Your browser is old and dusty. Try Google Chrome!

Details for slr0977

ORF slr0977
Accession NP_440216.1
Symbol
Category ABC transporter, permease component
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -136 -150 1.17956 0.193
NP_442761.1_5 Forward -100 -81 4.32602 0.268
NP_441418.1_6 Reverse -86 -105 -23.305 0.194
NP_441343.1_3 Reverse -76 -95 10.9142 0.276
NP_440897.1_6 Forward -186 -167 0.686995 0.179
NP_441453.1_1 Forward -102 -84 2.87 0.282
NP_441453.1_4 Forward -95 -87 14.7691 0.0119
NP_441453.1_4 Reverse -86 -94 6.80426 0.121
NP_441453.1_4 Forward -150 -142 4.24765 0.259
NP_441453.1_7 Reverse -289 -296 12.1338 0.295
NP_442151.1_6 Reverse -86 -100 14.1593 0.0395
NP_440996.1_2 Reverse -357 -366 14.8477 0.248
NP_442173.1_1 Forward -94 -86 12.0158 0.0316
NP_442173.1_1 Reverse -87 -95 12.0158 0.0316
NP_442752.1_4 Reverse -86 -93 13.8055 0.0199
NP_443027.1_4 Forward -152 -142 5.78156 0.298
NP_441745.1_3 Reverse -138 -157 14.3549 0.255
NP_441812.1_3 Reverse -92 -106 9.2427 0.245
NP_442975.1_10 Forward -99 -85 3.14559 0.263
NP_440784.1_7 Reverse -87 -94 6.23397 0.241
NP_440784.1_7 Forward -94 -87 6.13563 0.241
NP_442861.1_1 Reverse -300 -319 12.7825 0.26
NP_442289.1_4 Reverse -47 -63 20.6097 0.154
NP_440110.1_8 Reverse -175 -194 -0.197208 0.219
NP_442062.1_8 Reverse -86 -96 8.23984 0.0793
NP_442062.1_8 Forward -150 -140 4.10993 0.232
NP_440761.1_4 Forward -100 -81 -13.9635 0.257
NP_441859.1_3 Reverse -85 -104 4.12856 0.228
NP_440304.1_4 Forward -97 -87 8.1415 0.0859
NP_440304.1_4 Forward -269 -259 4.60159 0.258
NP_440916.1_1 Forward -366 -352 14.6509 0.206
NP_439918.1_2 Forward -63 -44 -1.96717 0.24
NP_441208.1_9 Forward -98 -84 16.1259 0.0671
NP_441208.1_9 Forward -263 -249 5.99778 0.254
NP_442742.1_9 Forward -365 -346 -7.08038 0.236
NP_442726.1_1 Forward -350 -331 10.9142 0.213
NP_440856.1_4 Reverse -79 -98 3.24438 0.128
NP_441083.1_5 Reverse -86 -96 16.7946 0.00546
NP_441083.1_5 Forward -95 -85 10.0098 0.0214
NP_441738.1_2 Forward -93 -86 15.28 0.0102
NP_441738.1_2 Reverse -57 -64 6.52862 0.261
NP_441558.1_5 Reverse -84 -103 15.6341 0.0398
NP_441558.1_5 Forward -97 -78 4.62101 0.276
NP_440209.1_1 Reverse -86 -94 8.57422 0.0425
NP_440209.1_1 Forward -95 -87 8.47588 0.0457
NP_441444.1_1 Forward -372 -353 7.27595 0.224
NP_440870.1_4 Forward -65 -47 3.16574 0.163
NP_442889.1_8 Reverse -28 -42 4.71887 0.255
NP_440447.1_6 Forward -103 -85 9.55725 0.135
NP_441713.1_1 Forward -101 -82 11.5042 0.0344
NP_442570.1_3 Reverse -133 -152 -1.27885 0.212
NP_441716.1_1 Reverse -271 -285 4.71948 0.252
NP_441598.1_3 Forward -197 -178 11.5089 0.292
NP_442111.1_4 Forward -96 -82 17.4042 0.0102
NP_441624.1_7 Reverse -141 -155 5.99778 0.296
NP_441163.1_1 Reverse -17 -34 6.3313 0.26
NP_440906.1_5 Reverse -87 -94 6.23397 0.234
NP_440906.1_5 Forward -94 -87 6.13563 0.241
NP_440747.1_10 Reverse -83 -95 7.4138 0.00422
NP_440747.1_10 Reverse -138 -150 -4.68091 0.115
NP_440747.1_10 Forward -98 -86 -11.7607 0.142
NP_440747.1_10 Reverse -236 -248 -11.9574 0.178
NP_440747.1_10 Forward -153 -141 -12.1541 0.227
NP_441130.1_10 Forward -97 -83 4.32615 0.295
NP_442634.1_4 Forward -97 -83 4.62115 0.0764
NP_442634.1_4 Forward -152 -138 -3.83532 0.17
NP_442634.1_4 Reverse -84 -98 -4.03198 0.179
NP_441265.1_3 Forward -101 -87 3.73617 0.181
NP_440842.1_10 Reverse -21 -35 3.63784 0.255
NP_441014.1_5 Reverse -33 -51 15.1621 0.2
NP_442848.1_1 Forward -286 -272 -4.32697 0.287
NP_441012.1_4 Reverse -273 -286 15.7522 0.163
NP_443018.1_3 Forward -149 -142 12.5271 0.0523
NP_443018.1_3 Reverse -142 -149 12.5271 0.0523
NP_443018.1_3 Forward -94 -87 11.7405 0.0655
NP_443018.1_3 Reverse -32 -39 9.38056 0.128
NP_443018.1_3 Reverse -87 -94 5.44732 0.193
NP_441634.1_8 Reverse -84 -98 -4.22864 0.295
NP_441634.1_8 Reverse -48 -62 -4.4253 0.295
NP_441634.1_9 Forward -285 -266 15.1416 0.165
NP_440376.1_1 Reverse -86 -95 15.7327 0.00625
NP_440376.1_1 Forward -95 -86 9.63616 0.0385
NP_441588.1_4 Reverse -33 -43 5.78156 0.235
NP_442687.1_7 Forward -96 -86 8.73149 0.101
NP_442687.1_7 Reverse -85 -95 6.76487 0.154
NP_442191.1_4 Forward -94 -80 11.8657 0.238
NP_442485.1_3 Reverse -76 -95 -5.50708 0.291
NP_441846.1_10 Forward -81 -62 -22.3217 0.259
NP_440642.1_1 Reverse -18 -37 8.84924 0.239
