Your browser is old and dusty. Try Google Chrome!

Details for slr0960

ORF slr0960
Accession NP_441747.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -204 -190 0.687908 0.202
NP_440795.1_7 Reverse -270 -277 11.3472 0.0978
NP_441418.1_6 Forward -386 -367 -23.1083 0.191
NP_442272.1_2 Reverse -233 -252 10.1695 0.258
NP_441453.1_4 Reverse -269 -277 7.19758 0.0757
NP_441453.1_4 Forward -278 -270 4.93597 0.224
NP_442151.1_6 Reverse -269 -283 10.521 0.122
NP_441818.1_1 Reverse -63 -74 10.9729 0.21
NP_441818.1_9 Reverse -324 -343 -2.36049 0.203
NP_441098.1_3 Forward -146 -127 -0.56821 0.25
NP_442287.1_3 Forward -343 -326 13.4111 0.294
NP_442173.1_1 Forward -277 -269 5.62429 0.206
NP_442173.1_1 Reverse -270 -278 4.73931 0.258
NP_442752.1_4 Reverse -269 -276 10.8555 0.0846
NP_440784.1_7 Forward -277 -270 12.4288 0.0475
NP_440784.1_7 Reverse -63 -70 6.43063 0.218
NP_440784.1_7 Reverse -270 -277 6.23397 0.241
NP_440061.1_9 Reverse -54 -68 8.84875 0.161
NP_440061.1_9 Reverse -110 -124 7.66879 0.198
NP_442062.1_8 Reverse -269 -279 7.45319 0.0985
NP_442062.1_8 Forward -278 -268 4.79825 0.198
NP_440304.1_4 Reverse -267 -277 8.23984 0.0845
NP_440304.1_4 Reverse -97 -107 2.43831 0.299
NP_440044.1_8 Reverse -270 -289 1.86774 0.161
NP_441935.1_2 Reverse -257 -276 -3.93378 0.253
NP_441208.1_9 Forward -352 -338 4.81781 0.285
NP_441594.1_6 Reverse -193 -212 2.94938 0.239
NP_441083.1_5 Reverse -269 -279 0.865012 0.218
NP_441083.1_5 Forward -278 -268 0.176696 0.241
NP_440209.1_1 Reverse -269 -277 8.37755 0.0576
NP_442889.1_8 Reverse -199 -213 13.5686 0.0588
NP_442889.1_8 Reverse -266 -280 10.422 0.0848
NP_441713.1_1 Forward -355 -336 5.01433 0.0568
NP_441624.1_1 Forward -388 -369 16.4207 0.266
NP_441624.1_7 Forward -42 -28 7.57108 0.249
NP_440906.1_5 Reverse -270 -277 6.23397 0.234
NP_440906.1_5 Forward -277 -270 6.0373 0.262
NP_440747.1_10 Forward -281 -269 -4.68091 0.115
NP_441130.1_7 Forward -283 -269 17.0102 0.287
NP_441130.1_10 Forward -73 -59 11.0127 0.107
NP_441486.1_1 Forward -281 -267 19.2725 0.00352
NP_441486.1_1 Reverse -266 -280 -2.75368 0.175
NP_442330.1_4 Reverse -200 -219 12.9943 0.286
NP_440403.1_4 Forward -77 -58 -9.14533 0.269
NP_440842.1_3 Reverse -275 -294 18.3873 0.0728
NP_443018.1_3 Reverse -270 -277 13.8055 0.024
NP_443018.1_3 Forward -277 -270 13.6088 0.0352
NP_440376.1_1 Reverse -269 -278 6.48957 0.0963
NP_440376.1_1 Forward -278 -269 -0.196935 0.285
NP_440376.1_1 Reverse -340 -349 -1.18024 0.294
NP_441077.1_6 Reverse -236 -252 4.82641 0.255
NP_440066.1_5 Forward -393 -374 7.66846 0.256
NP_441846.1_10 Reverse -314 -333 -20.1584 0.256
NP_441846.1_10 Reverse -325 -344 -21.6334 0.256
NP_440642.1_10 Forward -54 -40 3.34225 0.275
NP_442296.1_9 Forward -277 -258 -0.4922 0.197
NP_442658.1_1 Reverse -267 -277 13.9425 0.0293
