Your browser is old and dusty. Try Google Chrome!

Details for slr0957

ORF slr0957
Accession NP_441743.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -151 -132 -29.2048 0.219
NP_442151.1_6 Reverse -173 -187 6.3911 0.236
NP_442151.1_6 Forward -309 -295 5.50613 0.274
NP_440226.1_1 Reverse -130 -149 1.76941 0.29
NP_441465.1_8 Forward -285 -267 4.73903 0.299
NP_442752.1_4 Reverse -130 -137 4.26735 0.293
NP_442062.1_8 Reverse -130 -140 4.50326 0.212
NP_441492.1_5 Forward -25 -6 3.25662 0.291
NP_441619.1_8 Reverse -118 -132 9.34041 0.221
NP_441594.1_6 Forward -185 -166 4.03102 0.223
NP_441594.1_6 Reverse -170 -189 0.982764 0.276
NP_442276.1_2 Reverse -337 -356 3.93269 0.299
NP_442367.1_1 Forward -270 -251 -11.1119 0.264
NP_440856.1_1 Forward -186 -167 -2.26216 0.231
NP_442827.1_8 Forward -147 -128 -0.984623 0.238
NP_441738.1_2 Reverse -263 -270 6.52862 0.261
NP_441558.1_5 Forward -72 -53 6.78429 0.202
NP_441558.1_7 Reverse -132 -151 8.55425 0.276
NP_442889.1_8 Reverse -297 -311 5.89884 0.211
NP_442889.1_8 Reverse -127 -141 4.62054 0.26
NP_441713.1_1 Reverse -275 -294 -10.6203 0.204
NP_441770.1_10 Reverse -165 -184 16.9124 0.157
NP_440178.1_7 Reverse -129 -148 -21.83 0.241
NP_441495.1_3 Reverse -323 -342 24.2863 0.0209
NP_441387.1_8 Forward -35 -16 13.5117 0.271
NP_440343.1_3 Forward -125 -107 3.75497 0.266
NP_440438.2_8 Reverse -15 -34 10.6192 0.0807
NP_441209.1_8 Reverse -148 -166 11.5237 0.188
NP_441194.1_1 Forward -35 -16 14.9441 0.216
NP_441265.1_3 Reverse -343 -357 2.16287 0.2
NP_442848.1_1 Forward -270 -256 -0.885388 0.263
NP_442848.1_5 Reverse -172 -190 -1.16082 0.276
NP_441634.1_8 Reverse -168 -182 -4.62196 0.295
NP_440376.1_1 Forward -182 -173 4.81794 0.149
NP_441846.1_10 Reverse -110 -129 -22.6167 0.264
NP_441029.1_4 Forward -147 -128 -3.63879 0.283
NP_442782.1_2 Reverse -119 -133 3.24451 0.267
NP_441414.1_9 Reverse -142 -161 -10.7186 0.293
NP_439905.1_1 Reverse -29 -42 8.86907 0.228
NP_441097.1_2 Forward -278 -261 2.89044 0.293
NP_439990.1_6 Reverse -142 -161 8.35759 0.233
NP_442911.1_2 Forward -149 -130 -0.885524 0.0793
NP_442911.1_2 Reverse -120 -139 -5.70374 0.165
NP_440153.1_8 Reverse -173 -186 6.4108 0.17
NP_440325.1_1 Forward -33 -14 22.5172 0.0192
NP_443055.1_6 Reverse -134 -152 -1.16155 0.273
NP_440496.1_9 Forward -227 -208 -3.83545 0.263
NP_441099.1_6 Reverse -323 -342 13.9625 0.282
NP_442002.1_9 Reverse -129 -136 14.1004 0.074
NP_441646.1_1 Reverse -123 -142 2.3594 0.218
NP_441646.1_1 Forward -183 -164 -1.86883 0.296
NP_442438.1_10 Forward -144 -130 2.85119 0.168
NP_442438.1_10 Forward -184 -170 -0.000409212 0.244
NP_442771.1_1 Forward -141 -123 -9.0273 0.213
NP_441674.1_2 Reverse -175 -194 6.09597 0.297
NP_441550.1_8 Reverse -128 -138 5.48612 0.247