NP_441950.1_7 Forward -279 -260 -9.44032 0.297
NP_442296.1_9 Forward -101 -82 -2.16383 0.219
NP_442658.1_1 Forward -97 -87 8.04271 0.199
NP_440446.1_6 Forward -269 -250 11.7992 0.298
NP_440662.1_6 Forward -131 -112 11.2092 0.165
NP_442782.1_2 Forward -95 -81 7.76774 0.202
NP_442496.1_5 Forward -77 -59 6.01734 0.285
NP_441487.1_6 Reverse -78 -97 2.3594 0.254
NP_441958.1_5 Reverse -85 -95 18.9579 0.00183
NP_441958.1_5 Forward -96 -86 10.6981 0.0112
NP_442836.1_5 Forward -101 -82 3.93269 0.222
NP_440203.1_5 Forward -246 -236 10.9926 0.206
NP_443001.1_7 Reverse -178 -197 2.94938 0.279
NP_441162.1_3 Forward -88 -69 7.66927 0.287
NP_441097.1_2 Forward -79 -62 22.36 0.0313
NP_442690.1_1 Reverse -305 -324 -12.8819 0.25
NP_442911.1_2 Forward -105 -86 3.14605 0.0458
NP_442911.1_2 Reverse -131 -150 -10.6203 0.284
NP_442064.1_4 Reverse -131 -150 7.4718 0.242
NP_443055.1_6 Reverse -23 -41 -1.75153 0.284
NP_440993.1_2 Reverse -81 -97 5.56507 0.234
NP_440993.1_3 Reverse -65 -84 -1.47628 0.282
NP_440993.1_4 Forward -150 -133 5.64371 0.261
NP_440993.1_4 Forward -96 -79 4.75873 0.272
NP_440827.1_5 Forward -265 -246 19.9606 0.183
NP_441099.1_5 Forward -105 -86 8.06259 0.04
NP_441099.1_5 Reverse -62 -81 -8.45701 0.194
NP_442002.1_1 Forward -79 -61 -4.01242 0.222
NP_441294.1_7 Forward -99 -85 10.9784 0.161
NP_441000.1_6 Forward -96 -82 3.44117 0.111
NP_442771.1_1 Forward -97 -79 -2.14413 0.147
NP_440484.1_3 Forward -152 -138 9.43936 0.263
NP_441674.1_10 Reverse -176 -194 -0.570838 0.29
NP_440147.1_4 Reverse -84 -97 18.2105 0.00465
NP_440147.1_4 Forward -97 -84 1.19926 0.235
NP_441550.1_8 Forward -97 -87 18.8591 0.00654
NP_441550.1_8 Reverse -84 -94 14.5325 0.0141
NP_441916.1_7 Forward -95 -85 9.32148 0.037
NP_441916.1_7 Reverse -86 -96 7.15819 0.0745
NP_441916.1_10 Forward -152 -133 6.29264 0.208
NP_441041.1_4 Forward -286 -267 -6.68705 0.172
NP_441041.1_4 Forward -75 -56 -8.06369 0.196
NP_441041.1_7 Forward -98 -86 12.1793 0.0682
NP_441041.1_7 Reverse -83 -95 9.74986 0.108
NP_441041.1_8 Forward -187 -168 17.8088 0.157
NP_443063.1_7 Reverse -226 -242 14.9065 0.135
NP_441725.1_5 Reverse -87 -97 9.02648 0.0553
NP_441725.1_5 Forward -39 -29 -0.511621 0.26
NP_439966.1_7 Forward -97 -87 7.15773 0.154
NP_439966.1_7 Reverse -84 -94 4.60114 0.265
NP_439966.1_7 Reverse -256 -266 4.20782 0.285
NP_439966.1_9 Forward -264 -255 3.7363 0.253
NP_439966.1_9 Forward -66 -57 3.7363 0.253
NP_442941.1_3 Forward -94 -84 9.41981 0.0319
NP_442941.1_3 Reverse -142 -152 -0.314959 0.256
NP_440289.1_2 Forward -98 -85 4.34585 0.0673
NP_440289.1_2 Reverse -83 -96 -3.71729 0.267
NP_440260.1_8 Forward -264 -246 -3.52077 0.252
NP_440260.1_8 Reverse -77 -95 -7.65067 0.298
NP_442281.1_1 Reverse -26 -40 9.6354 0.0684
NP_442281.1_1 Forward -100 -86 8.55376 0.0798
NP_442281.1_1 Forward -155 -141 8.25877 0.0832
NP_442281.1_1 Reverse -136 -150 4.42388 0.195
NP_441334.1_7 Forward -97 -78 -3.93378 0.114
NP_440479.1_7 Reverse -342 -361 19.5277 0.133
NP_440437.1_1 Reverse -80 -99 2.45773 0.133
NP_442500.1_8 Reverse -218 -232 8.53947 0.295
NP_440498.1_1 Reverse -77 -95 -2.14413 0.235
NP_440375.1_8 Forward -94 -75 0.0977854 0.266
NP_441644.1_6 Forward -95 -85 18.7607 0.00127
NP_441644.1_6 Forward -150 -140 11.4843 0.0481
NP_441644.1_6 Reverse -141 -151 6.27276 0.163
NP_441644.1_6 Reverse -86 -96 6.0761 0.167
NP_441644.1_6 Reverse -31 -41 4.20782 0.245
NP_441644.1_6 Forward -53 -43 3.12618 0.297
NP_443049.1_6 Forward -281 -271 14.1783 0.131
NP_440652.1_1 Reverse -237 -256 2.55606 0.298
NP_440867.1_10 Reverse -71 -90 2.3594 0.289
NP_441810.1_9 Reverse -264 -283 3.34271 0.269
NP_440253.1_2 Reverse -86 -104 -1.16082 0.234
NP_440929.1_8 Forward -95 -86 16.5193 0.00413
NP_440929.1_8 Reverse -86 -95 9.53783 0.0296
NP_442933.1_5 Forward -225 -206 10.0292 0.288
NP_442933.1_10 Forward -95 -86 8.06287 0.0885
NP_442933.1_10 Reverse -86 -95 7.96454 0.0937
NP_441751.2_8 Forward -94 -80 -2.26202 0.132
NP_442554.1_8 Reverse -142 -152 15.123 0.00944
NP_442554.1_8 Reverse -87 -97 14.6313 0.0129
NP_442554.1_8 Forward -39 -29 10.3048 0.0476
NP_442554.1_8 Forward -149 -139 9.81313 0.0545
NP_442554.1_8 Forward -94 -84 7.45319 0.092
NP_441762.1_7 Reverse -85 -97 -7.04085 0.285
NP_442142.1_4 Reverse -138 -151 4.34528 0.223
NP_442142.1_4 Forward -98 -85 3.95196 0.239