NP_440141.1_8 Reverse -260 -279 3.83436 0.298
NP_442782.1_3 Forward -279 -262 19.5432 0.229
NP_441414.1_9 Reverse -269 -288 -3.54046 0.138
NP_441256.1_1 Reverse -59 -78 -0.4922 0.206
NP_441958.1_5 Reverse -268 -278 1.65166 0.0872
NP_441127.1_1 Reverse -386 -400 7.9644 0.3
NP_442836.1_5 Forward -284 -265 1.67108 0.276
NP_439905.1_1 Reverse -270 -283 6.80412 0.275
NP_440984.1_7 Forward -283 -269 8.94771 0.133
NP_442364.1_2 Forward -283 -264 16.5191 0.14
NP_442911.1_2 Forward -288 -269 -4.32711 0.132
NP_440377.1_1 Reverse -141 -158 11.6602 0.271
NP_440147.1_4 Forward -280 -267 0.0192843 0.268
NP_441550.1_8 Forward -280 -270 8.23937 0.127
NP_441550.1_8 Reverse -267 -277 7.94438 0.14
NP_441041.1_4 Forward -127 -108 -12.4886 0.266
NP_441041.1_7 Reverse -184 -196 7.32042 0.169
NP_442396.1_5 Forward -235 -222 8.37742 0.157
NP_441725.1_5 Forward -277 -267 9.22315 0.0553
NP_439966.1_8 Forward -182 -163 5.99764 0.298
NP_440289.1_2 Reverse -266 -279 -4.89726 0.294
NP_440260.1_8 Forward -60 -42 -2.73412 0.245
NP_442281.1_1 Reverse -264 -278 17.3052 0.00623
NP_441556.1_10 Forward -283 -269 19.7608 0.0841
NP_441644.1_6 Reverse -269 -279 13.2542 0.0212
NP_441644.1_6 Forward -278 -268 4.60114 0.233
NP_443049.1_6 Reverse -268 -278 11.7385 0.24
NP_442215.1_2 Forward -280 -264 6.05672 0.074
NP_442247.1_8 Forward -206 -192 8.25939 0.281
NP_440929.1_8 Reverse -269 -278 7.66954 0.0624
NP_440929.1_8 Forward -278 -269 7.57121 0.0706
NP_442933.1_2 Reverse -231 -249 5.34953 0.299
NP_442933.1_10 Reverse -269 -278 5.70292 0.165
NP_442671.1_2 Reverse -235 -254 3.14477 0.195
NP_440382.1_2 Reverse -236 -255 8.16011 0.215
NP_442554.1_8 Forward -277 -267 13.1564 0.0193
NP_442554.1_8 Reverse -270 -280 10.8948 0.0424
NP_442142.1_4 Reverse -368 -381 4.14862 0.231
NP_442292.1_1 Reverse -270 -279 8.1612 0.0478
NP_442292.1_1 Forward -277 -268 6.5879 0.101
NP_442476.1_6 Reverse -270 -284 1.67122 0.207
NP_443009.1_5 Forward -279 -268 4.08976 0.263
NP_441198.1_8 Reverse -267 -277 10.2438 0.289
NP_441468.1_1 Reverse -270 -277 13.8055 0.0242
NP_441468.1_1 Forward -277 -270 6.0373 0.223
NP_441673.1_1 Reverse -269 -278 1.37636 0.114
NP_441673.1_1 Forward -278 -269 1.1797 0.163
NP_441673.1_1 Reverse -340 -349 -8.06341 0.254
NP_441330.1_1 Reverse -8 -27 -15.7335 0.294
NP_441764.1_8 Reverse -182 -192 11.9807 0.284
NP_442227.1_2 Forward -393 -374 5.11266 0.202
NP_440871.1_3 Reverse -356 -370 15.1283 0.216
NP_441114.1_3 Forward -276 -267 7.57121 0.231
NP_441878.1_6 Reverse -268 -278 11.4848 0.0176
NP_441878.1_6 Forward -279 -269 -0.41329 0.177
NP_441878.1_6 Forward -350 -340 -7.78811 0.266
NP_441036.1_7 Reverse -43 -53 16.1058 0.261
NP_441557.1_5 Forward -278 -269 7.57121 0.049
NP_441557.1_5 Reverse -269 -278 1.08137 0.0794
NP_441557.1_9 Forward -375 -361 18.2892 0.264