NP_440465.1_10 Reverse -164 -183 1.47442 0.275
NP_442996.1_5 Forward -317 -298 4.62101 0.251
NP_441725.1_5 Forward -138 -128 -0.904945 0.274
NP_440260.1_8 Forward -146 -128 -5.19239 0.273
NP_442172.1_1 Reverse -151 -170 17.093 0.17
NP_441644.1_6 Forward -182 -172 3.51951 0.277
NP_441644.1_6 Reverse -173 -183 3.42118 0.282
NP_443049.1_6 Reverse -129 -139 13.1048 0.203
NP_442215.1_2 Forward -311 -295 3.89344 0.0903
NP_441810.1_5 Reverse -27 -46 6.4893 0.297
NP_440253.1_2 Reverse -173 -191 -1.65248 0.245
NP_440780.1_1 Forward -39 -20 6.92274 0.289
NP_441751.2_8 Forward -138 -124 2.06454 0.0884
NP_441762.1_7 Reverse -166 -178 -6.64753 0.284
NP_442408.2_1 Reverse -307 -326 -5.9004 0.279
NP_440730.1_10 Reverse -61 -80 16.5182 0.164
NP_440158.1_1 Forward -31 -12 9.31004 0.284
NP_440379.1_5 Forward -191 -172 -11.0136 0.288
NP_441758.1_7 Forward -138 -124 18.4851 0.114
NP_441020.2_6 Forward -272 -255 6.13536 0.275
NP_441015.1_10 Reverse -114 -133 -8.16202 0.272
NP_441673.1_1 Forward -182 -173 -7.86675 0.187
NP_441673.1_1 Reverse -173 -182 -7.96508 0.206
NP_442490.1_9 Reverse -118 -137 -1.08219 0.179
NP_442490.1_9 Forward -191 -172 -7.67036 0.278
NP_441764.1_4 Forward -34 -17 10.0772 0.27
NP_441906.1_5 Forward -213 -194 8.75009 0.279
NP_441878.1_6 Forward -183 -173 -7.00147 0.201
NP_441590.1_4 Forward -132 -113 1.6703 0.299
NP_440084.1_8 Forward -166 -152 9.6563 0.28
NP_442183.1_1 Forward -270 -256 6.88276 0.157
NP_441574.1_1 Reverse -167 -186 -5.50708 0.263
NP_442347.1_2 Forward -138 -129 5.40793 0.23
NP_442965.1_2 Forward -86 -67 -1.96717 0.255
NP_440547.1_1 Forward -193 -174 8.75009 0.256
NP_442888.1_9 Reverse -167 -186 20.4523 0.0448
NP_442594.1_8 Reverse -108 -127 2.0644 0.295
NP_441633.1_3 Forward -141 -128 2.87088 0.0834
NP_441633.1_3 Forward -213 -200 -6.96221 0.283
NP_442590.1_10 Reverse -167 -186 5.60432 0.258
NP_442998.1_10 Forward -137 -130 5.93897 0.206
NP_440299.1_1 Forward -242 -229 2.87033 0.269
NP_441743.1_1 Forward -199 -180 34.1203 0.000027
NP_441743.1_2 Forward -166 -147 20.535 0.114
NP_441743.1_3 Forward -283 -264 25.3688 0.0135
NP_441743.1_4 Forward -253 -234 26.9421 0.00347
NP_441743.1_5 Forward -223 -204 24.4839 0.0275
NP_441743.1_6 Forward -367 -348 33.727 0.00000228
NP_441743.1_7 Forward -304 -285 19.6656 0.276
NP_441743.1_9 Forward -33 -14 22.9106 0.0635
NP_441559.1_8 Forward -216 -202 -4.81863 0.238
NP_442860.1_7 Forward -37 -19 7.06387 0.293
NP_440915.1_6 Forward -306 -292 -3.44199 0.296
NP_440215.1_10 Forward -271 -252 13.6675 0.257
NP_440306.1_8 Forward -165 -146 -1.08295 0.224
NP_440695.1_6 Forward -160 -146 11.5748 0.265
NP_439985.1_2 Reverse -175 -194 8.65258 0.209
NP_441404.1_8 Forward -236 -222 13.4703 0.271