NP_442142.1_4 Forward -245 -232 3.16532 0.265
NP_442142.1_4 Forward -153 -140 2.28034 0.295
NP_442142.1_4 Reverse -28 -41 2.28034 0.295
NP_442292.1_1 Forward -94 -85 7.66954 0.0634
NP_442292.1_1 Forward -149 -140 5.21127 0.152
NP_442292.1_1 Reverse -142 -151 4.81794 0.17
NP_442292.1_1 Reverse -87 -96 -0.196935 0.239
NP_441024.1_6 Reverse -342 -361 7.49569 0.29
NP_442381.1_8 Forward -98 -79 -12.4886 0.267
NP_443009.1_5 Reverse -85 -96 7.33466 0.132
NP_443009.1_5 Forward -96 -85 7.138 0.137
NP_440807.1_6 Forward -100 -81 18.1907 0.254
NP_441715.1_4 Forward -94 -84 6.96153 0.121
NP_440015.1_9 Reverse -86 -104 -1.75081 0.292
NP_440183.1_9 Reverse -273 -292 -19.1751 0.277
NP_440379.1_5 Forward -99 -80 -5.11376 0.219
NP_441468.1_1 Reverse -87 -94 6.13563 0.209
NP_441468.1_1 Forward -94 -87 6.0373 0.223
NP_441468.1_1 Reverse -142 -149 3.97235 0.277
NP_441468.1_1 Forward -149 -142 3.97235 0.277
NP_441020.2_6 Forward -97 -80 6.43035 0.262
NP_441015.1_10 Forward -155 -136 -3.04881 0.184
NP_441673.1_1 Reverse -86 -95 11.1111 0.0121
NP_441673.1_1 Forward -95 -86 11.0128 0.018
NP_441731.1_3 Reverse -78 -97 -3.73712 0.284
NP_441826.1_2 Forward -101 -87 -4.52363 0.296
NP_441330.1_1 Forward -155 -136 -6.68705 0.167
NP_442868.1_6 Forward -97 -87 6.96153 0.0919
NP_442868.1_6 Reverse -84 -94 0.668351 0.213
NP_441056.1_1 Reverse -55 -74 -9.44032 0.3
NP_441612.1_2 Reverse -355 -365 14.9389 0.21
NP_442559.1_3 Reverse -14 -33 18.9773 0.125
NP_442808.1_1 Forward -96 -86 9.321 0.0481
NP_442808.1_1 Reverse -22 -32 3.91283 0.218
NP_442808.1_1 Reverse -270 -280 3.71617 0.227
NP_440145.1_3 Reverse -76 -95 7.66927 0.0466
NP_440145.1_3 Forward -160 -141 -4.03212 0.217
NP_442718.1_2 Forward -289 -270 -5.40875 0.295
NP_442542.1_2 Forward -97 -84 8.67241 0.152
NP_442542.1_2 Forward -237 -224 8.18076 0.16
NP_442050.1_5 Forward -97 -87 12.7626 0.0516
NP_442050.1_5 Reverse -53 -63 9.02601 0.202
NP_442050.1_8 Forward -87 -68 12.8206 0.272
NP_442342.1_9 Reverse -79 -95 1.92682 0.296
NP_442789.1_4 Reverse -376 -395 -4.91709 0.265
NP_440274.1_2 Reverse -266 -280 17.5018 0.199
NP_442593.1_9 Forward -333 -314 16.4649 0.257
NP_441878.1_6 Forward -96 -86 10.4031 0.0176
NP_441878.1_6 Reverse -85 -95 0.766681 0.134
NP_441878.1_6 Forward -151 -141 0.766681 0.134
NP_441878.1_6 Reverse -140 -150 0.57002 0.14
NP_441878.1_6 Reverse -30 -40 0.57002 0.14
NP_441036.1_8 Reverse -85 -95 14.4347 0.0234
NP_441557.1_5 Reverse -86 -95 10.2261 0.0144
NP_441557.1_5 Forward -95 -86 10.1278 0.0188
NP_441445.1_1 Reverse -278 -297 3.04771 0.22
NP_441590.1_4 Reverse -259 -278 2.9486 0.29
NP_442066.2_4 Reverse -226 -245 -0.787193 0.18
NP_442183.1_1 Reverse -86 -100 6.6861 0.164
NP_442166.1_7 Forward -94 -80 7.86607 0.264
NP_441549.1_9 Forward -99 -81 -0.275845 0.137
NP_440540.1_8 Forward -101 -82 8.16093 0.254
NP_441037.1_4 Forward -97 -87 14.9194 0.028
NP_440151.1_2 Reverse -141 -159 18.7995 0.15
NP_441633.1_3 Reverse -84 -97 5.72248 0.0481
NP_442764.1_3 Reverse -239 -249 16.4013 0.295
NP_440136.1_2 Reverse -87 -94 6.23397 0.171
NP_440136.1_2 Forward -94 -87 6.13563 0.193
NP_442590.1_9 Forward -41 -22 4.62101 0.273
NP_442590.1_10 Forward -102 -83 3.83436 0.283
NP_442998.1_10 Forward -93 -86 15.5754 0.0102
NP_442998.1_10 Reverse -88 -95 5.84064 0.235
NP_440299.1_1 Reverse -137 -150 10.0485 0.0615
NP_440299.1_1 Reverse -273 -286 4.24695 0.213
NP_440640.1_6 Forward -81 -62 0.884433 0.266
NP_441007.1_5 Forward -149 -130 12.3892 0.203
NP_440256.1_1 Reverse -138 -157 -7.17871 0.231
NP_440256.1_1 Reverse -83 -102 -8.752 0.266
NP_440256.1_1 Forward -43 -24 -9.83364 0.289
NP_441559.1_8 Forward -308 -294 3.24451 0.143
NP_441559.1_8 Reverse -81 -95 -1.08205 0.18
NP_442860.1_7 Reverse -317 -335 15.7609 0.188
NP_440915.1_6 Reverse -82 -96 15.6342 0.0183
NP_440915.1_6 Forward -99 -85 15.1426 0.0183
NP_440915.1_6 Forward -271 -257 -0.197071 0.186
NP_442158.1_4 Forward -257 -247 15.418 0.167
NP_442158.1_4 Forward -222 -212 14.828 0.176
NP_442158.1_4 Reverse -101 -111 14.0414 0.203
NP_442866.1_1 Reverse -81 -100 -6.58872 0.255
NP_441464.1_8 Reverse -86 -100 7.17775 0.217
NP_442993.1_1 Forward -267 -251 -10.9545 0.231
NP_442386.1_9 Reverse -140 -149 9.04574 0.175
NP_440570.1_5 Forward -355 -336 5.70265 0.188
NP_440570.1_5 Reverse -62 -81 0.0977854 0.258
