Your browser is old and dusty. Try Google Chrome!

Details for slr0971

ORF slr0971
Accession NP_440199.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -288 -302 12.4876 0.0464
NP_440795.1_7 Forward -295 -288 14.6904 0.0123
NP_440795.1_7 Reverse -288 -295 14.6904 0.0123
NP_440795.1_7 Reverse -365 -372 9.77388 0.169
NP_441418.1_6 Reverse -287 -306 -18.9784 0.0841
NP_441418.1_6 Reverse -271 -290 -19.0768 0.0844
NP_441418.1_6 Forward -296 -277 -29.9915 0.249
NP_441418.1_6 Forward -289 -270 -30.6798 0.291
NP_442291.1_5 Forward -297 -281 10.5799 0.0434
NP_442291.1_5 Reverse -286 -302 4.87675 0.0841
NP_442272.1_2 Reverse -134 -153 14.9441 0.173
NP_440897.1_6 Reverse -287 -306 1.17865 0.171
NP_441453.1_4 Reverse -287 -295 16.539 0.00633
NP_441453.1_4 Forward -296 -288 16.539 0.00633
NP_441623.1_1 Forward -130 -112 -3.32411 0.258
NP_442151.1_6 Reverse -287 -301 10.6193 0.119
NP_442151.1_6 Forward -296 -282 8.75105 0.164
NP_441818.1_1 Reverse -288 -299 18.8393 0.00301
NP_441818.1_1 Forward -295 -284 9.79292 0.232
NP_440226.1_1 Forward -296 -277 7.47261 0.105
NP_441465.1_8 Forward -307 -289 13.3922 0.17
NP_440150.1_6 Forward -283 -264 2.94938 0.263
NP_442173.1_1 Forward -295 -287 15.4574 0.00633
NP_442173.1_1 Reverse -288 -296 15.4574 0.00633
NP_442752.1_4 Forward -296 -289 13.8055 0.0199
NP_442752.1_4 Reverse -287 -294 13.8055 0.0199
NP_443027.1_4 Forward -298 -288 14.0414 0.0452
NP_441745.1_3 Reverse -108 -127 18.0915 0.201
NP_442975.1_10 Forward -300 -286 13.4703 0.0459
NP_442975.1_10 Reverse -283 -297 1.76896 0.291
NP_440784.1_7 Forward -295 -288 15.9687 0.0123
NP_440784.1_7 Reverse -288 -295 15.9687 0.0123
NP_442909.1_7 Forward -295 -281 10.0287 0.14
NP_440061.1_9 Forward -298 -284 12.6836 0.0927
NP_440061.1_9 Reverse -167 -181 5.70218 0.275
NP_441054.1_2 Reverse -336 -355 10.3242 0.284
NP_439979.1_7 Forward -290 -273 14.6902 0.267
NP_440878.1_9 Reverse -381 -400 -2.95047 0.281
NP_442062.1_8 Forward -296 -286 17.3846 0.00193
NP_442062.1_8 Reverse -287 -297 17.3846 0.00193
NP_441859.1_3 Forward -290 -271 9.83173 0.125
NP_440304.1_4 Forward -298 -288 10.8948 0.051
NP_440304.1_4 Reverse -285 -295 1.84832 0.299
NP_442242.1_4 Forward -295 -288 14.3954 0.0124
NP_442242.1_4 Reverse -288 -295 14.3954 0.0124
NP_440044.1_8 Reverse -288 -307 11.5042 0.0497
NP_440044.1_8 Forward -295 -276 -3.73712 0.29
NP_441935.1_1 Forward -84 -65 5.70265 0.292
NP_441208.1_9 Reverse -284 -298 6.48943 0.244
NP_441594.1_6 Forward -305 -286 2.16274 0.255
NP_441594.1_6 Forward -187 -168 1.76941 0.262
NP_440132.1_1 Forward -396 -378 13.3922 0.172
NP_442110.1_7 Reverse -287 -301 10.0294 0.0684
NP_442726.1_7 Reverse -378 -396 19.0954 0.0738
NP_440856.1_7 Reverse -208 -227 9.14423 0.116
NP_440856.1_7 Reverse -265 -284 1.27776 0.161
NP_441083.1_5 Forward -296 -286 20.3345 0.00053
NP_441083.1_5 Reverse -287 -297 20.3345 0.00053
NP_441083.1_5 Reverse -169 -179 4.20827 0.153
NP_441738.1_2 Forward -294 -287 15.28 0.0102
NP_441738.1_2 Reverse -289 -296 15.28 0.0102
NP_441558.1_5 Forward -298 -279 12.5858 0.0675
NP_440209.1_1 Reverse -287 -295 18.1123 0.00295
NP_440209.1_1 Forward -296 -288 18.1123 0.00295
NP_442889.1_8 Forward -299 -285 13.1753 0.0588
NP_440447.1_1 Reverse -121 -139 13.0972 0.125
NP_441713.1_1 Forward -302 -283 -6.1954 0.118
NP_441770.1_4 Forward -216 -197 -6.88371 0.228
NP_440178.1_7 Forward -297 -278 -21.4367 0.223
NP_442461.1_4 Reverse -283 -302 11.9958 0.214
NP_440538.1_2 Reverse -180 -199 9.53674 0.276
NP_441716.1_1 Forward -296 -282 16.3225 0.0392
NP_441716.1_1 Reverse -287 -301 12.586 0.0741
NP_442111.1_4 Forward -297 -283 8.06273 0.081
NP_442111.1_4 Reverse -11 -25 5.21113 0.172
NP_442111.1_4 Reverse -248 -262 5.01447 0.181
NP_442111.1_4 Reverse -286 -300 3.14618 0.253
NP_440343.1_9 Reverse -277 -296 6.4893 0.3
NP_440906.1_5 Forward -295 -288 15.8704 0.0124
NP_440906.1_5 Reverse -288 -295 15.8704 0.0124
NP_441209.1_5 Reverse -125 -144 18.289 0.109
NP_440747.1_10 Reverse -284 -296 14.9853 0.00221
NP_440747.1_10 Forward -299 -287 7.51213 0.00286
NP_440747.1_10 Reverse -246 -258 -4.48425 0.101
NP_441130.1_10 Forward -298 -284 8.45605 0.135
NP_441486.1_1 Forward -299 -285 23.5007 0.00162
NP_441486.1_1 Reverse -284 -298 21.2391 0.00239
NP_441486.1_1 Forward -397 -383 -5.90027 0.266
NP_440403.1_4 Forward -305 -286 1.47442 0.136
NP_440842.1_6 Forward -291 -272 16.9115 0.121
NP_441014.1_10 Reverse -286 -305 9.53674 0.123
NP_441014.1_10 Forward -269 -250 3.83357 0.206
NP_442848.1_1 Forward -302 -288 15.9292 0.0143
NP_442848.1_1 Reverse -281 -295 -2.36035 0.263
NP_442848.1_5 Forward -172 -154 2.96908 0.276
NP_441012.1_4 Reverse -381 -394 9.2624 0.272
NP_441012.1_4 Reverse -180 -193 8.08242 0.272
NP_441012.1_4 Reverse -273 -286 7.00078 0.272