NP_441458.1_8 Forward -255 -236 2.29213 0.295
NP_442135.1_2 Reverse -312 -330 16.8661 0.287
NP_441574.1_1 Forward -392 -373 -5.9004 0.27
NP_442444.1_3 Reverse -260 -279 23.5006 0.0334
NP_441037.1_4 Reverse -267 -277 16.0889 0.0175
NP_442047.1_2 Forward -270 -256 12.6843 0.251
NP_441633.1_3 Forward -280 -267 3.26421 0.0709
NP_440136.1_2 Reverse -270 -277 6.52896 0.116
NP_440136.1_2 Forward -277 -270 6.13563 0.193
NP_442998.1_10 Forward -276 -269 6.13563 0.181
NP_440299.1_1 Forward -282 -269 7.49186 0.112
NP_441799.1_1 Forward -282 -268 4.12889 0.266
NP_441007.1_10 Reverse -264 -277 -0.275709 0.273
NP_442785.1_7 Reverse -267 -281 8.94771 0.279
NP_440748.1_5 Forward -275 -256 10.2259 0.139
NP_441464.1_8 Forward -278 -264 6.09611 0.247
NP_441464.1_10 Forward -240 -226 9.14437 0.263
NP_440695.1_6 Reverse -244 -258 10.3144 0.268
NP_442386.1_9 Forward -279 -270 11.1107 0.103
NP_441340.1_5 Forward -277 -270 13.5105 0.0314
NP_441340.1_5 Reverse -270 -277 6.23397 0.132
NP_441340.1_9 Reverse -241 -251 8.15881 0.256
NP_441947.1_4 Reverse -258 -277 10.1275 0.3
NP_440327.1_6 Forward -392 -373 2.94938 0.285
NP_440586.1_8 Forward -277 -270 11.3468 0.0736
NP_440586.1_8 Reverse -270 -277 9.47853 0.146
NP_442251.1_6 Reverse -188 -195 6.43063 0.298
NP_441262.1_3 Reverse -269 -276 5.25066 0.215
NP_443051.1_1 Reverse -268 -277 8.35786 0.0371
NP_439984.1_7 Forward -47 -29 3.55906 0.256
NP_439937.1_9 Reverse -216 -233 -11.8598 0.267
NP_442294.1_3 Forward -391 -377 13.8636 0.252
NP_440408.1_7 Reverse -269 -288 11.5042 0.224
NP_440408.1_7 Reverse -295 -314 7.07928 0.292
NP_440372.1_2 Reverse -270 -277 6.62729 0.151
NP_440372.1_2 Forward -277 -270 6.52896 0.188
NP_441789.1_7 Forward -333 -314 -4.81951 0.288
NP_440819.1_5 Reverse -391 -399 7.59091 0.272
NP_440316.1_10 Reverse -268 -278 7.25653 0.251
NP_441572.1_7 Forward -77 -58 -2.75381 0.2
NP_442384.1_10 Reverse -269 -282 6.60746 0.0987
NP_441877.1_5 Reverse -243 -262 -0.0988766 0.276
NP_441018.1_7 Forward -221 -202 8.84924 0.239
NP_442262.1_10 Reverse -270 -277 13.0188 0.0314
NP_442262.1_10 Forward -277 -270 11.6422 0.092
NP_440344.1_10 Reverse -262 -279 -4.38605 0.0956
NP_440531.1_6 Forward -286 -267 -5.50708 0.299
NP_442910.1_1 Reverse -262 -281 -8.16202 0.285
NP_442065.1_5 Forward -321 -302 -2.16383 0.197
NP_440297.1_9 Forward -277 -267 9.91146 0.0917
NP_440297.1_9 Reverse -270 -280 -0.118297 0.282
NP_440350.1_5 Forward -358 -339 -3.14714 0.255
NP_440999.1_5 Reverse -55 -74 7.76679 0.291
NP_440888.1_2 Forward -284 -270 9.04542 0.139
NP_440600.1_4 Forward -286 -268 -5.29072 0.276
NP_441543.1_2 Reverse -203 -212 7.37455 0.127
NP_441543.1_2 Forward -277 -268 7.07956 0.131
NP_441469.1_8 Reverse -268 -277 12.1928 0.123
NP_441469.1_8 Forward -279 -270 5.60459 0.258
NP_443064.1_6 Reverse -21 -31 9.17338 0.242