NP_441340.1_5 Reverse -87 -94 13.5105 0.0314
NP_441340.1_5 Forward -94 -87 5.84064 0.208
NP_441340.1_5 Reverse -142 -149 4.07068 0.239
NP_441340.1_5 Forward -149 -142 4.07068 0.239
NP_441340.1_9 Forward -21 -11 8.54444 0.256
NP_440168.1_9 Reverse -376 -395 -5.21209 0.296
NP_440327.1_6 Forward -357 -338 2.16274 0.299
NP_441254.1_1 Reverse -362 -375 17.2266 0.172
NP_441160.1_1 Reverse -79 -98 -12.0953 0.296
NP_440586.1_8 Forward -94 -87 9.47853 0.146
NP_440586.1_8 Forward -149 -142 7.61025 0.227
NP_440586.1_8 Reverse -142 -149 7.61025 0.227
NP_440586.1_8 Reverse -87 -94 5.74197 0.283
NP_441262.1_3 Reverse -86 -93 14.7888 0.0223
NP_440027.1_3 Forward -296 -278 2.47668 0.289
NP_443051.1_1 Reverse -85 -94 16.6177 0.00754
NP_443051.1_1 Forward -96 -87 8.25953 0.0414
NP_443051.1_1 Forward -151 -142 -0.000272808 0.245
NP_439937.1_9 Reverse -85 -102 -7.04165 0.157
NP_440926.1_10 Reverse -93 -112 13.9625 0.259
NP_440926.1_10 Reverse -156 -175 13.5691 0.259
NP_440836.1_3 Forward -282 -263 15.8307 0.144
NP_440398.1_6 Forward -363 -344 2.85105 0.294
NP_443039.1_7 Reverse -55 -69 4.91554 0.248
NP_440439.1_1 Reverse -83 -96 17.8172 0.0105
NP_440439.1_1 Forward -98 -85 -1.06236 0.249
NP_439943.1_7 Reverse -136 -155 5.30933 0.261
NP_440372.1_2 Reverse -87 -94 13.8055 0.0214
NP_440372.1_2 Forward -94 -87 6.52896 0.188
NP_440770.1_3 Forward -262 -248 17.2075 0.139
NP_442783.1_8 Forward -362 -343 21.9264 0.0225
NP_441946.1_7 Reverse -55 -73 23.0277 0.0303
NP_440991.1_2 Forward -89 -70 10.7175 0.275
NP_440991.1_8 Forward -148 -129 14.9299 0.268
NP_440819.1_5 Reverse -355 -363 7.68924 0.266
NP_440316.1_10 Forward -268 -258 6.66654 0.256
NP_440316.1_10 Forward -151 -141 6.37155 0.263
NP_439977.1_5 Reverse -80 -99 1.67108 0.19
NP_440139.1_1 Reverse -80 -99 6.88182 0.139
NP_441572.1_7 Forward -101 -82 6.58763 0.0794
NP_440267.1_2 Reverse -81 -95 10.3237 0.141
NP_442384.1_10 Forward -95 -82 14.7689 0.0132
NP_441018.1_7 Forward -265 -246 11.3075 0.188
NP_441018.1_7 Forward -214 -195 9.43923 0.223
NP_441018.1_7 Forward -74 -55 6.09597 0.299
NP_442790.1_4 Forward -276 -257 -13.0786 0.257
NP_442262.1_10 Forward -94 -87 13.2155 0.0213
NP_442262.1_10 Forward -149 -142 10.4622 0.145
NP_442262.1_10 Reverse -142 -149 10.4622 0.145
NP_442262.1_10 Reverse -32 -39 9.47889 0.187
NP_441689.1_5 Reverse -84 -94 5.78111 0.197
NP_440344.1_10 Forward -102 -85 -0.452814 0.0426
NP_440531.1_6 Reverse -23 -42 1.27776 0.178
NP_440531.1_6 Forward -158 -139 0.884433 0.185
NP_440562.1_10 Reverse -77 -95 6.41066 0.284
NP_441640.1_8 Forward -302 -283 -3.14714 0.249
NP_441640.1_8 Forward -285 -266 -5.01543 0.27
NP_442693.1_6 Reverse -80 -99 12.3892 0.278
NP_440297.1_9 Forward -39 -29 9.32148 0.0917
NP_440297.1_9 Forward -149 -139 0.176696 0.282
NP_440297.1_9 Reverse -142 -152 -0.216628 0.282
NP_440297.1_9 Reverse -87 -97 -0.216628 0.282
NP_440350.1_5 Reverse -102 -121 -3.14714 0.255
NP_442280.1_10 Reverse -142 -160 14.4153 0.128
NP_442280.1_10 Reverse -131 -149 13.1491 0.158
NP_442280.1_10 Reverse -137 -155 9.35044 0.233
NP_442280.1_10 Forward -160 -142 9.15564 0.236
NP_442280.1_10 Reverse -126 -144 6.81803 0.268
NP_442280.1_10 Reverse -132 -150 6.62323 0.27
NP_441896.1_3 Forward -104 -85 2.26107 0.199
NP_441103.1_7 Reverse -65 -83 23.8144 0.0352
NP_441103.1_7 Reverse -110 -128 16.3413 0.276
NP_440894.1_10 Forward -100 -81 3.83436 0.263
NP_440999.1_1 Reverse -20 -39 2.55527 0.249
NP_440999.1_9 Forward -99 -85 1.57289 0.162
NP_440888.1_2 Forward -95 -81 13.1753 0.0324
NP_440888.1_2 Reverse -177 -191 5.21053 0.288
NP_441345.1_8 Reverse -229 -248 14.1591 0.26
NP_439969.1_3 Forward -100 -81 10.2259 0.116
NP_442277.1_4 Reverse -262 -281 0.785326 0.299
NP_442033.1_10 Forward -97 -78 -11.9969 0.261
NP_441543.1_2 Forward -94 -85 6.09625 0.153
NP_441543.1_2 Reverse -142 -151 4.12963 0.279
NP_442845.1_2 Forward -273 -259 10.7177 0.143
NP_442845.1_2 Forward -46 -32 5.30946 0.237
NP_442845.1_2 Forward -156 -142 3.53951 0.287
NP_441178.1_4 Reverse -79 -98 14.2574 0.162
NP_443064.1_6 Reverse -86 -96 12.6639 0.0796
NP_443064.1_6 Forward -95 -85 8.6886 0.276
NP_442337.1_8 Forward -255 -236 -2.36049 0.3
NP_442578.1_7 Reverse -87 -94 6.0373 0.18
NP_440710.1_1 Reverse -78 -96 1.49411 0.135