NP_442327.1_3 Forward -171 -152 17.9998 0.156
NP_440586.1_1 Forward -186 -167 -3.14714 0.263
NP_440586.1_8 Reverse -131 -138 12.6251 0.0546
NP_443051.1_1 Reverse -129 -138 -1.18024 0.297
NP_441232.1_10 Forward -150 -131 4.916 0.187
NP_439937.1_8 Forward -190 -171 4.81767 0.199
NP_439937.1_8 Forward -187 -168 1.86774 0.219
NP_442294.1_3 Reverse -198 -212 12.2903 0.29
NP_441167.1_1 Forward -25 -6 8.55425 0.213
NP_440439.1_1 Forward -179 -166 -0.0790467 0.207
NP_441789.1_7 Forward -220 -201 -0.689632 0.251
NP_441789.1_7 Forward -129 -110 -3.63955 0.277
NP_441789.1_7 Forward -127 -108 -3.93454 0.28
NP_441803.1_2 Reverse -168 -187 0.982764 0.242
NP_442368.1_3 Forward -274 -256 9.45892 0.3
NP_441572.1_1 Forward -153 -134 18.9773 0.0125
NP_442384.1_10 Reverse -167 -180 5.72248 0.121
NP_440948.1_10 Forward -125 -106 13.5691 0.261
NP_441877.1_7 Forward -193 -174 1.37531 0.242
NP_440075.1_2 Forward -282 -263 3.14605 0.292
NP_440189.1_2 Reverse -159 -178 3.14605 0.268
NP_440350.1_5 Reverse -65 -84 -5.40875 0.289
NP_440999.1_2 Reverse -213 -232 12.9791 0.177
NP_440888.1_2 Reverse -173 -187 8.3571 0.163
NP_442277.1_2 Reverse -27 -41 19.1741 0.0963
NP_442277.1_4 Forward -185 -166 0.785326 0.299
NP_441949.1_5 Forward -34 -15 12.0296 0.25
NP_440575.1_3 Forward -190 -171 17.5024 0.266
NP_442845.1_2 Forward -308 -294 4.22782 0.264
NP_442845.1_4 Forward -178 -159 5.80098 0.268
NP_442710.1_7 Reverse -153 -172 1.33103 0.175
NP_442578.1_7 Reverse -131 -138 12.6255 0.0418
NP_441621.1_7 Reverse -177 -191 -6.29359 0.283
NP_443062.1_6 Reverse -162 -181 1.47442 0.275
NP_442204.1_1 Forward -278 -267 3.20526 0.266
NP_441351.1_8 Reverse -174 -193 1.17943 0.276
NP_442859.1_2 Forward -273 -254 9.14423 0.199
NP_442120.1_10 Forward -296 -277 -11.7019 0.264
NP_440778.1_8 Forward -155 -136 20.059 0.187
NP_440673.1_2 Forward -368 -349 8.43855 0.27
NP_440673.1_3 Forward -137 -130 10.1672 0.149
NP_441052.1_2 Reverse -130 -140 3.81494 0.173
NP_440689.1_1 Forward -257 -239 7.68896 0.297
NP_441336.1_9 Reverse -321 -340 20.649 0.132
NP_441719.1_4 Reverse -131 -138 3.77569 0.285
NP_441004.1_4 Forward -153 -143 10.9931 0.254
NP_442694.1_4 Forward -368 -359 12.5861 0.249
NP_441851.1_10 Reverse -129 -139 4.0116 0.291
NP_440682.1_2 Reverse -174 -193 -16.7168 0.262
NP_442515.1_1 Forward -183 -169 -0.688726 0.231
NP_442515.1_1 Reverse -129 -143 -0.787057 0.235
NP_441982.1_6 Reverse -147 -156 11.5304 0.288
NP_441982.1_6 Reverse -146 -155 11.5304 0.288
NP_442709.1_4 Forward -172 -153 7.97961 0.161
NP_442450.1_5 Reverse -259 -269 6.07655 0.204
NP_440943.1_6 Forward -297 -278 14.2574 0.267
NP_442006.1_2 Forward -283 -266 -15.9891 0.235
NP_441078.1_4 Forward -182 -173 -1.57357 0.266
NP_440793.1_1 Reverse -65 -79 10.6187 0.289