NP_441012.1_4 Reverse -267 -280 6.4108 0.279
NP_443018.1_3 Forward -295 -288 14.8871 0.0123
NP_443018.1_3 Reverse -288 -295 14.8871 0.0123
NP_443018.1_3 Forward -201 -194 5.34899 0.212
NP_441634.1_8 Forward -298 -284 2.94952 0.158
NP_441634.1_8 Reverse -285 -299 -4.62196 0.295
NP_441182.1_7 Reverse -134 -147 18.8988 0.234
NP_440376.1_1 Forward -296 -287 19.4693 0.000692
NP_440376.1_1 Reverse -287 -296 19.4693 0.000692
NP_440376.1_1 Forward -394 -385 4.81794 0.149
NP_441588.1_4 Forward -294 -284 8.92815 0.14
NP_441588.1_4 Reverse -289 -299 8.63316 0.14
NP_442687.1_7 Forward -297 -287 8.92815 0.0994
NP_442687.1_7 Reverse -286 -296 8.92815 0.0994
NP_442687.1_7 Reverse -384 -394 5.28991 0.211
NP_442191.1_4 Reverse -117 -131 11.8657 0.238
NP_441077.1_6 Forward -100 -84 2.22343 0.288
NP_442485.1_3 Forward -291 -272 -4.03212 0.277
NP_441846.1_10 Reverse -270 -289 -16.4218 0.256
NP_440042.1_2 Reverse -207 -226 7.17762 0.184
NP_441422.1_3 Forward -186 -167 16.0637 0.218
NP_442658.1_1 Forward -304 -294 9.41933 0.157
NP_442658.1_1 Reverse -285 -295 6.76441 0.214
NP_442658.1_1 Forward -298 -288 6.76441 0.214
NP_442782.1_2 Forward -232 -218 0.294584 0.291
NP_442782.1_7 Forward -304 -285 0.982764 0.207
NP_442205.1_9 Reverse -281 -297 -2.98973 0.277
NP_441414.1_9 Forward -296 -277 -3.63879 0.14
NP_441414.1_9 Reverse -293 -312 -4.81876 0.162
NP_440607.1_5 Forward -283 -264 7.96426 0.165
NP_442937.1_5 Forward -301 -282 6.29264 0.282
NP_441317.1_4 Reverse -346 -360 11.3738 0.253
NP_441958.1_5 Forward -297 -287 12.2714 0.00183
NP_441958.1_5 Reverse -286 -296 12.2714 0.00183
NP_442836.1_5 Reverse -281 -300 1.0811 0.288
NP_440203.1_1 Forward -295 -276 20.649 0.138
NP_440203.1_5 Forward -112 -102 9.81266 0.245
NP_440203.1_5 Forward -293 -283 9.71433 0.245
NP_439905.1_1 Reverse -294 -307 11.1307 0.204
NP_439990.1_5 Forward -301 -288 10.049 0.128
NP_442911.1_2 Reverse -277 -296 -2.55715 0.0995
NP_440153.1_5 Forward -295 -281 2.94952 0.219
NP_440153.1_5 Forward -400 -386 2.16287 0.237
NP_440153.1_8 Reverse -265 -278 -3.4223 0.295
NP_442064.1_4 Forward -306 -287 8.16011 0.235
NP_443055.1_3 Reverse -278 -297 15.8971 0.0848
NP_443055.1_6 Reverse -257 -275 5.1316 0.181
NP_443055.1_6 Reverse -371 -389 1.69003 0.225
NP_441429.1_7 Reverse -369 -387 18.997 0.278
NP_440138.1_6 Forward -301 -282 5.2102 0.23
NP_441099.1_5 Forward -306 -287 2.85105 0.0535
NP_441099.1_5 Reverse -277 -296 -8.35868 0.193
NP_441294.1_7 Reverse -283 -297 20.5773 0.00181
NP_441294.1_7 Forward -300 -286 14.242 0.0448
NP_441646.1_1 Reverse -280 -299 9.53756 0.127
NP_441646.1_7 Reverse -380 -394 18.5841 0.133
NP_442438.1_10 Forward -301 -287 6.29277 0.118
NP_442438.1_10 Reverse -282 -296 3.04785 0.166
NP_441000.1_6 Forward -297 -283 -5.01529 0.257
NP_442771.1_1 Reverse -65 -83 -10.5023 0.265
NP_440147.1_4 Reverse -285 -298 11.3273 0.0326
NP_440147.1_4 Forward -298 -285 2.18257 0.209
NP_441550.1_8 Reverse -285 -295 14.6309 0.0132
NP_441550.1_8 Forward -298 -288 12.3692 0.0336
NP_441550.1_8 Forward -180 -170 8.82935 0.112
NP_441916.1_7 Forward -296 -286 10.3048 0.0261
NP_441916.1_7 Reverse -287 -297 10.3048 0.0261
NP_441916.1_7 Forward -394 -384 3.22496 0.223
NP_440206.1_4 Forward -284 -265 -0.689632 0.29
NP_441041.1_4 Reverse -287 -306 -4.03212 0.128
NP_441041.1_4 Forward -296 -277 -7.67036 0.191
NP_442396.1_5 Reverse -283 -296 10.7374 0.106
NP_442996.1_1 Forward -154 -135 4.53544 0.265
NP_442004.1_6 Forward -296 -282 8.35772 0.142
NP_442004.1_6 Forward -81 -67 2.45787 0.264
NP_442004.1_6 Reverse -287 -301 1.76955 0.278
NP_441725.1_5 Reverse -288 -298 11.2881 0.0247
NP_441725.1_5 Forward -295 -285 2.04498 0.115
NP_439966.1_7 Forward -298 -288 15.8108 0.0124
NP_439966.1_7 Reverse -285 -295 7.25606 0.15
NP_442941.1_3 Reverse -288 -298 19.9412 0.00262
NP_442941.1_3 Forward -295 -285 11.0914 0.0116
NP_440289.1_2 Forward -299 -286 13.294 0.0132
NP_440289.1_2 Forward -397 -384 -4.11062 0.28
NP_440289.1_2 Reverse -284 -297 -4.89726 0.294
NP_440260.1_8 Reverse -278 -296 -3.22577 0.25
NP_440260.1_8 Forward -382 -364 -4.40575 0.272
NP_440260.1_8 Forward -277 -259 -7.15901 0.295
NP_442281.1_1 Forward -301 -287 17.5018 0.00555
NP_441556.1_10 Reverse -281 -295 10.5138 0.267
NP_440375.1_8 Forward -295 -276 6.09597 0.168
NP_441644.1_6 Forward -296 -286 17.3841 0.00127
NP_441644.1_6 Reverse -287 -297 17.3841 0.00127
NP_441644.1_6 Reverse -364 -374 4.99446 0.216
NP_440867.1_3 Forward -133 -114 9.53756 0.244
NP_442215.1_2 Reverse -285 -301 14.7098 0.0195
NP_442215.1_2 Forward -298 -282 -4.66135 0.237
NP_442177.1_5 Reverse -342 -356 12.1926 0.22
NP_442029.1_1 Forward -276 -257 -12.8819 0.26
NP_440253.1_2 Reverse -287 -305 12.6055 0.027