NP_442578.1_7 Reverse -390 -397 6.72562 0.18
NP_441462.1_2 Forward -278 -268 0.471689 0.148
NP_443062.1_6 Forward -79 -60 0.392778 0.295
NP_440516.1_8 Reverse -269 -278 -0.196935 0.185
NP_442428.1_5 Reverse -270 -277 14.1988 0.0242
NP_442428.1_5 Forward -277 -270 6.0373 0.212
NP_441353.1_8 Forward -237 -218 17.1974 0.245
NP_442120.1_10 Reverse -196 -215 -14.3569 0.288
NP_440673.1_3 Forward -276 -269 11.6422 0.0724
NP_441052.1_2 Reverse -269 -279 7.05986 0.0818
NP_441052.1_2 Reverse -202 -212 0.766681 0.256
NP_440436.1_4 Forward -277 -268 12.979 0.0276
NP_441884.1_9 Reverse -266 -285 -24.0916 0.284
NP_441719.1_4 Reverse -270 -277 6.62729 0.151
NP_441719.1_4 Forward -277 -270 6.52896 0.188
NP_442366.1_3 Forward -279 -261 1.49411 0.149
NP_442206.1_10 Reverse -269 -284 -0.413427 0.292
NP_441851.1_4 Forward -104 -85 10.6192 0.271
NP_441851.1_10 Reverse -268 -278 15.8113 0.00552
NP_441851.1_10 Forward -279 -269 4.40493 0.271
NP_442515.1_1 Reverse -268 -282 0.491246 0.19
NP_440463.1_4 Forward -169 -150 17.8948 0.126
NP_440463.1_8 Forward -396 -377 6.82221 0.269
NP_441349.1_10 Forward -288 -269 -0.295539 0.0936
NP_440432.1_9 Forward -277 -262 7.45305 0.0427
NP_440431.1_4 Reverse -231 -250 -10.1703 0.297
NP_442450.1_5 Reverse -267 -277 7.64985 0.13
NP_440588.1_2 Forward -287 -268 4.52268 0.0801
NP_440588.1_2 Forward -233 -214 -6.09707 0.269
NP_442006.1_2 Reverse -377 -394 -17.7591 0.282
NP_442243.1_1 Forward -284 -266 1.10005 0.22
NP_441078.1_4 Reverse -269 -278 7.66954 0.052
NP_441078.1_4 Forward -278 -269 0.491382 0.188
NP_441078.1_4 Forward -349 -340 -1.08191 0.222
NP_441078.1_4 Reverse -340 -349 -2.06522 0.295
NP_442348.1_2 Forward -218 -209 9.53783 0.28
NP_440526.1_3 Forward -277 -266 10.9729 0.0646
NP_441432.1_8 Reverse -268 -277 5.60459 0.147
NP_441432.1_8 Reverse -274 -283 2.55633 0.298
NP_441732.1_2 Reverse -336 -352 -8.0046 0.105
NP_442489.1_7 Reverse -269 -278 8.1612 0.0294
NP_442489.1_7 Forward -278 -269 0.491382 0.178
NP_440941.1_1 Reverse -323 -333 16.2046 0.252
NP_440559.1_1 Forward -277 -268 7.66954 0.0999
NP_440559.1_1 Reverse -270 -279 6.78456 0.128
NP_441659.2_8 Forward -278 -268 7.74818 0.0566
NP_441659.2_8 Reverse -269 -279 5.09324 0.117
NP_442913.1_10 Reverse -260 -279 -5.01543 0.254
NP_442913.1_10 Forward -287 -268 -6.09707 0.291
NP_440779.1_5 Forward -278 -261 13.0185 0.0268
NP_442346.1_5 Reverse -268 -278 15.9097 0.00378
NP_442346.1_5 Forward -279 -269 6.07655 0.216
NP_440352.1_5 Reverse -232 -251 11.4877 0.257
NP_440352.1_5 Reverse -37 -56 9.63828 0.294
NP_440545.1_3 Reverse -336 -353 4.85706 0.0661
NP_440545.1_3 Reverse -265 -282 -6.15601 0.27
NP_441629.1_3 Reverse -6 -25 -1.96793 0.268
NP_441833.1_4 Reverse -270 -277 6.23397 0.163
NP_441833.1_4 Forward -277 -270 6.13563 0.198
NP_441895.1_10 Forward -157 -138 -18.8801 0.282