NP_440760.1_1 Forward -139 -120 -16.8151 0.187
NP_442797.1_7 Reverse -166 -184 -0.374176 0.282
NP_442353.1_4 Forward -188 -169 3.24359 0.22
NP_440713.1_4 Reverse -113 -132 3.6377 0.24
NP_442489.1_7 Forward -182 -173 -1.08191 0.179
NP_441659.2_8 Reverse -173 -183 3.71661 0.152
NP_441040.1_5 Reverse -250 -269 4.42435 0.248
NP_442849.1_1 Forward -83 -69 9.04604 0.264
NP_440708.1_6 Forward -126 -107 -9.93197 0.275
NP_442346.1_5 Reverse -129 -139 4.20827 0.296
NP_440545.1_3 Forward -143 -126 -5.36936 0.247
NP_442851.1_3 Reverse -171 -190 4.52268 0.298
NP_441126.1_6 Reverse -145 -159 14.5155 0.267
NP_443040.1_1 Reverse -150 -164 9.79739 0.291
NP_440671.1_4 Reverse -187 -201 5.50613 0.281
NP_440671.1_5 Reverse -260 -274 14.5519 0.273
NP_442140.1_3 Reverse -168 -178 4.60159 0.242
NP_440875.1_9 Reverse -169 -179 11.0001 0.187
NP_440567.1_1 Forward -138 -124 5.21113 0.105
NP_442497.1_10 Forward -138 -129 0.196389 0.208
NP_440821.1_4 Reverse -128 -138 0.0783647 0.205
NP_441951.1_4 Forward -308 -289 2.94938 0.283
NP_442193.1_1 Reverse -110 -128 7.78729 0.28
NP_441508.1_1 Reverse -17 -36 15.5553 0.104
NP_440863.1_1 Forward -82 -68 13.9992 0.25
NP_443035.1_3 Forward -334 -315 17.1082 0.291
NP_442138.1_9 Reverse -358 -377 8.94676 0.254
NP_440546.1_4 Forward -302 -292 11.5973 0.0774
NP_440546.1_4 Reverse -293 -303 8.59164 0.181
NP_442349.1_9 Reverse -166 -184 4.73903 0.133
NP_442592.1_2 Reverse -130 -149 3.83436 0.297
NP_440401.1_9 Forward -206 -199 12.6251 0.287
NP_441497.1_3 Reverse -141 -160 -10.227 0.294
NP_442479.1_9 Forward -99 -80 -10.9153 0.273
NP_442402.1_4 Forward -165 -146 4.52188 0.144
NP_440696.1_3 Forward -274 -256 0.117479 0.237
NP_442039.1_4 Forward -263 -256 8.39725 0.202
NP_442039.1_7 Reverse -144 -154 15.123 0.211
NP_441811.1_8 Forward -145 -131 12.3893 0.209
NP_442696.1_6 Forward -215 -196 -13.2752 0.27
NP_442837.1_3 Forward -138 -131 9.87221 0.106
NP_442837.1_4 Forward -150 -131 13.0775 0.233
NP_440160.1_7 Reverse -281 -300 13.1758 0.223
NP_441203.1_1 Forward -138 -119 -15.8318 0.242
NP_442174.1_9 Forward -304 -285 6.4893 0.288
NP_442533.1_1 Reverse -112 -131 -13.7669 0.238
NP_442533.1_1 Reverse -114 -133 -17.3068 0.285
NP_442533.1_6 Reverse -173 -182 5.50626 0.14
NP_442533.1_6 Forward -182 -173 4.22796 0.186
NP_442533.1_6 Forward -176 -167 3.14632 0.224
NP_442232.1_3 Reverse -122 -141 -10.227 0.266
NP_442322.1_4 Reverse -257 -274 2.10309 0.21
NP_441527.1_4 Forward -77 -58 -8.54695 0.247
NP_441527.1_4 Reverse -151 -170 -9.59736 0.26
NP_440115.1_6 Reverse -127 -137 7.15819 0.158
NP_439965.1_1 Forward -371 -352 -8.65367 0.275
NP_441059.1_2 Forward -306 -287 -6.49039 0.265
NP_440646.1_1 Forward -349 -330 5.211 0.119
NP_441286.1_1 Forward -140 -128 3.2839 0.048