NP_440929.1_8 Forward -296 -287 19.2726 0.000701
NP_440929.1_8 Reverse -287 -296 19.2726 0.000701
NP_440780.1_1 Reverse -37 -56 9.11906 0.274
NP_440780.1_1 Reverse -136 -155 8.06865 0.274
NP_442933.1_10 Forward -296 -287 17.601 0.00325
NP_442933.1_10 Reverse -287 -296 17.601 0.00325
NP_441751.2_8 Forward -295 -281 7.27608 0.0339
NP_441751.2_8 Reverse -288 -302 5.70279 0.0416
NP_442554.1_8 Reverse -288 -298 15.9097 0.00747
NP_442554.1_8 Forward -295 -285 15.3197 0.00882
NP_441762.1_7 Forward -297 -285 0.432302 0.0747
NP_441762.1_7 Reverse -286 -298 -6.84419 0.284
NP_442142.1_4 Forward -299 -286 14.1783 0.0311
NP_442142.1_4 Reverse -262 -275 12.2117 0.0464
NP_442142.1_4 Reverse -376 -389 5.62358 0.187
NP_442142.1_4 Reverse -284 -297 3.06699 0.268
NP_442292.1_1 Forward -295 -286 18.486 0.00229
NP_442292.1_1 Reverse -288 -297 18.486 0.00229
NP_442143.1_10 Forward -295 -276 15.8307 0.183
NP_443009.1_5 Reverse -286 -297 8.90795 0.0965
NP_443009.1_5 Forward -297 -286 8.90795 0.0965
NP_441715.1_4 Reverse -288 -298 14.828 0.0268
NP_441715.1_4 Forward -295 -285 7.94484 0.107
NP_440379.1_5 Forward -397 -378 4.52268 0.136
NP_440464.1_10 Forward -257 -247 13.8676 0.169
NP_440464.1_10 Forward -295 -285 13.0082 0.169
NP_441468.1_1 Forward -295 -288 15.8704 0.0124
NP_441468.1_1 Reverse -288 -295 15.8704 0.0124
NP_441020.2_6 Forward -396 -379 9.97027 0.156
NP_441015.1_10 Forward -183 -164 1.67108 0.158
NP_441673.1_1 Forward -296 -287 20.8459 0.000698
NP_441673.1_1 Reverse -287 -296 20.8459 0.000698
NP_441673.1_1 Forward -394 -385 -7.86675 0.187
NP_441673.1_1 Reverse -385 -394 -7.96508 0.206
NP_441826.1_2 Forward -302 -288 12.586 0.0267
NP_441826.1_2 Reverse -281 -295 3.63784 0.107
NP_441826.1_2 Reverse -287 -301 -0.590395 0.215
NP_441826.1_5 Reverse -266 -285 7.86593 0.221
NP_441330.1_1 Forward -98 -79 -15.7335 0.294
NP_442490.1_9 Reverse -259 -278 -8.45701 0.291
NP_442868.1_6 Forward -298 -288 9.91146 0.038
NP_442868.1_6 Reverse -285 -295 9.81313 0.038
NP_442719.1_2 Reverse -364 -382 -10.7979 0.283
NP_441612.1_2 Reverse -287 -297 8.54929 0.21
NP_441612.1_2 Forward -296 -286 8.54929 0.21
NP_441612.1_2 Reverse -249 -259 6.32259 0.294
NP_442361.1_3 Forward -302 -289 7.98409 0.285
NP_442808.1_1 Reverse -286 -296 8.63269 0.0481
NP_442808.1_1 Forward -297 -287 8.63269 0.0481
NP_441101.1_10 Forward -300 -281 -7.4737 0.29
NP_440145.1_3 Forward -306 -287 4.32602 0.087
NP_440145.1_3 Reverse -277 -296 -0.000545616 0.138
NP_442050.1_5 Forward -298 -288 16.4991 0.00812
NP_442050.1_5 Reverse -285 -295 7.64939 0.243
NP_442050.1_8 Forward -190 -171 16.0302 0.272
NP_441114.1_3 Forward -113 -104 7.27622 0.247
NP_440558.1_2 Forward -305 -286 -1.08219 0.208
NP_440558.1_2 Forward -277 -258 -3.63879 0.237
NP_440558.1_2 Forward -244 -225 -3.93378 0.239
NP_442789.1_4 Forward -234 -215 -0.688862 0.209
NP_441518.1_3 Forward -306 -287 -4.42544 0.12
NP_442792.1_5 Reverse -101 -118 16.0668 0.222
NP_441878.1_6 Forward -297 -287 10.4031 0.0176
NP_441878.1_6 Reverse -286 -296 10.4031 0.0176
NP_441878.1_6 Reverse -384 -394 0.865012 0.132
NP_441878.1_6 Forward -395 -385 -7.00147 0.201
NP_441878.1_8 Forward -186 -172 18.3875 0.184
NP_441036.1_8 Forward -297 -287 8.33817 0.174
NP_441036.1_8 Reverse -286 -296 8.33817 0.174
NP_442503.1_9 Forward -227 -208 8.45592 0.221
NP_441557.1_5 Forward -296 -287 19.9609 0.000699
NP_441557.1_5 Reverse -287 -296 19.9609 0.000699
NP_441445.1_1 Reverse -278 -297 19.469 0.0276
NP_441445.1_1 Forward -187 -168 8.65258 0.117
NP_442267.1_4 Reverse -377 -396 5.211 0.198
NP_442267.1_4 Reverse -308 -327 5.11266 0.198
NP_442066.2_4 Reverse -287 -306 -9.24366 0.296
NP_441458.1_10 Forward -305 -286 2.55606 0.269
NP_441458.1_10 Reverse -240 -259 2.26107 0.272
NP_442183.1_1 Reverse -287 -301 18.3875 0.00758
NP_441407.1_5 Forward -306 -287 4.12936 0.253
NP_441574.1_1 Forward -385 -366 -7.17871 0.286
NP_442347.1_2 Forward -295 -286 12.4878 0.056
NP_442347.1_2 Reverse -288 -297 12.4878 0.056
NP_442347.1_2 Forward -257 -248 4.71961 0.266
NP_442645.1_2 Reverse -279 -298 4.62101 0.0235
NP_442645.1_2 Reverse -64 -83 -18.4868 0.274
NP_442645.1_2 Reverse -154 -173 -22.8133 0.296
NP_440547.1_1 Forward -285 -266 21.1397 0.052
NP_441037.1_4 Reverse -285 -295 7.9999 0.237
NP_441633.1_3 Reverse -285 -298 1.10092 0.109
NP_441633.1_3 Forward -298 -285 -5.97891 0.236
NP_440136.1_2 Forward -295 -288 15.9687 0.0123
NP_440136.1_2 Reverse -288 -295 15.9687 0.0123
NP_442590.1_10 Forward -190 -171 5.211 0.267
NP_442590.1_10 Forward -296 -277 3.6377 0.289
NP_442590.1_10 Forward -277 -258 3.53937 0.29
NP_442998.1_10 Forward -294 -287 15.5754 0.0102
NP_442998.1_10 Reverse -289 -296 15.5754 0.0102
NP_440899.1_1 Reverse -367 -386 10.0665 0.196
NP_440299.1_1 Reverse -283 -296 16.2433 0.0109
