0.01
NP_440216.1_1 Reverse -51 -65 6.6861 0.0139
NP_440216.1_1 Reverse -164 -178 -9.44018 0.145
NP_440216.1_1 Forward -177 -163 -10.9151 0.153
NP_440216.1_1 Reverse -361 -375 -12.0951 0.24
NP_440172.1_1 Reverse -51 -61 16.303 0.00854
NP_440172.1_1 Forward -60 -50 15.0247 0.00945
NP_440172.1_1 Reverse -361 -371 10.5998 0.0479
NP_441064.1_4 Forward -231 -212 11.3075 0.246
NP_442015.1_10 Forward -64 -51 10.4424 0.0391
NP_442015.1_10 Reverse -47 -60 1.49425 0.204
NP_441045.1_4 Reverse -319 -338 11.3075 0.274
NP_441226.1_7 Forward -59 -52 14.4934 0.0123
NP_441226.1_7 Reverse -52 -59 14.4934 0.0123
NP_441226.1_7 Reverse -362 -369 11.5435 0.0757
NP_441226.1_7 Forward -160 -153 9.77352 0.131
NP_441226.1_7 Forward -166 -159 8.59356 0.197
NP_441111.1_7 Forward -59 -51 18.7023 0.00294
NP_441111.1_7 Reverse -52 -60 18.7023 0.00294
NP_441111.1_7 Forward -369 -361 8.96754 0.0463
NP_442379.1_10 Forward -377 -360 11.3469 0.0787
NP_441766.1_2 Forward -60 -51 17.5026 0.00297
NP_441766.1_2 Reverse -51 -60 17.5026 0.00297
NP_441766.1_2 Reverse -361 -370 8.1612 0.0645
NP_440416.1_9 Reverse -157 -176 -5.40875 0.0797
NP_440416.1_9 Reverse -44 -63 -8.06369 0.109
NP_443052.1_8 Forward -70 -51 -1.86883 0.0843
NP_443052.1_9 Reverse -160 -179 -4.13045 0.254
NP_441940.1_4 Forward -169 -150 11.2092 0.266
NP_442403.1_8 Reverse -53 -72 7.27595 0.178
NP_442154.1_1 Reverse -296 -314 -15.9105 0.228
NP_440261.1_5 Reverse -52 -65 5.13249 0.0476
NP_440261.1_5 Forward -59 -46 -10.4038 0.201
NP_440988.1_10 Forward -231 -217 4.22114 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAGGAAGTCCGGGATTTGTCAAAACGGGAAAGGGATCGCCTTTTAAGTAGTTTACGTTTAATTCTTCATCACTTCCTCAATTGGGACTACCAGCCCCAGAAACGTTCCCGCAGTTGGCAGAATACAATTGATCGAGAGCGGAACAATATTGAACTATATCTTGAGGACAGTCCCAGTCTGCAGCGTTATCTCAATGATGGGGTGTCTCTCGCTAAAATGTATCGGCTGGCGCGGGCCGACGCGATCCGGGAAACTGATTTAGATTTTCCCAAAGATTGCCTATACGATATGGAAGATGTATTAAGTCGCGTTATTTCCCTCGGTGAATGATCCTCTAGAGGGCGATCGCCAAATGAAAACCAATTGTTAAAATTAATTCACTCTTCTAAGCTGCACCATT

CDS

ATGGCTACCGTTTTAGACCTTCAGCCAATTATTTCGTTGAACCGAGGGCAATTTTATCAGCTCTGTCAAAACAATCCTGACCTCAGCCTAGAAAGAAACCCCCAAGGGAAGCTCATCATTCTGTCCCCAGTTGGTGGTGAAAGTGGTGCCCAAGAAGCGAGCCTTATTTTCAAAGTTTCTCTCTGGAATTATCAGAGTCAACTCGGAATTGTCTTTAGTTCCTCAACAATCTTTAGCCTACCCCAAGGTGGCGATCGCTCCCCCGATGTGGCTTGGGTCTCCCGAGGTAATTGGGAAAAGTTAACCCCAGCAGAACGAGAGGGTTTTCCCCCAATTTGTCCTGATTTTGTGATTGAACTCAGATCAAAAAGTGATCGTCTTAAACCCCTACAAGACAAAATGCTAGAGTACCTAACATCTGGTTTGCAACTAGGCTGGCTAATCAATCCACAACAAAAACAGGTGGAGATCTACCGCCAAAATCAACCCACAGAAATAACTAATCTCCCCACAAAATTGTCTGGGGAGAATGTTTTACCCGGATTTAGCATTTCTCTAGACTAG

Protein

MATVLDLQPIISLNRGQFYQLCQNNPDLSLERNPQGKLIILSPVGGESGAQEASLIFKVSLWNYQSQLGIVFSSSTIFSLPQGGDRSPDVAWVSRGNWEKLTPAEREGFPPICPDFVIELRSKSDRLKPLQDKMLEYLTSGLQLGWLINPQQKQVEIYRQNQPTEITNLPTKLSGENVLPGFSISLD