NP_440148.1_1 Forward -106 -87 -5.11376 0.231
NP_441462.1_2 Reverse -86 -96 18.3679 0.0036
NP_441462.1_2 Forward -95 -85 10.4031 0.011
NP_441621.1_7 Forward -97 -83 2.65453 0.123
NP_441929.1_3 Reverse -251 -270 5.80098 0.266
NP_443062.1_1 Reverse -277 -295 6.30325 0.204
NP_443062.1_1 Reverse -141 -159 5.03566 0.242
NP_442204.1_1 Reverse -82 -93 11.3667 0.0565
NP_442204.1_1 Forward -79 -68 6.25352 0.17
NP_442204.1_1 Forward -154 -143 2.51695 0.266
NP_442204.1_6 Reverse -227 -246 11.4058 0.172
NP_440516.1_8 Reverse -86 -95 16.9127 0.00442
NP_440516.1_8 Forward -95 -86 14.8477 0.00685
NP_442428.1_5 Reverse -87 -94 6.13563 0.209
NP_442428.1_5 Forward -94 -87 6.0373 0.212
NP_442428.1_5 Forward -149 -142 4.36568 0.271
NP_442428.1_5 Reverse -142 -149 4.36568 0.271
NP_441867.1_2 Forward -79 -60 -12.3902 0.253
NP_440673.1_3 Forward -93 -86 12.4288 0.0426
NP_440865.1_9 Forward -189 -170 -7.86702 0.251
NP_441052.1_2 Forward -150 -140 4.0116 0.168
NP_441052.1_2 Reverse -86 -96 0.865012 0.256
NP_441052.1_2 Forward -95 -85 0.57002 0.256
NP_440436.1_4 Reverse -278 -287 7.76745 0.124
NP_440436.1_4 Reverse -87 -96 6.39082 0.162
NP_441884.1_9 Forward -98 -79 -23.6983 0.284
NP_442864.1_7 Forward -131 -113 7.59063 0.274
NP_441719.1_4 Reverse -87 -94 6.82395 0.0855
NP_441719.1_4 Forward -94 -87 6.52896 0.188
NP_441004.1_1 Forward -88 -69 -16.9135 0.287
NP_441004.1_1 Forward -150 -131 -17.6018 0.292
NP_441004.1_4 Forward -35 -25 11.2881 0.254
NP_441115.1_4 Reverse -85 -103 7.88485 0.269
NP_442694.1_4 Forward -261 -252 12.9794 0.225
NP_442694.1_4 Forward -33 -24 12.6844 0.248
NP_442694.1_4 Forward -70 -61 11.0128 0.286
NP_442206.1_10 Forward -150 -135 7.55138 0.178
NP_443054.1_2 Reverse -84 -98 7.76774 0.14
NP_443054.1_2 Reverse -22 -36 5.99778 0.212
NP_441966.1_8 Reverse -135 -153 -5.38906 0.261
NP_441851.1_10 Forward -96 -86 7.64985 0.135
NP_440682.1_2 Reverse -178 -197 -6.98204 0.0859
NP_442814.1_10 Reverse -72 -91 5.80098 0.269
NP_440165.1_5 Forward -96 -77 -8.06369 0.288
NP_442709.1_3 Forward -135 -116 9.73422 0.121
NP_441046.1_2 Reverse -303 -322 1.67108 0.256
NP_442689.1_8 Forward -334 -317 -2.3211 0.235
NP_442689.1_8 Reverse -308 -325 -6.64766 0.286
NP_441409.1_6 Forward -101 -82 -7.08038 0.142
NP_440432.1_9 Reverse -87 -102 -3.26502 0.179
NP_440432.1_9 Forward -39 -24 -3.65835 0.187
NP_442843.1_1 Forward -177 -158 -11.5053 0.291
NP_439960.1_10 Forward -196 -178 8.27895 0.128
NP_440396.1_1 Forward -165 -146 -5.50708 0.272
NP_441124.1_5 Forward -21 -11 10.5254 0.286
NP_440431.1_3 Reverse -85 -104 -11.7019 0.29
NP_440588.1_2 Reverse -77 -96 0.294447 0.148
NP_441031.1_6 Reverse -68 -87 -0.000545616 0.296
NP_442006.1_2 Forward -150 -133 -7.13932 0.169
NP_442006.1_2 Forward -144 -127 -15.7924 0.228
NP_442006.1_2 Reverse -22 -39 -17.1691 0.27
NP_441003.1_9 Reverse -132 -151 8.45592 0.224
NP_441078.1_4 Reverse -86 -95 9.93116 0.0203
NP_441078.1_4 Forward -95 -86 9.83282 0.0226
NP_441078.1_4 Forward -150 -141 -1.6719 0.266
NP_441078.1_4 Reverse -141 -150 -1.77023 0.266
NP_441539.1_1 Reverse -7 -21 18.1901 0.284
NP_441663.1_8 Reverse -80 -99 -2.75381 0.272
NP_442348.1_2 Forward -262 -253 7.37455 0.28
NP_442443.1_1 Forward -86 -67 -5.31042 0.282
NP_440793.1_1 Forward -369 -355 16.7152 0.21
NP_440526.1_3 Reverse -87 -98 11.4645 0.0646
NP_440526.1_3 Reverse -56 -67 6.54802 0.195
NP_440526.1_3 Reverse -278 -289 0.451529 0.281
NP_441432.1_8 Reverse -85 -94 14.0611 0.0258
NP_441432.1_8 Forward -151 -142 6.19458 0.118
NP_441432.1_8 Forward -281 -272 3.24465 0.252
NP_441333.1_1 Forward -369 -359 16.6423 0.157
NP_441333.1_1 Forward -370 -360 11.7806 0.241
NP_442320.1_8 Forward -101 -87 -1.96703 0.0847
NP_441732.1_2 Reverse -82 -98 -16.3627 0.165
NP_440497.1_6 Reverse -81 -100 1.27776 0.239
NP_440321.1_1 Forward -353 -336 10.9536 0.283
NP_440760.1_1 Reverse -86 -105 -21.535 0.238
NP_440760.1_7 Forward -374 -355 18.7798 0.0275
NP_440760.1_7 Reverse -192 -211 5.2102 0.211
NP_442797.1_6 Reverse -131 -150 7.44938 0.289
NP_442797.1_7 Reverse -79 -97 4.54237 0.221
NP_440131.1_4 Reverse -134 -153 7.07928 0.243
NP_440199.1_10 Forward -283 -273 14.4347 0.0861
NP_442407.1_6 Forward -84 -65 22.3206 0.0453
NP_441023.1_1 Forward -95 -77 17.9154 0.18
NP_442400.1_10 Forward -16 -3 9.41998 0.271
NP_442400.1_10 Reverse -319 -332 8.56056 0.278