NP_440299.1_1 Forward -300 -287 14.08 0.0259
NP_440299.1_1 Reverse -381 -394 4.93527 0.193
NP_441799.1_1 Reverse -283 -297 18.5835 0.00832
NP_441799.1_1 Forward -300 -286 3.44058 0.298
NP_441007.1_10 Forward -301 -288 0.412608 0.23
NP_442333.2_5 Forward -291 -272 -11.2103 0.246
NP_440256.1_1 Reverse -284 -303 6.19431 0.0314
NP_440256.1_1 Forward -96 -77 -5.50708 0.184
NP_441957.1_7 Reverse -305 -324 20.5506 0.093
NP_440087.1_1 Reverse -278 -297 -0.197208 0.175
NP_441559.1_8 Reverse -282 -296 0.392915 0.167
NP_440915.1_6 Forward -300 -286 4.52282 0.0953
NP_442785.1_7 Forward -298 -284 10.7177 0.228
NP_441704.1_8 Forward -307 -288 6.78348 0.258
NP_441464.1_8 Forward -296 -282 5.50613 0.253
NP_441464.1_10 Reverse -342 -356 13.2743 0.199
NP_441464.1_10 Reverse -343 -357 10.4227 0.259
NP_440695.1_6 Forward -56 -42 14.4836 0.215
NP_440677.1_1 Forward -226 -207 5.60432 0.294
NP_442386.1_9 Reverse -286 -295 13.8639 0.0289
NP_442386.1_9 Forward -297 -288 13.8639 0.0289
NP_441340.1_5 Forward -295 -288 15.6737 0.0124
NP_441340.1_5 Reverse -288 -295 15.6737 0.0124
NP_441947.1_4 Forward -307 -288 10.3242 0.3
NP_440768.1_2 Forward -135 -116 12.7825 0.104
NP_440327.1_6 Reverse -333 -352 4.22769 0.274
NP_442240.1_7 Forward -383 -364 19.6656 0.203
NP_440586.1_8 Forward -295 -288 13.2151 0.026
NP_440586.1_8 Reverse -288 -295 13.2151 0.026
NP_440586.1_8 Reverse -218 -225 5.93863 0.283
NP_442251.1_6 Forward -295 -288 15.2804 0.0124
NP_442251.1_6 Reverse -288 -295 15.2804 0.0124
NP_442959.1_7 Forward -355 -336 3.14605 0.222
NP_440684.1_9 Reverse -281 -295 8.94771 0.221
NP_440684.1_9 Forward -302 -288 8.25939 0.233
NP_441262.1_3 Reverse -287 -294 14.7888 0.0223
NP_441262.1_3 Forward -296 -289 14.7888 0.0223
NP_440027.1_3 Forward -290 -272 8.08151 0.196
NP_440027.1_3 Forward -296 -278 5.52492 0.24
NP_440027.1_3 Reverse -265 -283 4.54162 0.257
NP_443051.1_1 Reverse -286 -295 10.4228 0.00754
NP_443051.1_1 Forward -297 -288 10.4228 0.00754
NP_439984.1_3 Reverse -280 -294 15.7319 0.145
NP_439937.1_9 Reverse -207 -224 -14.2198 0.287
NP_439937.1_9 Forward -297 -280 -14.6131 0.287
NP_440408.1_7 Reverse -265 -284 8.55425 0.276
NP_442239.1_8 Reverse -379 -398 15.3391 0.205
NP_440372.1_2 Forward -295 -288 16.3621 0.0124
NP_440372.1_2 Reverse -288 -295 16.3621 0.0124
NP_440378.1_6 Reverse -272 -291 18.4857 0.168
NP_440316.1_10 Forward -389 -379 5.97822 0.275
NP_441803.1_2 Forward -226 -207 2.0644 0.22
NP_441803.1_2 Forward -301 -282 0.884433 0.243
NP_441572.1_7 Forward -302 -283 6.09597 0.0842
NP_442384.1_10 Forward -296 -283 18.0139 0.00545
NP_442384.1_10 Reverse -287 -300 10.049 0.047
NP_440693.1_6 Forward -184 -165 13.9625 0.255
NP_441604.1_4 Reverse -377 -396 -4.91709 0.247
NP_441018.1_7 Reverse -152 -171 13.7658 0.132
NP_441018.1_7 Reverse -283 -302 7.07928 0.277
NP_442790.1_4 Forward -30 -11 -9.93197 0.198
NP_442262.1_10 Forward -295 -288 14.1988 0.0123
NP_442262.1_10 Reverse -288 -295 14.1988 0.0123
NP_442262.1_10 Forward -201 -194 7.6106 0.274
NP_441689.1_5 Forward -298 -288 15.3192 0.0403
NP_441689.1_5 Reverse -255 -265 6.17443 0.197
NP_441689.1_5 Reverse -285 -295 5.78111 0.197
NP_440163.1_10 Forward -397 -387 16.4013 0.0762
NP_440163.1_10 Forward -299 -289 11.3864 0.169
NP_440344.1_10 Forward -303 -286 18.9184 0.00244
NP_440531.1_6 Forward -304 -285 11.9958 0.0545
NP_442910.1_1 Forward -303 -284 11.7008 0.0484
NP_441965.1_3 Forward -306 -287 2.16274 0.214
NP_441965.1_10 Forward -299 -283 7.13836 0.155
NP_440297.1_9 Reverse -288 -298 9.32148 0.0917
NP_440297.1_9 Forward -295 -285 -0.118297 0.282
NP_440297.1_9 Forward -279 -269 -0.511621 0.289
NP_440894.1_10 Reverse -167 -186 3.44104 0.272
NP_440894.1_10 Reverse -109 -128 2.3594 0.29
NP_440999.1_9 Forward -300 -286 4.32615 0.116
NP_440888.1_2 Reverse -287 -301 18.0918 0.00261
NP_440888.1_2 Forward -296 -282 10.2254 0.1
NP_440600.1_4 Forward -304 -286 -7.749 0.294
NP_440179.1_6 Forward -295 -276 7.07928 0.209
NP_442948.1_2 Reverse -286 -305 6.68596 0.231
NP_440575.1_1 Forward -146 -127 -2.45958 0.294
NP_441543.1_2 Forward -295 -286 16.9127 0.00359
NP_441543.1_2 Reverse -288 -297 16.9127 0.00359
NP_441543.1_2 Reverse -250 -259 10.5211 0.0724
NP_441543.1_3 Forward -69 -55 8.06211 0.286
NP_442845.1_2 Reverse -281 -295 14.8476 0.0774
NP_442845.1_2 Forward -302 -288 11.8976 0.121
NP_441469.1_8 Forward -297 -288 6.48957 0.227
NP_441469.1_8 Reverse -286 -295 6.48957 0.227
NP_442315.1_1 Forward -195 -177 8.57394 0.212
NP_443064.1_6 Forward -296 -286 12.5669 0.0796
NP_443064.1_6 Reverse -287 -297 12.5669 0.0796
NP_442337.1_7 Forward -382 -364 19.882 0.0581
NP_442578.1_7 Forward -295 -288 14.5921 0.026
NP_442578.1_7 Reverse -288 -295 14.5921 0.026