NP_442674.1_3 Reverse -292 -311 6.98015 0.222
NP_442614.1_2 Forward -182 -168 11.2093 0.206
NP_440028.1_6 Forward -97 -79 10.5406 0.277
NP_440907.2_8 Forward -125 -115 8.3377 0.117
NP_441021.1_1 Reverse -131 -150 -6.29373 0.179
NP_441021.1_1 Forward -138 -119 -9.93197 0.224
NP_441463.1_3 Forward -149 -130 4.916 0.081
NP_441463.1_3 Reverse -132 -151 -8.26035 0.267
NP_442209.1_6 Forward -334 -315 12.1925 0.292
NP_441962.1_4 Reverse -174 -193 -7.4737 0.189
NP_440387.1_1 Reverse -130 -146 1.43517 0.104
NP_441425.1_4 Forward -389 -375 17.4042 0.282
NP_441272.1_4 Forward -311 -292 9.24257 0.181
NP_440293.1_3 Reverse -111 -130 -2.16383 0.239
NP_440766.1_5 Reverse -146 -158 7.27382 0.29
NP_440457.1_1 Reverse -126 -138 7.70879 0.101
NP_440457.1_1 Forward -396 -384 4.95553 0.15
NP_440457.1_1 Forward -274 -262 -0.74767 0.273
NP_440798.1_6 Forward -125 -112 9.55739 0.0943
NP_441436.1_8 Reverse -172 -191 6.68596 0.297
NP_440473.1_1 Forward -129 -110 10.9682 0.285
NP_441253.1_1 Reverse -132 -151 3.53937 0.297
NP_442514.1_5 Reverse -292 -311 -9.04772 0.294
NP_442862.1_3 Forward -158 -141 6.52869 0.263
NP_441173.1_9 Forward -154 -146 11.4254 0.226
NP_441902.1_3 Reverse -249 -259 12.9817 0.23
NP_441207.1_7 Reverse -151 -165 11.0948 0.249
NP_442373.1_2 Reverse -101 -120 -4.42544 0.205
NP_440216.1_6 Forward -183 -167 1.04184 0.237
NP_440172.1_1 Reverse -281 -291 5.19158 0.149
NP_441226.1_7 Forward -150 -143 9.47853 0.147
NP_440198.1_2 Reverse -133 -152 14.4233 0.276
NP_442379.1_10 Forward -146 -129 -2.3211 0.228
NP_440072.1_5 Reverse -110 -128 0.510803 0.236
NP_440591.1_5 Reverse -134 -153 12.1917 0.207
NP_442154.1_1 Reverse -111 -129 -16.2055 0.236
NP_442154.1_6 Forward -189 -170 4.32602 0.234
NP_442564.1_9 Reverse -130 -144 14.0253 0.256
NP_440988.1_10 Reverse -171 -185 9.93309 0.19
NP_440988.1_10 Forward -184 -170 7.80321 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTTAGCCGTGCGTTGGAAACATTGAAGGAGTCTGGCTTTTGGATCTATGGCACCGTAGCAGGGAAACAAACTGCTCTGCATCAAGCGGATTTGCGAGAACCCATGGGGTTAGTAATTGGCTCGGAAGGAGAGGGATTGAGCTTGCTCACCCAAAAACACTGTGACCATCTAATTACCATTCCTTTAGCCGGTAAAACCCCCAGTCTGAATGCTTCTGTGGCGGCGGCCATCAGTCTTTATGAAATTTTTCGCCAACGGGGTTTTGATCGCCCCACCCTATCCCACACTGCCTCCGACTTACGAGAAGTTTCCGAGGATTAGGAAAAGAAGGGACAAGGTAGCAGATTTAATTACGATTCTGCCGGCAATGTAACAAAATATTGCGGATTGGAAAGTTAAA

CDS

ATGACAGCAAACAAATCCCATTACCTTGTCTCTATCCCTACCCAAAGTCCTATGAAAGAACTGTGGATCCGTGTTTTATCCTTGCTGGGCATGGCTCACTGGGTTGTAATTAGCACCGGCGCTCCTCGCTGTACCTATTATTTTGGCCCCTTTGCCCGCCGTAGTAGTGCGGAAAAAGCCCAGCTAGGCTACCTGGAGGATTTGCGGGGAGAAGGAGCCCAGGATATTCAGGTAACCGTCAAGCAATGTAAGCCCGCCCGCTTGACCATTTTTGATGAGGCAGAGGAGTTAATGCCTATCCTTTCTCCCTAG

Protein

MTANKSHYLVSIPTQSPMKELWIRVLSLLGMAHWVVISTGAPRCTYYFGPFARRSSAEKAQLGYLEDLRGEGAQDIQVTVKQCKPARLTIFDEAEELMPILSP