NP_442162.1_9 Reverse -270 -277 6.62729 0.142
NP_442162.1_9 Forward -277 -270 6.43063 0.208
NP_442140.1_3 Reverse -270 -280 12.2714 0.0632
NP_442140.1_3 Forward -277 -267 9.7148 0.103
NP_442497.1_10 Forward -277 -268 10.0295 0.0222
NP_442497.1_10 Reverse -270 -279 -1.18024 0.256
NP_440821.1_4 Reverse -267 -277 1.25834 0.139
NP_441239.1_9 Forward -280 -268 7.51213 0.158
NP_441239.1_9 Reverse -267 -279 6.1355 0.2
NP_441727.1_8 Forward -391 -372 1.47442 0.223
NP_441892.1_1 Reverse -260 -277 7.11867 0.0915
NP_442669.1_1 Forward -266 -247 -0.000545616 0.299
NP_441617.1_6 Forward -252 -233 -2.36049 0.258
NP_441617.1_6 Forward -205 -186 -6.78538 0.288
NP_442052.1_8 Reverse -267 -277 14.0414 0.253
NP_440462.1_4 Reverse -323 -337 9.14437 0.243
NP_440868.1_4 Forward -282 -270 -0.157684 0.248
NP_440374.1_6 Forward -168 -149 18.1907 0.142
NP_442402.1_1 Forward -184 -165 14.0608 0.186
NP_442402.1_10 Forward -175 -165 13.7459 0.199
NP_441848.1_4 Reverse -236 -252 10.6064 0.25
NP_441848.1_9 Forward -44 -33 11.6612 0.268
NP_440696.1_9 Forward -75 -56 12.3883 0.296
NP_442039.1_4 Reverse -270 -277 6.3323 0.289
NP_442039.1_7 Reverse -271 -281 14.3364 0.211
NP_440825.1_7 Forward -116 -106 11.8361 0.2
NP_442837.1_3 Reverse -270 -277 6.0373 0.25
NP_442837.1_3 Forward -277 -270 5.93897 0.265
NP_442532.1_1 Reverse -236 -250 8.8503 0.292
NP_441408.2_7 Reverse -200 -219 -4.72043 0.286
NP_440914.1_1 Reverse -269 -279 14.1778 0.0178
NP_442533.1_1 Reverse -31 -50 -16.9135 0.277
NP_442533.1_6 Forward -278 -269 7.66954 0.0897
NP_442533.1_6 Reverse -269 -278 6.8829 0.101
NP_442533.1_6 Reverse -62 -71 2.458 0.255
NP_440661.1_10 Reverse -49 -68 16.2241 0.254
NP_442541.1_6 Forward -392 -373 22.418 0.0717
NP_442232.1_9 Reverse -347 -366 14.2566 0.224
NP_442229.1_1 Forward -280 -266 16.5185 0.0828
NP_443016.1_1 Reverse -263 -282 -4.22878 0.232
NP_439944.1_9 Reverse -270 -280 5.78156 0.221
NP_441028.1_6 Forward -54 -44 12.0743 0.192
NP_441527.1_4 Reverse -230 -249 -8.45146 0.244
NP_441527.1_4 Reverse -221 -240 -12.8441 0.294
NP_440007.1_9 Reverse -265 -279 4.71948 0.267
NP_439965.1_7 Forward -209 -190 14.0184 0.242
NP_441106.1_1 Reverse -268 -277 6.5879 0.0893
NP_441286.1_1 Forward -279 -267 4.36554 0.0342
NP_442674.1_3 Reverse -261 -280 2.75194 0.299
NP_440670.1_8 Reverse -269 -278 6.78456 0.099
NP_440670.1_8 Forward -278 -269 5.3096 0.167
NP_442614.1_2 Reverse -269 -283 14.6509 0.0946
NP_441069.1_1 Forward -161 -144 19.41 0.0853
NP_440907.2_8 Forward -277 -267 6.56775 0.161
NP_441021.1_1 Forward -277 -258 -9.73531 0.219
NP_441021.1_8 Reverse -264 -282 5.23069 0.215
NP_442893.1_4 Forward -255 -236 0.392004 0.223
NP_441626.1_2 Reverse -270 -277 6.52896 0.137
NP_441626.1_2 Forward -277 -270 5.93897 0.231
NP_442615.1_1 Forward -287 -269 -6.56903 0.252