NP_442578.1_7 Reverse -250 -257 9.38056 0.138
NP_441462.1_2 Forward -296 -286 11.5831 0.00406
NP_441462.1_2 Reverse -287 -297 11.5831 0.00406
NP_441462.1_2 Forward -394 -384 -0.511621 0.236
NP_441621.1_7 Forward -393 -379 -3.04867 0.188
NP_443062.1_1 Forward -296 -278 6.8883 0.19
NP_443062.1_6 Reverse -139 -158 2.0644 0.262
NP_442204.1_1 Forward -300 -289 0.353664 0.281
NP_442204.1_1 Forward -335 -324 -0.236322 0.289
NP_442204.1_2 Forward -350 -331 5.40766 0.299
NP_442204.1_5 Forward -181 -162 -0.295539 0.283
NP_441560.1_8 Reverse -380 -399 17.356 0.0478
NP_441560.1_10 Forward -304 -285 6.58763 0.287
NP_442537.1_3 Reverse -265 -284 12.8808 0.239
NP_440516.1_2 Forward -302 -284 -0.275845 0.249
NP_440516.1_8 Forward -296 -287 16.9127 0.00442
NP_440516.1_8 Reverse -287 -296 16.9127 0.00442
NP_441785.1_1 Reverse -287 -301 18.5558 0.06
NP_442428.1_5 Forward -295 -288 15.8704 0.0124
NP_442428.1_5 Reverse -288 -295 15.8704 0.0124
NP_441032.1_5 Reverse -169 -188 14.6508 0.146
NP_440783.1_5 Forward -400 -381 8.06259 0.126
NP_440673.1_2 Forward -306 -287 15.6574 0.088
NP_440673.1_2 Reverse -277 -296 9.90183 0.228
NP_440673.1_3 Forward -294 -287 12.4288 0.0426
NP_440673.1_3 Reverse -289 -296 12.4288 0.0426
NP_441714.1_3 Reverse -280 -298 16.2429 0.127
NP_441052.1_2 Forward -296 -286 19.9412 0.00106
NP_441052.1_2 Reverse -287 -297 19.9412 0.00106
NP_441052.1_2 Forward -258 -248 4.60159 0.154
NP_442219.1_8 Forward -383 -364 12.419 0.158
NP_442219.1_8 Reverse -198 -217 9.9065 0.219
NP_442219.1_9 Forward -295 -286 17.7976 0.00718
NP_442219.1_9 Reverse -288 -297 17.7976 0.00718
NP_440436.1_2 Forward -310 -291 23.3259 0.00317
NP_440436.1_4 Forward -295 -286 17.2072 0.00233
NP_440436.1_4 Reverse -288 -297 17.2072 0.00233
NP_441884.1_8 Reverse -270 -289 -13.5702 0.284
NP_441884.1_9 Reverse -284 -303 -23.9933 0.284
NP_442864.1_7 Reverse -265 -283 7.68896 0.274
NP_440314.1_9 Forward -295 -276 7.57094 0.0451
NP_441719.1_4 Forward -295 -288 16.3621 0.0124
NP_441719.1_4 Reverse -288 -295 16.3621 0.0124
NP_441004.1_2 Forward -228 -209 -4.52377 0.291
NP_441004.1_4 Reverse -336 -346 7.55152 0.298
NP_442366.1_5 Reverse -284 -294 17.2858 0.0141
NP_440129.1_10 Reverse -264 -278 6.98109 0.177
NP_442873.1_5 Reverse -378 -397 7.66846 0.276
NP_442694.1_4 Reverse -345 -354 12.9794 0.225
NP_442206.1_10 Reverse -287 -302 4.01147 0.179
NP_443054.1_2 Forward -298 -284 1.47456 0.245
NP_440864.1_9 Forward -284 -265 -6.88371 0.28
NP_441851.1_10 Forward -297 -287 15.8113 0.00552
NP_441851.1_10 Reverse -286 -296 15.8113 0.00552
NP_440611.1_6 Reverse -371 -390 8.84924 0.262
NP_442856.1_7 Forward -267 -248 -2.65548 0.236
NP_441273.1_1 Forward -88 -69 16.4207 0.171
NP_442515.1_1 Reverse -248 -262 2.5562 0.133
NP_442515.1_1 Forward -297 -283 2.06454 0.143
NP_442515.1_1 Reverse -286 -300 1.76955 0.149
NP_441683.1_4 Forward -383 -364 20.5498 0.126
NP_440165.1_5 Reverse -321 -340 -8.26035 0.297
NP_441046.1_2 Reverse -276 -295 -1.86883 0.292
NP_441349.1_10 Forward -306 -287 2.16274 0.0762
NP_441349.1_10 Reverse -277 -296 1.47442 0.0833
NP_441409.1_6 Reverse -281 -300 -10.4236 0.205
NP_440432.1_9 Reverse -288 -303 -2.08505 0.167
NP_442843.1_1 Reverse -272 -291 -10.0303 0.274
NP_442843.1_1 Forward -387 -368 -11.1119 0.286
NP_442843.1_1 Reverse -194 -213 -11.9969 0.296
NP_442843.1_4 Reverse -375 -393 17.4237 0.159
NP_441477.1_5 Forward -129 -110 5.80098 0.292
NP_442450.1_5 Forward -298 -288 9.32148 0.115
NP_442450.1_5 Reverse -285 -295 7.55152 0.13
NP_440588.1_2 Reverse -240 -259 -7.08038 0.299
NP_441031.1_8 Reverse -266 -285 -5.01543 0.268
NP_442237.1_3 Reverse -139 -153 16.3407 0.289
NP_442006.1_2 Forward -388 -371 -4.97604 0.137
NP_441570.1_1 Reverse -287 -305 11.2289 0.00811
NP_441570.1_1 Reverse -271 -289 -9.51896 0.139
NP_441570.1_1 Forward -296 -278 -16.4021 0.245
NP_440078.1_4 Reverse -374 -393 15.4374 0.175
NP_441078.1_4 Forward -296 -287 19.6659 0.0007
NP_441078.1_4 Reverse -287 -296 19.6659 0.0007
NP_441078.1_4 Forward -394 -385 -1.57357 0.266
NP_441078.1_4 Forward -258 -249 -1.57357 0.266
NP_442729.1_5 Forward -275 -265 8.33817 0.248
NP_442729.1_8 Forward -300 -287 8.47575 0.125
NP_440707.1_7 Forward -188 -169 9.63589 0.207
NP_440526.1_3 Reverse -288 -299 10.1862 0.0646
NP_440526.1_3 Forward -295 -284 0.943182 0.267
NP_441432.1_8 Reverse -286 -295 16.8143 0.00595
NP_441432.1_8 Forward -297 -288 16.8143 0.00595
NP_441432.1_8 Reverse -105 -114 12.2911 0.0444
NP_441432.1_9 Reverse -87 -100 12.0888 0.221
NP_442320.1_8 Forward -302 -288 21.4357 0.00555
NP_441732.1_2 Forward -300 -284 3.00846 0.0141
NP_441732.1_2 Reverse -283 -299 -7.90627 0.0983
NP_442003.1_4 Forward -295 -276 10.8159 0.288
NP_440760.1_1 Forward -296 -277 -13.2752 0.1
