Your browser is old and dusty. Try Google Chrome!

Details for slr0954

ORF slr0954
Accession NP_441741.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -99 -85 17.8958 0.0212
NP_441061.1_2 Reverse -92 -106 11.701 0.0507
NP_440795.1_7 Forward -99 -92 14.6904 0.0123
NP_440795.1_7 Reverse -92 -99 14.6904 0.0123
NP_440795.1_7 Forward -314 -307 14.1988 0.0267
NP_441418.1_6 Forward -100 -81 -22.125 0.169
NP_441418.1_6 Reverse -27 -46 -23.1083 0.191
NP_441418.1_6 Reverse -91 -110 -29.3032 0.221
NP_441453.1_4 Reverse -91 -99 16.539 0.00633
NP_441453.1_4 Forward -100 -92 16.539 0.00633
NP_441453.1_4 Forward -315 -307 6.90259 0.121
NP_442151.1_6 Reverse -91 -105 16.6175 0.0139
NP_442151.1_6 Forward -100 -86 6.3911 0.236
NP_440226.1_1 Forward -100 -81 6.98095 0.115
NP_441630.1_3 Forward -108 -89 -1.18052 0.293
NP_442623.1_3 Reverse -92 -111 -18.2901 0.263
NP_441976.1_1 Reverse -28 -47 14.7491 0.135
NP_442173.1_1 Forward -99 -91 15.4574 0.00633
NP_442173.1_1 Reverse -92 -100 15.4574 0.00633
NP_442173.1_1 Reverse -307 -315 7.59091 0.163
NP_442752.1_4 Forward -100 -93 13.8055 0.0199
NP_442752.1_4 Reverse -91 -98 13.8055 0.0199
NP_442752.1_4 Reverse -288 -295 6.52896 0.154
NP_443027.1_4 Forward -102 -92 15.3197 0.0437
NP_443027.1_4 Reverse -89 -99 13.943 0.0452
NP_443027.1_4 Reverse -304 -314 6.8632 0.262
NP_443027.1_4 Forward -317 -307 6.37155 0.283
NP_441812.1_3 Forward -284 -270 13.7659 0.151
NP_442975.1_10 Reverse -87 -101 12.782 0.0459
NP_442975.1_10 Forward -104 -90 11.2087 0.0508
NP_442975.1_10 Forward -319 -305 6.0955 0.193
NP_440784.1_7 Forward -99 -92 15.9687 0.0123
NP_440784.1_7 Reverse -92 -99 15.9687 0.0123
NP_440784.1_7 Reverse -307 -314 13.2155 0.0365
NP_440784.1_7 Forward -314 -307 12.1338 0.0604
NP_442861.1_1 Reverse -203 -222 16.0274 0.218
NP_441054.1_2 Reverse -201 -220 9.53756 0.292
NP_441476.1_5 Reverse -86 -105 10.2259 0.0933
NP_441476.1_5 Forward -105 -86 -6.29373 0.273
NP_442062.1_3 Forward -393 -374 5.89931 0.182
NP_442062.1_8 Forward -100 -90 19.4496 0.000558
NP_442062.1_8 Reverse -91 -101 10.3048 0.0493
NP_440761.1_4 Reverse -86 -105 -3.93378 0.132
NP_441859.1_3 Forward -101 -82 14.6499 0.0704
NP_441859.1_3 Reverse -90 -109 1.76863 0.275
NP_440304.1_4 Forward -102 -92 18.9579 0.00406
NP_440304.1_4 Reverse -89 -99 9.91146 0.051
NP_442242.1_4 Forward -99 -92 14.3954 0.0124
NP_442242.1_4 Reverse -92 -99 14.3954 0.0124
NP_442242.1_4 Forward -314 -307 12.0355 0.0521
NP_442242.1_4 Reverse -307 -314 11.5438 0.089
NP_441208.1_9 Forward -103 -89 7.86607 0.219
NP_441208.1_9 Reverse -88 -102 7.76774 0.219
NP_441594.1_6 Reverse -82 -101 11.7008 0.116
NP_441594.1_6 Forward -109 -90 7.07928 0.181
NP_441594.1_6 Forward -97 -78 3.44104 0.23
NP_442276.1_2 Reverse -294 -313 6.4893 0.291
NP_442110.1_7 Reverse -91 -105 11.111 0.0636
NP_442110.1_7 Forward -100 -86 0.196253 0.266
NP_441925.1_4 Reverse -23 -42 -16.5208 0.284
NP_440856.1_1 Reverse -81 -100 -5.40875 0.276
NP_440856.1_1 Forward -110 -91 -5.50708 0.276
NP_440856.1_4 Forward -107 -88 -3.63879 0.234
NP_441083.1_5 Forward -100 -90 11.3864 0.0159
NP_441083.1_5 Reverse -91 -101 11.2881 0.0159
NP_442827.1_8 Forward -108 -89 7.76679 0.0938