NP_441431.1_2 Reverse -266 -280 8.3571 0.218
NP_440467.1_3 Forward -22 -3 11.3539 0.278
NP_440114.1_5 Reverse -373 -392 10.3242 0.213
NP_441853.1_5 Reverse -196 -215 0.58944 0.279
NP_442087.1_2 Reverse -40 -59 15.4385 0.178
NP_439988.1_3 Reverse -320 -334 4.32615 0.295
NP_441237.1_9 Forward -277 -267 16.893 0.01
NP_442940.1_2 Forward -351 -332 4.32602 0.243
NP_442130.1_9 Forward -235 -216 9.63589 0.267
NP_441436.1_2 Reverse -323 -342 -5.99873 0.296
NP_441253.1_8 Reverse -264 -278 11.8274 0.229
NP_442862.1_3 Forward -107 -90 11.5436 0.202
NP_441885.1_5 Reverse -269 -279 2.04498 0.0868
NP_442703.1_9 Reverse -127 -145 9.75391 0.244
NP_442341.1_7 Reverse -20 -34 3.8345 0.21
NP_442341.1_9 Reverse -60 -74 10.0287 0.141
NP_442341.1_9 Forward -280 -266 7.76712 0.187
NP_441756.1_5 Forward -353 -334 -1.96717 0.267
NP_441173.1_9 Forward -174 -166 9.75379 0.284
NP_441842.1_10 Reverse -262 -276 14.3559 0.0606
NP_443060.1_1 Reverse -216 -235 7.07848 0.3
NP_440679.1_10 Forward -393 -374 -20.5517 0.286
NP_442451.1_2 Forward -286 -267 -8.55534 0.251
NP_440149.1_8 Reverse -269 -288 -5.60541 0.23
NP_442127.1_1 Forward -54 -36 7.19654 0.227
NP_440216.1_1 Forward -71 -57 -11.3085 0.178
NP_440216.1_9 Reverse -271 -280 7.17789 0.286
NP_440172.1_1 Reverse -269 -279 5.68323 0.136
NP_442015.1_10 Forward -282 -269 2.87088 0.187
NP_441226.1_7 Forward -277 -270 14.1984 0.024
NP_441111.1_7 Forward -277 -269 8.86921 0.0589
NP_441766.1_2 Forward -278 -269 6.39124 0.0993
NP_440416.1_9 Forward -285 -266 -17.6018 0.243
NP_442403.1_9 Forward -217 -198 2.45773 0.285
NP_442154.1_1 Forward -388 -370 -8.14232 0.157
NP_442154.1_1 Reverse -322 -340 -10.9939 0.211
NP_440261.1_5 Reverse -270 -283 -4.40561 0.147
NP_440261.1_5 Reverse -341 -354 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTTTACCGCTGCCGTTTTAGCGCCGGTGTTTGAAGAAATTATCTTCCGGGGCTTTCTCCTACCAGCCCTAACCCGCTACTTTCCCGTTAGTGTAGCCATTATTCTCAGCAGTTTACTGTTTGCCATCGCCCATTTGAATGTGTCGGAAATTTTACCTTTATTTGTTTTGGGCTCCATTCTCGGCCTTGTTTATAGCCGTTCCCGCAATCTTTTATCTTCGATGATTCTCCACAGTCTCTGGAATAGTGGAACATTGTTAAGCCTATTTATTTTGGGTGGCAGTTGAATGCTGATAGTGCCCTGATTTTGAAAGTAAGATTCTAGAATGGTGCTGGCAGGCCGAATTTTCCTCTAGCCCCCTAACCTGTGGTGAGTCGCCAGTGGACTGGTGAGTTTTT

CDS

ATGGACTGGCTTTTCTATTTGTTCTTAACAGCCGTTTTTTACGTTTACCGTTTAGTCAGCCTGAAATCGAGAACAGAGCAGGAACGCATCGGTTCAACGCCGGTGTTTTTCTCTACCCTCGGTTTTTTTGCCATTTTTGAATTTGTTTTTGCGGACTCTTTGTTTAGACTGCCACTATTTCATGTTTTAGGGCTAATTTTTTCCTTTATTTGTGCTTTTACCATTTATATTTACCTGCGGAATTTAAAAAAGGAGGTAGAAGTGATTTTCGAAAAATTAGTCAAACAAAGTCAGGGCAAAGTGAGCGTACTGACTTTTATGCAACGTACTAACATGACTAAAGATGAAGCCATGGATTACTTAGACGCCAAATTACGCCAGCTCCCTGGCATCACCTACGAAACCCTGGGCAATATTTATTATGAATTTGACCGTTGGTAA

Protein

MDWLFYLFLTAVFYVYRLVSLKSRTEQERIGSTPVFFSTLGFFAIFEFVFADSLFRLPLFHVLGLIFSFICAFTIYIYLRNLKKEVEVIFEKLVKQSQGKVSVLTFMQRTNMTKDEAMDYLDAKLRQLPGITYETLGNIYYEFDRW