NP_442797.1_2 Reverse -260 -278 11.9743 0.295
NP_442797.1_7 Reverse -378 -396 3.65739 0.234
NP_442797.1_7 Reverse -216 -234 1.59244 0.257
NP_440199.1_4 Forward -153 -135 17.668 0.203
NP_440199.1_4 Reverse -138 -156 14.2303 0.203
NP_440199.1_6 Forward -328 -311 18.4267 0.239
NP_440199.1_10 Forward -299 -289 16.7946 0.0381
NP_441057.1_4 Reverse -153 -171 3.55906 0.244
NP_442298.1_10 Forward -114 -95 14.4541 0.219
NP_440913.1_3 Reverse -265 -278 17.7189 0.184
NP_440713.1_4 Reverse -277 -296 3.53937 0.242
NP_442489.1_7 Forward -296 -287 20.1576 0.000695
NP_442489.1_7 Reverse -287 -296 20.1576 0.000695
NP_442489.1_7 Forward -394 -385 -1.08191 0.179
NP_440386.1_8 Forward -206 -188 12.703 0.194
NP_440559.1_1 Forward -295 -286 17.4043 0.00658
NP_440559.1_1 Reverse -288 -297 17.4043 0.00658
NP_442763.1_10 Reverse -317 -336 2.75272 0.26
NP_441659.2_8 Forward -296 -286 18.1713 0.00133
NP_441659.2_8 Reverse -287 -297 18.1713 0.00133
NP_440363.1_9 Reverse -200 -218 15.7521 0.187
NP_442913.1_10 Reverse -278 -297 6.78429 0.058
NP_442346.1_2 Reverse -276 -295 4.32602 0.289
NP_442346.1_5 Forward -297 -287 16.6963 0.00248
NP_442346.1_5 Reverse -286 -296 16.6963 0.00248
NP_440545.1_3 Reverse -283 -300 5.05372 0.0646
NP_440545.1_3 Reverse -267 -284 -0.747806 0.157
NP_440545.1_3 Reverse -381 -398 -3.00942 0.197
NP_440545.1_5 Reverse -283 -300 8.29864 0.21
NP_441629.1_3 Reverse -378 -397 -4.32786 0.29
NP_440486.1_6 Reverse -270 -289 8.75091 0.235
NP_440486.1_6 Forward -259 -240 8.16093 0.248
NP_440010.1_10 Forward -190 -171 12.8808 0.19
NP_440010.1_10 Reverse -166 -185 1.57275 0.297
NP_442603.1_7 Reverse -287 -301 10.422 0.126
NP_441888.1_7 Forward -301 -287 2.2612 0.225
NP_441888.1_9 Forward -388 -369 13.9702 0.282
NP_443022.1_6 Forward -145 -126 15.8307 0.143
NP_441047.1_2 Reverse -288 -307 3.24438 0.231
NP_440170.1_5 Forward -306 -287 6.09597 0.188
NP_441833.1_4 Forward -295 -288 15.9687 0.0124
NP_441833.1_4 Reverse -288 -295 15.9687 0.0124
NP_442162.1_9 Forward -295 -288 16.2637 0.0124
NP_442162.1_9 Reverse -288 -295 16.2637 0.0124
NP_440671.1_4 Forward -302 -288 17.4042 0.0208
NP_440671.1_4 Forward -286 -272 13.3726 0.0834
NP_442404.1_9 Reverse -211 -225 10.0287 0.263
NP_440224.1_1 Forward -307 -288 9.3409 0.0598
NP_440772.1_8 Forward -302 -283 13.6675 0.253
NP_442140.1_3 Forward -295 -285 12.2714 0.0632
NP_442140.1_3 Reverse -288 -298 4.40493 0.243
NP_442021.1_3 Forward -379 -360 -7.17871 0.265
NP_442547.1_7 Forward -398 -379 18.2039 0.141
NP_441813.1_5 Forward -298 -288 15.9097 0.01
NP_441813.1_5 Reverse -285 -295 8.63316 0.0367
NP_440590.1_4 Forward -295 -282 11.6223 0.019
NP_440590.1_4 Reverse -288 -301 5.32916 0.0585
NP_440567.1_1 Reverse -288 -302 12.586 0.0225
NP_440567.1_1 Forward -295 -281 8.45605 0.0577
NP_442497.1_10 Forward -295 -286 10.4228 0.0087
NP_442497.1_10 Reverse -288 -297 10.4228 0.0087
NP_440821.1_4 Forward -298 -288 18.2696 0.00448
NP_440821.1_4 Reverse -285 -295 9.41981 0.0286
NP_441239.1_9 Forward -282 -270 6.1355 0.2
NP_441239.1_9 Forward -298 -286 4.36554 0.253
NP_441239.1_9 Reverse -285 -297 3.38223 0.285
NP_441892.1_1 Reverse -376 -393 -1.73112 0.212
NP_441892.1_1 Forward -305 -288 -3.69774 0.247
NP_442193.1_8 Forward -299 -280 9.24175 0.299
NP_442270.1_9 Reverse -276 -295 -8.752 0.226
NP_441017.1_6 Forward -300 -286 18.0918 0.0376
NP_440833.1_6 Forward -211 -197 10.0287 0.255
NP_440876.1_5 Reverse -289 -308 10.8159 0.244
NP_440354.1_7 Reverse -211 -229 6.90232 0.278
NP_442138.1_10 Reverse -287 -306 -1.37718 0.175
NP_442052.1_8 Reverse -383 -393 12.5664 0.265
NP_440546.1_4 Forward -296 -286 10.046 0.109
NP_440546.1_4 Reverse -287 -297 10.046 0.109
NP_440462.1_6 Forward -298 -288 7.74818 0.0699
NP_440462.1_6 Reverse -255 -265 2.04498 0.294
NP_440462.1_6 Reverse -285 -295 1.35667 0.294
NP_442340.1_7 Reverse -303 -322 16.2241 0.269
NP_442592.1_3 Reverse -212 -231 9.73422 0.258
NP_440868.1_4 Reverse -283 -295 15.7719 0.0164
NP_440868.1_4 Forward -300 -288 -0.846001 0.282
NP_440401.1_9 Forward -357 -350 14.5917 0.287
NP_442499.1_1 Forward -225 -206 3.34271 0.257
NP_440374.1_1 Reverse -231 -250 23.9922 0.0261
NP_442039.1_4 Forward -295 -288 15.1821 0.0124
NP_442039.1_4 Reverse -288 -295 15.1821 0.0124
NP_442039.1_7 Forward -224 -214 15.713 0.211
NP_442039.1_7 Reverse -108 -118 7.25653 0.277
NP_441811.1_8 Reverse -281 -295 14.7492 0.162
NP_440008.1_9 Reverse -66 -85 10.2259 0.255
NP_440825.1_7 Forward -295 -285 12.9096 0.152
NP_442837.1_3 Forward -295 -288 15.7721 0.0124
NP_442837.1_3 Reverse -288 -295 15.7721 0.0124
NP_442053.1_1 Forward -296 -287 18.3876 0.0007
NP_442053.1_1 Reverse -287 -296 18.3876 0.0007
NP_440505.1_3 Forward -298 -288 16.303 0.00696
NP_440505.1_3 Reverse -285 -295 9.22315 0.122