NP_442489.1_7 Forward -95 -86 10.5211 0.0102
NP_442489.1_7 Reverse -86 -95 10.4228 0.0151
NP_442489.1_7 Forward -150 -141 -1.6719 0.235
NP_442489.1_7 Reverse -141 -150 -1.77023 0.247
NP_440559.1_1 Reverse -87 -96 14.5527 0.0154
NP_441659.2_8 Forward -95 -85 17.7779 0.00179
NP_441659.2_8 Reverse -86 -96 9.81313 0.0269
NP_441659.2_8 Forward -150 -140 3.02829 0.177
NP_440426.1_7 Reverse -76 -95 10.9142 0.124
NP_439912.1_7 Reverse -66 -85 15.2408 0.208
NP_441040.1_2 Reverse -77 -96 -8.55534 0.236
NP_441968.1_1 Reverse -248 -256 15.162 0.257
NP_441968.1_1 Forward -110 -102 15.162 0.257
NP_442008.1_2 Forward -98 -79 7.37428 0.212
NP_440779.1_4 Reverse -65 -82 15.7111 0.272
NP_440779.1_5 Forward -40 -23 -5.95935 0.157
NP_442346.1_5 Forward -151 -141 13.0581 0.0301
NP_442346.1_5 Forward -96 -86 8.1415 0.146
NP_442346.1_5 Reverse -85 -95 7.15819 0.178
NP_442346.1_5 Reverse -30 -40 5.68323 0.234
NP_442346.1_5 Reverse -140 -150 5.28991 0.253
NP_442346.1_10 Reverse -173 -192 -2.0655 0.294
NP_440545.1_3 Forward -99 -82 5.25038 0.0631
NP_440545.1_3 Reverse -137 -154 4.16874 0.0738
NP_440545.1_3 Reverse -82 -99 0.825489 0.131
NP_440545.1_3 Forward -154 -137 -6.35267 0.276
NP_442934.1_1 Forward -332 -313 11.3075 0.28
NP_440459.1_2 Reverse -22 -39 10.5603 0.196
NP_440459.1_2 Reverse -84 -101 8.39697 0.264
NP_440010.1_10 Reverse -74 -93 8.35759 0.216
NP_440010.1_10 Forward -279 -260 4.32602 0.246
NP_440010.1_10 Forward -44 -25 3.24438 0.264
NP_442603.1_7 Reverse -86 -100 10.1271 0.133
NP_440449.1_6 Forward -103 -85 11.4655 0.131
NP_440170.1_6 Reverse -81 -100 11.5042 0.285
NP_441833.1_4 Forward -94 -87 6.52896 0.0924
NP_441833.1_4 Reverse -87 -94 6.23397 0.163
NP_441895.1_10 Reverse -290 -309 -27.7299 0.29
NP_442162.1_9 Forward -94 -87 12.9205 0.0282
NP_442162.1_9 Reverse -87 -94 12.9205 0.0282
NP_442199.1_5 Forward -158 -139 6.29264 0.0828
NP_442140.1_3 Forward -149 -139 8.4365 0.119
NP_442140.1_3 Reverse -87 -97 5.5849 0.202
NP_442140.1_3 Reverse -32 -42 5.09324 0.227
NP_441671.1_10 Reverse -75 -94 6.39097 0.205
NP_440875.1_9 Forward -93 -83 16.5483 0.0145
NP_440875.1_9 Reverse -143 -153 12.6548 0.106
NP_441813.1_5 Reverse -84 -94 8.4365 0.0432
NP_441813.1_5 Forward -97 -87 5.78156 0.109
NP_440590.1_4 Reverse -87 -100 14.2773 0.011
NP_440567.1_1 Forward -94 -80 0.196253 0.254
NP_440567.1_1 Reverse -87 -101 0.0979218 0.256
NP_442497.1_10 Reverse -87 -96 10.1278 0.0166
NP_442497.1_10 Forward -94 -85 7.76787 0.0731
NP_440821.1_4 Forward -97 -87 9.7148 0.0274
NP_441239.1_9 Forward -97 -85 13.2153 0.0386
NP_441239.1_9 Forward -152 -140 8.9871 0.117
NP_441239.1_9 Reverse -84 -96 6.82381 0.175
NP_441239.1_9 Reverse -29 -41 6.43049 0.189
NP_441239.1_9 Reverse -139 -151 3.48056 0.285
NP_441951.1_6 Reverse -63 -82 14.2574 0.197
NP_441727.1_3 Reverse -134 -153 3.83436 0.275
NP_441892.1_1 Forward -159 -142 3.28376 0.128
NP_441892.1_1 Reverse -22 -39 -3.00942 0.231
NP_442044.1_1 Forward -95 -76 -5.60541 0.188
NP_442044.1_1 Forward -64 -45 -11.4069 0.271
NP_442270.1_9 Reverse -283 -302 2.26107 0.14
NP_440833.1_6 Forward -19 -5 10.717 0.242
NP_442138.1_9 Forward -108 -89 7.17681 0.299
NP_440546.1_4 Reverse -86 -96 13.8273 0.0459
NP_440546.1_4 Forward -40 -30 12.373 0.0679
NP_440546.1_4 Forward -95 -85 10.9186 0.101
NP_440546.1_4 Reverse -31 -41 6.8464 0.276
NP_440462.1_6 Reverse -84 -94 9.22315 0.049
NP_440462.1_6 Forward -97 -87 7.45319 0.0788
NP_442611.1_1 Forward -95 -76 19.6656 0.0372
NP_442611.1_3 Forward -74 -56 17.1287 0.159
NP_440868.1_4 Reverse -82 -94 12.527 0.0235
NP_442499.1_4 Forward -42 -28 11.0127 0.226
NP_440270.1_6 Reverse -130 -149 9.53756 0.254
NP_442402.1_2 Forward -367 -353 13.4703 0.263
NP_441848.1_4 Forward -27 -11 10.2244 0.261
NP_440653.1_10 Forward -81 -62 2.75272 0.288
NP_440696.1_3 Forward -160 -142 -1.16082 0.251
NP_440696.1_3 Forward -290 -272 -2.83245 0.279
NP_442023.1_2 Reverse -23 -42 7.66927 0.255
NP_442039.1_4 Reverse -87 -94 11.6422 0.0747
NP_442625.1_4 Forward -248 -229 2.55606 0.288
NP_442837.1_3 Forward -94 -87 6.0373 0.25
NP_442837.1_3 Reverse -87 -94 6.0373 0.25
NP_442837.1_3 Forward -58 -51 5.84064 0.272
NP_440160.1_2 Forward -156 -137 -5.11376 0.269
NP_442053.1_1 Forward -95 -86 16.6177 0.00257
NP_442053.1_1 Reverse -86 -95 8.65285 0.0741
NP_440505.1_3 Reverse -84 -94 15.6147 0.0106
NP_440505.1_3 Forward -72 -62 5.28991 0.236
NP_440505.1_7 Reverse -68 -87 2.26107 0.237
NP_442844.1_5 Forward -322 -303 1.47364 0.271
NP_441408.2_7 Forward -152 -133 6.09597 0.172
NP_441408.2_7 Reverse -243 -262 -5.21209 0.292
NP_440914.1_1 Forward -95 -85 14.373 0.0158
NP_441699.1_2 Forward -119 -100 10.2259 0.252
NP_441011.1_8 Reverse -87 -96 10.8161 0.094
NP_441011.1_8 Forward -94 -85 6.78456 0.184
NP_442101.1_10 Reverse -78 -97 -4.81876 0.151
NP_442533.1_1 Forward -78 -59 -14.7502 0.247
NP_442533.1_1 Forward -87 -68 -16.5201 0.271
NP_442533.1_6 Forward -95 -86 14.2577 0.0132
NP_442533.1_6 Reverse -31 -40 11.5045 0.0432
NP_442533.1_6 Reverse -86 -95 7.47288 0.0898
NP_442533.1_6 Forward -150 -141 7.17789 0.0948
NP_442533.1_6 Reverse -141 -150 6.68623 0.105
NP_442533.1_6 Reverse -258 -267 2.06468 0.275
NP_441089.1_10 Reverse -75 -94 1.37609 0.294
NP_442541.1_10 Reverse -141 -155 3.73557 0.252
NP_441482.1_7 Forward -101 -87 -9.93184 0.209
NP_439944.1_9 Reverse -87 -97 8.1415 0.116
NP_441028.1_6 Forward -362 -352 5.48612 0.255
NP_441028.1_6 Forward -363 -353 5.38779 0.255
NP_440116.1_8 Forward -94 -75 -2.55715 0.135
NP_441527.1_5 Reverse -354 -373 11.8235 0.297
NP_440115.1_6 Reverse -83 -93 14.0414 0.0615
NP_440007.1_4 Forward -161 -142 9.24257 0.274
NP_440007.1_9 Forward -99 -85 3.04785 0.277
NP_440007.1_9 Forward -154 -140 1.47456 0.285
NP_442728.1_7 Reverse -24 -38 17.6992 0.17
NP_441106.1_1 Reverse -85 -94 8.75118 0.0469
NP_441106.1_1 Forward -151 -142 5.50626 0.145
NP_441869.1_4 Forward -386 -367 7.96426 0.276
NP_442306.1_10 Reverse -81 -100 -21.6334 0.282
NP_441286.1_1 Reverse -85 -97 5.34885 0.0259
NP_440670.1_8 Reverse -86 -95 18.0926 0.00136
NP_440670.1_8 Forward -95 -86 15.831 0.00494
NP_441479.1_1 Forward -98 -79 23.4022 0.0244
NP_441647.1_1 Forward -197 -178 14.6508 0.174
NP_440886.1_7 Forward -96 -86 6.76441 0.114
NP_442614.1_2 Forward -84 -70 6.29277 0.291
NP_442614.1_2 Reverse -86 -100 5.80112 0.297
NP_440404.1_9 Reverse -356 -375 8.54611 0.242
NP_442072.1_9 Reverse -85 -103 -3.52077 0.0363
NP_442072.1_9 Forward -96 -78 -21.2203 0.206
NP_442401.1_2 Forward -396 -377 8.25844 0.248
NP_440907.2_8 Reverse -51 -61 10.1076 0.103
NP_440907.2_8 Reverse -87 -97 9.91099 0.103
NP_440907.2_8 Forward -94 -84 7.84605 0.117
NP_441626.1_2 Reverse -87 -94 12.2322 0.0511
NP_441626.1_2 Forward -94 -87 5.93897 0.231
NP_441626.1_6 Forward -99 -81 14.6697 0.169
NP_442365.1_7 Reverse -267 -286 -6.39206 0.292
NP_442794.1_1 Reverse -137 -149 8.79043 0.0914
NP_442615.1_1 Reverse -77 -95 -2.14413 0.139
NP_441962.1_4 Forward -155 -136 -15.1435 0.299
NP_440387.1_1 Forward -95 -79 -2.20308 0.147
NP_440855.1_5 Reverse -231 -250 1.6703 0.295
NP_441431.1_2 Reverse -83 -97 10.717 0.155
NP_441431.1_2 Forward -153 -139 10.422 0.159
NP_441993.1_1 Forward -39 -20 3.506 0.233
NP_441993.1_1 Reverse -135 -154 2.72635 0.254
NP_441993.1_1 Forward -101 -82 2.62889 0.256
NP_440143.1_1 Reverse -377 -396 14.5524 0.246
NP_440358.1_8 Forward -266 -247 0.982764 0.258
NP_440114.1_10 Forward -40 -26 12.7826 0.0731
NP_440114.1_10 Reverse -86 -100 6.6861 0.26
NP_440114.1_10 Forward -267 -253 6.48943 0.269
NP_441858.1_6 Forward -144 -125 16.2241 0.0751
NP_442323.1_7 Reverse -81 -100 10.4217 0.147
NP_442323.1_7 Reverse -55 -74 2.06362 0.273
NP_442357.1_8 Reverse -325 -344 6.58763 0.241
NP_440287.1_6 Forward -104 -85 1.67108 0.266
NP_439988.1_3 Forward -44 -30 7.07942 0.278
NP_441237.1_9 Reverse -87 -97 14.533 0.0323
NP_442930.1_1 Reverse -161 -171 10.796 0.275
NP_441133.1_1 Forward -273 -254 12.4875 0.269
NP_439910.1_2 Forward -103 -86 -12.9408 0.113
NP_440457.1_1 Reverse -82 -94 12.527 0.092
NP_440457.1_1 Forward -99 -87 5.34885 0.141
NP_440457.1_1 Forward -284 -272 -1.23932 0.3
NP_440798.1_6 Forward -94 -81 9.85238 0.0874
NP_442680.1_7 Reverse -347 -366 -3.54046 0.265
NP_440801.1_9 Reverse -139 -153 17.2953 0.227
NP_441889.1_4 Reverse -77 -96 1.67108 0.289
NP_442509.1_9 Reverse -86 -96 14.6309 0.0263
NP_441496.1_1 Forward -265 -251 13.094 0.295
NP_443037.1_7 Forward -350 -331 5.11266 0.276
NP_440185.1_9 Forward -90 -73 13.7068 0.264
NP_440554.1_4 Forward -94 -84 15.0247 0.02
NP_440554.1_4 Reverse -142 -152 5.28991 0.153