NP_441203.1_1 Forward -279 -260 -20.2567 0.297
NP_440013.1_1 Forward -165 -146 7.57013 0.284
NP_441408.2_7 Forward -333 -314 -4.52377 0.281
NP_440914.1_1 Forward -296 -286 17.5935 0.000537
NP_440914.1_1 Reverse -287 -297 17.5935 0.000537
NP_440914.1_1 Reverse -169 -179 8.41992 0.191
NP_441011.1_8 Forward -295 -286 8.25953 0.144
NP_441011.1_8 Reverse -288 -297 8.25953 0.144
NP_442533.1_6 Forward -296 -287 17.2076 0.00137
NP_442533.1_6 Reverse -287 -296 17.2076 0.00137
NP_442533.1_6 Reverse -385 -394 5.50626 0.14
NP_442533.1_6 Forward -394 -385 4.22796 0.186
NP_442533.1_6 Forward -114 -105 1.96635 0.28
NP_441482.1_7 Forward -302 -288 -1.18038 0.0637
NP_441482.1_7 Reverse -265 -279 -11.5051 0.268
NP_439944.1_9 Reverse -288 -298 19.0562 0.00329
NP_439944.1_9 Forward -295 -285 10.5014 0.0887
NP_441697.1_5 Forward -156 -137 -9.78835 0.274
NP_440816.1_2 Forward -222 -203 7.40308 0.266
NP_442202.1_4 Reverse -380 -394 14.3866 0.218
NP_440116.1_5 Reverse -284 -301 5.54538 0.176
NP_440116.1_8 Forward -295 -276 1.47442 0.0926
NP_440115.1_6 Reverse -284 -294 8.33817 0.13
NP_440007.1_9 Forward -300 -286 10.3243 0.163
NP_440608.1_6 Forward -353 -334 9.43841 0.238
NP_441972.1_5 Forward -291 -272 -2.26216 0.18
NP_441106.1_1 Forward -297 -288 9.63616 0.0311
NP_441106.1_1 Reverse -286 -295 9.63616 0.0311
NP_441106.1_1 Forward -395 -386 2.85133 0.255
NP_440429.1_2 Forward -295 -276 11.0125 0.258
NP_439903.1_6 Forward -33 -14 1.08032 0.255
NP_440797.1_2 Forward -307 -288 20.4592 0.0373
NP_441286.1_1 Reverse -286 -298 21.3768 0.00196
NP_441286.1_1 Forward -297 -285 12.9203 0.00815
NP_442674.1_3 Forward -304 -285 8.35677 0.199
NP_440670.1_8 Forward -296 -287 18.3876 0.000699
NP_440670.1_8 Reverse -287 -296 18.3876 0.000699
NP_440886.1_7 Forward -297 -287 7.94438 0.0805
NP_440886.1_7 Reverse -286 -296 7.94438 0.0805
NP_440886.1_7 Reverse -216 -226 3.32285 0.287
NP_440083.1_1 Forward -147 -128 1.27776 0.288
NP_442614.1_2 Forward -296 -282 13.5693 0.124
NP_442614.1_2 Forward -220 -206 10.1277 0.234
NP_442072.1_9 Forward -297 -279 -21.2203 0.206
NP_442401.1_2 Reverse -168 -187 6.98015 0.282
NP_440028.1_6 Forward -399 -381 13.6872 0.225
NP_441808.1_8 Reverse -157 -176 10.4225 0.236
NP_441808.1_8 Forward -400 -381 8.84924 0.259
NP_441808.1_8 Forward -190 -171 6.58763 0.285
NP_440907.2_8 Forward -295 -285 7.64939 0.117
NP_439967.1_7 Forward -297 -279 11.4255 0.193
NP_440841.1_4 Forward -116 -97 -8.35868 0.25
NP_441463.1_3 Forward -306 -287 -3.3438 0.174
NP_441463.1_6 Forward -298 -284 8.34861 0.25
NP_441626.1_2 Forward -295 -288 15.7721 0.0124
NP_441626.1_2 Reverse -288 -295 15.7721 0.0124
NP_442365.1_7 Forward -300 -281 2.16274 0.168
NP_442794.1_1 Forward -300 -288 10.1671 0.0721
NP_442794.1_1 Reverse -283 -295 2.69391 0.286
NP_442615.1_1 Reverse -278 -296 0.0191479 0.109
NP_442615.1_1 Reverse -240 -258 -5.78238 0.223
NP_441962.1_4 Reverse -282 -301 -5.11376 0.164
NP_441962.1_4 Reverse -288 -307 -9.63698 0.218
NP_441962.1_4 Reverse -380 -399 -10.4236 0.228
NP_441962.1_4 Reverse -266 -285 -13.6686 0.277
NP_440387.1_1 Forward -296 -280 14.6115 0.00635
NP_440387.1_1 Reverse -249 -265 1.82849 0.0943
NP_440387.1_1 Reverse -287 -303 -1.71142 0.143
NP_440855.1_1 Forward -292 -273 2.0644 0.213
NP_441431.1_2 Forward -391 -377 11.2087 0.145
NP_441836.1_1 Forward -307 -288 15.2005 0.153
NP_441836.1_2 Forward -264 -245 -2.0655 0.224
NP_441836.1_2 Reverse -281 -300 -5.11376 0.272
NP_440634.1_10 Reverse -172 -191 5.2102 0.279
NP_440634.1_10 Reverse -169 -188 4.71854 0.3
NP_441993.1_1 Forward -280 -261 6.81956 0.177
NP_442352.1_1 Reverse -211 -224 14.6825 0.251
NP_440814.1_7 Reverse -94 -113 16.0274 0.092
NP_440467.1_3 Reverse -266 -285 11.6469 0.268
NP_441858.1_2 Forward -218 -199 16.9528 0.148
NP_440287.1_6 Reverse -278 -297 3.83436 0.208
NP_440293.1_10 Forward -196 -177 -2.0655 0.271
NP_440766.1_4 Forward -300 -286 8.25939 0.0871
NP_441237.1_2 Forward -292 -273 13.7658 0.238
NP_441237.1_9 Forward -295 -285 14.828 0.0242
NP_439910.1_2 Forward -304 -287 -22.2823 0.22
NP_440457.1_1 Forward -300 -288 7.02048 0.105
NP_440457.1_1 Reverse -283 -295 2.69391 0.205
NP_440457.1_1 Reverse -267 -279 1.02229 0.248
NP_442940.1_2 Reverse -169 -188 -0.000545616 0.296
NP_440798.1_6 Forward -295 -282 5.62415 0.14
NP_441801.1_4 Forward -133 -123 11.3864 0.231
NP_441801.1_4 Reverse -261 -271 2.7333 0.262
NP_440801.1_8 Reverse -363 -382 6.4893 0.166
NP_442040.1_4 Forward -292 -273 11.2092 0.11
NP_442509.1_9 Forward -296 -286 8.14104 0.192
NP_442509.1_9 Reverse -287 -297 8.14104 0.192
NP_442514.1_5 Reverse -376 -395 -6.98278 0.275
NP_442514.1_5 Forward -369 -350 -7.17944 0.275
NP_440554.1_4 Reverse -288 -298 7.05986 0.106
NP_442737.1_5 Reverse -286 -305 12.5881 0.261
NP_441885.1_5 Forward -296 -286 20.9245 0.000538
NP_441885.1_5 Reverse -287 -297 20.9245 0.000538
NP_441885.1_5 Forward -258 -248 -0.0199663 0.186
NP_442341.1_7 Reverse -286 -300 18.0925 0.0111
NP_442341.1_7 Forward -297 -283 7.9644 0.0956
NP_442341.1_7 Reverse -168 -182 2.2612 0.263
NP_442341.1_7 Forward -259 -245 2.06454 0.271
NP_442341.1_9 Reverse -285 -299 8.65209 0.166
NP_442341.1_9 Forward -298 -284 5.99717 0.247
NP_441756.1_5 Forward -283 -264 1.57275 0.216
NP_441756.1_5 Forward -397 -378 -1.37718 0.255
NP_440423.1_6 Forward -304 -285 -15.8318 0.229
NP_443000.1_7 Forward -298 -288 17.0896 0.00865
NP_443000.1_7 Reverse -285 -295 10.3048 0.0345
NP_440507.2_8 Reverse -194 -213 2.94938 0.292
NP_441842.1_1 Forward -294 -281 18.1116 0.0202
NP_441842.1_10 Forward -303 -289 10.7177 0.155
NP_440275.1_3 Forward -298 -288 8.1415 0.0602
NP_440275.1_3 Reverse -285 -295 8.04317 0.0602
NP_440091.1_1 Forward -300 -288 8.88877 0.0567
NP_440091.1_1 Reverse -283 -295 8.29878 0.0653
NP_443010.1_10 Forward -299 -282 4.02703 0.242
NP_439962.1_4 Reverse -272 -291 -8.45701 0.294
NP_440149.1_8 Reverse -287 -306 -7.4737 0.285
NP_441105.1_3 Reverse -282 -301 -7.57203 0.255
NP_441105.1_3 Forward -399 -380 -10.0303 0.3
NP_440216.1_1 Forward -296 -282 -0.0987402 0.0284
NP_440216.1_1 Reverse -287 -301 -9.73518 0.145
NP_440172.1_1 Forward -296 -286 15.0247 0.00945
NP_440172.1_1 Reverse -287 -297 15.0247 0.00945
NP_440167.1_3 Forward -306 -287 9.63589 0.247
NP_442015.1_10 Reverse -283 -296 10.5407 0.0391
NP_442015.1_10 Forward -300 -287 10.344 0.0391
NP_442015.1_10 Forward -284 -271 6.90245 0.103
NP_441226.1_7 Forward -295 -288 14.4934 0.0123
NP_441226.1_7 Reverse -288 -295 14.4934 0.0123
NP_441111.1_7 Forward -295 -287 18.7023 0.00294
NP_441111.1_7 Reverse -288 -296 18.7023 0.00294
NP_442379.1_10 Reverse -280 -297 1.51381 0.223
NP_441766.1_2 Forward -296 -287 17.5026 0.00297
NP_441766.1_2 Reverse -287 -296 17.5026 0.00297
NP_442417.1_5 Reverse -271 -285 7.9644 0.168
NP_440416.1_9 Reverse -377 -396 -13.3736 0.165
NP_443052.1_9 Forward -291 -272 2.65439 0.169
NP_443052.1_9 Reverse -378 -397 -2.36049 0.238
NP_443052.1_9 Forward -396 -377 -5.9004 0.274
NP_442154.1_1 Forward -396 -378 -11.9772 0.217
NP_442154.1_1 Forward -195 -177 -15.8121 0.225
NP_440261.1_5 Forward -295 -282 -4.50394 0.151
NP_440988.1_10 Forward -298 -284 17.6781 0.099
NP_440988.1_10 Forward -180 -166 12.9343 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTAACGGCGGCGGCCCAGGCGGATTTTGTCACCGCTCTGTATAACCCCAAATCCCAAAAGCGCACCGAGTTGATTGAACAGGCCCAAGCTATTTTCCTACAATGGCGATCGCCAACCACTCCGGTGGCCCTGGTGCGTTCCGTTTATCGCCAAGATGAAACCATTGTGCGTACCACGTTGGCGGCAATGCTGAACTTTCCCATTGATATGCTGACGGTGGTGCTCATCGGCAACAGTAACACCTACAATTATCAAGATTATTTGATTACTCCCCGGGGCTATTATGCCAATGCCTAGAAAAAAACAGTCAATTACTGGAGCGGTGCTCAAGCCCTCTAATCCCATAATTTTCAAGGTACCCTGAATAGAAGTGAGTCCGTTGACCGGGAGTATTTTCCA

CDS

ATGAAGCTGGTGAAGGATGTACAACTGAGGCGTTATACCCCTCCCACCTGTACTTTAGAGTTGTGGCAAACTCGACGGGTATGGCAAAGACCTCCCCAAACTTTGCCGGCGGATTATCGTTTTGCGCTCCATTTTGACGATCCCCGTTTGCCGGAAGTAGAACAATTAACTTTGTCTGGCACACCGGAGGAGTTGGAAGCCCTCGCTTTAGCGGTGGAAACCTATCTCCAGCAACGGCTTAACCCCTGTGCTTCCTTGGAACCAAGCACCTATCCGGAACCAGTATTTAATGCGGACGGTGAACCTTCTTTTTGCCTACGACCCCAGGGATTATGGAGCCATGAACTTTTGGGGATGGGGGCTCCCATTACCCTCAATACTTCCCAGTTGTACGATCTGATGCTGGCCTTGGAAGGTTTCCGTCTCCAGGATTTAGAGCCGAGCCGGATGTCAGTGCTCATGGCCAGAGAACAGTCGCCTAAAGCATTGGTCTTAGCCGGAATGGTAGCAGCCGGTAGTGTGGCGGCGATCGCCATAGCGGCCCTGTGGATGCGCCAACCCCAACCCGAAGTGGCGGTGCAGAATAATTTTCAACTGCCAATGCCCAACCAATTTCAGTTTGAGGAAGTTAGCTCTATGGTGCCACCACCACCGAGGGGCGATACCCCCTCCCCTCAATTGGCCCCAATCCTAGCTTTACGGGATCCTCTGCCTTCCCCCAGTGCCGTGCTAGCTGCTGCTCCCCCTCCCCGTAATCCTAATATTCCCCTAGTGGTGCCCCCAGAAAGGGTGCGTCCCCCTGATTTACAAGCTCCAGGAGCCCCAGGGGAAACCTATATTGCCATTCCTGATCCCACTAATCTACAACCCCTGACACCGCCGCCAGAACCGTCTTACCCCGGTGCCTTGGCTATTTTGCCCCGCCCCGACGGTCAACCCCTACCCTATGGTGGCGAGATATTGTCCACTACCCCCGATTTACCGCCTCTGCCCCCTGCTTCTAATCCCGTTAGTTTTAGGCCGCCTCGACCCCGTGCTGTGCCACCCCGTTCCACCAATTTACTGGACACCATTCCCCAGGTGGCGGAAGTGCGTAAGTTCTATCAAGAGCAGTGGCAACCGCCGGAAGATCAAACCCAAACGTTGGAATATCGCCTACAAATTGATCCCAGTGGGACGGTGAAGAGAACCATGCCCCTAGGCCGAGCCGCTAGCATTTACATGGCCCGCCTGCCCCAACCTGCCCCTGGGGAACCGTTGGTCTCTCCCCTCGCCGATGACAGGATGGAAACCATTCGCTTAGTACTTACTCCCCTGGGAGATGTGAAGGCTTTTCTGGAAGATCAACCCCAATAG

Protein

MKLVKDVQLRRYTPPTCTLELWQTRRVWQRPPQTLPADYRFALHFDDPRLPEVEQLTLSGTPEELEALALAVETYLQQRLNPCASLEPSTYPEPVFNADGEPSFCLRPQGLWSHELLGMGAPITLNTSQLYDLMLALEGFRLQDLEPSRMSVLMAREQSPKALVLAGMVAAGSVAAIAIAALWMRQPQPEVAVQNNFQLPMPNQFQFEEVSSMVPPPPRGDTPSPQLAPILALRDPLPSPSAVLAAAPPPRNPNIPLVVPPERVRPPDLQAPGAPGETYIAIPDPTNLQPLTPPPEPSYPGALAILPRPDGQPLPYGGEILSTTPDLPPLPPASNPVSFRPPRPRAVPPRSTNLLDTIPQVAEVRKFYQEQWQPPEDQTQTLEYRLQIDPSGTVKRTMPLGRAASIYMARLPQPAPGEPLVSPLADDRMETIRLVLTPLGDVKAFLEDQPQ