NP_441885.1_5 Reverse -86 -96 9.12481 0.0238
NP_441885.1_5 Forward -95 -85 1.55333 0.109
NP_442341.1_7 Reverse -85 -99 7.17775 0.11
NP_442341.1_9 Reverse -84 -98 11.9953 0.115
NP_441756.1_5 Forward -99 -80 12.8808 0.0961
NP_441756.1_5 Reverse -113 -132 1.37609 0.217
NP_441173.1_9 Forward -320 -312 11.7204 0.226
NP_443000.1_7 Reverse -84 -94 10.5998 0.0345
NP_443000.1_7 Forward -152 -142 0.766681 0.29
NP_440275.1_3 Reverse -84 -94 13.5497 0.0268
NP_440275.1_3 Forward -97 -87 9.91146 0.046
NP_440091.1_1 Forward -290 -278 2.98891 0.176
NP_442354.1_8 Reverse -168 -187 7.47261 0.266
NP_442354.1_8 Reverse -102 -121 6.98095 0.266
NP_441397.1_8 Reverse -353 -366 17.3458 0.142
NP_441397.1_8 Forward -23 -10 14.5765 0.189
NP_442451.1_2 Reverse -194 -213 -8.16202 0.241
NP_441122.1_1 Forward -44 -29 11.583 0.2
NP_441207.1_7 Reverse -358 -372 16.9036 0.179
NP_442214.1_1 Forward -75 -56 14.4541 0.187
NP_441105.1_3 Forward -161 -142 0.392778 0.125
NP_441105.1_3 Forward -106 -87 -6.58872 0.236
NP_441105.1_3 Reverse -228 -247 -8.65367 0.275
NP_440216.1_1 Forward -95 -81 23.9923 0.000628
NP_440216.1_1 Reverse -86 -100 -11.2101 0.169
NP_440216.1_2 Forward -24 -5 17.994 0.102
NP_440216.1_3 Forward -121 -105 25.6246 0.00482
NP_440216.1_8 Forward -354 -337 19.2134 0.161
NP_440216.1_9 Forward -148 -139 16.9127 0.116
NP_440216.1_9 Reverse -33 -42 7.37455 0.286
NP_440216.1_9 Reverse -212 -221 7.17789 0.286
NP_440216.1_9 Reverse -247 -256 5.80125 0.289
NP_440216.1_9 Forward -111 -102 5.80125 0.289
NP_440172.1_1 Forward -95 -85 14.6313 0.011
NP_440172.1_1 Reverse -86 -96 6.56821 0.102
NP_440172.1_1 Reverse -31 -41 1.94665 0.29
NP_442371.1_1 Reverse -213 -223 11.8776 0.273
NP_441350.1_2 Reverse -78 -97 19.174 0.219
NP_442015.1_10 Reverse -137 -150 9.75405 0.0449
NP_442015.1_10 Forward -99 -86 1.9859 0.204
NP_441226.1_7 Reverse -87 -94 12.7234 0.0312
NP_441226.1_7 Forward -94 -87 11.5435 0.0757
NP_440198.1_2 Reverse -225 -244 18.5047 0.206
NP_441111.1_7 Reverse -87 -95 8.96754 0.0463
NP_441111.1_7 Forward -94 -86 8.86921 0.0589
NP_442379.1_10 Reverse -79 -96 0.235503 0.223
NP_441766.1_2 Forward -95 -86 13.9627 0.0114
NP_441766.1_2 Reverse -86 -95 7.76787 0.0714
NP_442252.1_4 Forward -81 -62 12.4875 0.278
NP_440416.1_9 Reverse -79 -98 -8.26035 0.112
NP_440416.1_9 Reverse -134 -153 -17.4051 0.239
NP_440416.1_9 Reverse -112 -131 -20.1584 0.282
NP_443052.1_9 Reverse -113 -132 0.196116 0.201
NP_443052.1_9 Reverse -125 -144 -1.18052 0.223
NP_441974.1_1 Forward -22 -5 13.4119 0.292
NP_442154.1_1 Reverse -376 -394 -17.2871 0.251
NP_442154.1_1 Forward -80 -62 -19.0571 0.289
NP_440261.1_5 Reverse -87 -100 -2.93064 0.0983
NP_440261.1_5 Forward -94 -81 -3.22564 0.12
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTATGCCACTAGGTTCCACACCCCTGAGTATTTTTATTTTTCCCCTGAAACTTTGGAATTTGCCGGTTTTAGGTTAAATTTCAACCAATACTCTCCCGTAATTCCCAATGAGCAAGGATGGCTATGGAGTGAGGCGCTGGGATTTTTTCTTGGCATCCACCAGGGTCAGTTGCGCTATTTTTCCGTGGAGGGAATTTTAGTACCTACCCCTGAGGAGGCGGCCCAACAGGAAATATTGAGGCCTGACCAGGCCATGGCAAAGGTAGAGCAGGAGGCTCAACGGGCGGACCAAGAAAAATTCAGGGCCGATCGCCTGGCGGCCAAGCTGAGGGAGTTGGGATTGGATCCCGATGATGTTTAGCCATGGGCCTTTGGGCGTAGCAAAAATTGACCTCAAGT

CDS

ATGAAAACTTCCCCCCCAGAACTGATTATTGAAGCAGGACGCACGGAGCGTCAGTATTGGCAAGACCTATGGCGTTACCGGGAATTGTTTTACACCCTGGCTTGGCGGGACATTGCGGTACGGTACAAACAAACGGCGATCGGTATAGCTTGGGCCTTAATCCGGCCATTTTTGACCATGGTGGTGTTTACGGTGGTATTTGGTAAGTTGGCTAATTTACCTTCGGAGGGGGTGCCCTATCCCATTCTGGTGTTTGCGGGAATGTTGCCCTGGCAGTTTTTTTCCACTTCCCTTAGTTCCGCCAGCGATAGTCTAATTGCCAATGCCAATCTAATTTCTAAGGTGTATTTTCCTCGCTTAGTGGTGCCTACCAGTGCCGTGGTGACTAGCTTTGTTGATTTTTTAATTTCTGGGATGATTATGTTGGGGCTGATGGCTTGGTATAATTTCTTGCCCAGTTGGCATGTGATTACATTGCCTTTCTTCATTTTGATTGCCTTTATGGCTTCCATGGGAGCAGGGTTATGGCTTTGTTCCCTCAATGTCAAATACCGAGATTTTCGCTACATTGTGCCATTCATTGTCCAATTTGGTTTGTACATTTCCCCGGTGGGTTTTAGTAGTAATGTGGTGCCGGAAAAATGGCGATTGCTCTATTCCATTAACCCGATGGTGAGTGTAATTGATGGTTTTCGTTGGGCGATTTTGGGGGGAGAATCAACTATATTTCTGCCGGGTTTTTTGTTGTCTTTACTGTTGGTGATCATTATTTTTATAACAGGAATTCTCTATTTTCGTAAGATGGAACGCACCTTCGCTGATGTGATTTAA

Protein

MKTSPPELIIEAGRTERQYWQDLWRYRELFYTLAWRDIAVRYKQTAIGIAWALIRPFLTMVVFTVVFGKLANLPSEGVPYPILVFAGMLPWQFFSTSLSSASDSLIANANLISKVYFPRLVVPTSAVVTSFVDFLISGMIMLGLMAWYNFLPSWHVITLPFFILIAFMASMGAGLWLCSLNVKYRDFRYIVPFIVQFGLYISPVGFSSNVVPEKWRLLYSINPMVSVIDGFRWAILGGESTIFLPGFLLSLLLVIIIFITGILYFRKMERTFADVI