NP_442827.1_8 Reverse -83 -102 1.6703 0.173
NP_441434.1_6 Reverse -124 -134 14.1397 0.288
NP_441434.1_7 Forward -98 -84 5.1128 0.225
NP_441738.1_2 Forward -98 -91 15.28 0.0102
NP_441738.1_2 Reverse -93 -100 15.28 0.0102
NP_441738.1_4 Forward -110 -91 5.11266 0.207
NP_441558.1_5 Reverse -304 -323 10.3242 0.1
NP_441558.1_5 Forward -102 -83 5.211 0.257
NP_440209.1_1 Reverse -91 -99 18.1123 0.00295
NP_440209.1_1 Forward -100 -92 18.1123 0.00295
NP_440209.1_2 Reverse -156 -172 11.2683 0.244
NP_442889.1_8 Reverse -88 -102 3.63724 0.273
NP_441713.1_1 Reverse -85 -104 -14.4552 0.259
NP_441713.1_1 Reverse -300 -319 -15.6352 0.268
NP_441770.1_4 Forward -44 -25 -10.0303 0.263
NP_441770.1_10 Forward -102 -83 11.0125 0.23
NP_440178.1_7 Reverse -90 -109 -11.8003 0.103
NP_440178.1_7 Forward -101 -82 -21.535 0.229
NP_442111.1_4 Reverse -90 -104 12.0943 0.0451
NP_440906.1_5 Forward -99 -92 15.8704 0.0124
NP_440906.1_5 Reverse -92 -99 15.8704 0.0124
NP_440906.1_5 Reverse -307 -314 13.3138 0.0268
NP_440906.1_5 Forward -314 -307 6.13563 0.241
NP_440747.1_10 Forward -103 -91 -2.02597 0.0196
NP_440747.1_10 Reverse -88 -100 -2.02597 0.0196
NP_441130.1_10 Forward -102 -88 10.521 0.112
NP_441130.1_10 Reverse -89 -103 9.73436 0.12
NP_441130.1_10 Forward -38 -24 5.21113 0.242
NP_441854.1_10 Reverse -89 -108 2.0644 0.282
NP_441486.1_1 Reverse -88 -102 -3.44199 0.178
NP_441880.2_10 Forward -99 -81 14.0805 0.111
NP_442634.1_4 Reverse -89 -103 4.62115 0.0764
NP_442634.1_4 Forward -102 -88 4.22782 0.0819
NP_440470.1_5 Reverse -378 -397 15.0396 0.158
NP_442848.1_1 Forward -106 -92 -2.75368 0.263
NP_442848.1_1 Reverse -85 -99 -4.32697 0.287
NP_442848.1_9 Forward -106 -87 2.16274 0.255
NP_443018.1_3 Forward -99 -92 14.8871 0.0123
NP_443018.1_3 Reverse -92 -99 14.8871 0.0123
NP_443018.1_3 Reverse -9 -16 7.6106 0.156
NP_443018.1_3 Forward -314 -307 5.15232 0.226
NP_443018.1_3 Reverse -307 -314 5.05399 0.238
NP_441316.1_7 Reverse -89 -104 4.01147 0.137
NP_441316.1_7 Forward -102 -87 2.63483 0.154
NP_441316.1_7 Forward -317 -302 -0.610089 0.208
NP_441634.1_8 Forward -102 -88 5.60446 0.114
NP_440376.1_1 Forward -100 -91 19.4693 0.000692
NP_440376.1_1 Reverse -91 -100 19.4693 0.000692
NP_441588.1_4 Forward -98 -88 6.96153 0.178
NP_442687.1_7 Reverse -90 -100 15.8113 0.0125
NP_442687.1_7 Forward -101 -91 9.02648 0.0994
NP_441077.1_2 Forward -394 -375 5.1084 0.224
NP_442485.1_3 Reverse -25 -44 0.687771 0.237
NP_442485.1_3 Reverse -80 -99 -2.0655 0.261
NP_442485.1_3 Reverse -86 -105 -3.73712 0.277
NP_440642.1_1 Reverse -98 -117 6.19431 0.28
NP_440642.1_10 Reverse -383 -397 8.84875 0.198
NP_441422.1_7 Reverse -89 -106 5.9387 0.0992
NP_441422.1_7 Forward -102 -85 -4.97604 0.247
NP_440667.1_2 Forward -39 -20 -2.26216 0.232
NP_441763.1_10 Reverse -295 -314 4.91521 0.297
NP_440887.1_4 Reverse -156 -175 17.3112 0.16
NP_440360.1_10 Forward -98 -84 14.2576 0.1
NP_440360.1_10 Reverse -93 -107 4.71948 0.227
NP_442658.1_1 Reverse -89 -99 18.7607 0.00222
NP_442658.1_1 Forward -102 -92 15.9091 0.00966
NP_442658.1_1 Forward -317 -307 5.38779 0.269
NP_440141.1_8 Forward -26 -7 9.63589 0.214
NP_442205.1_9 Reverse -85 -101 8.02334 0.105
NP_442205.1_9 Forward -106 -90 1.04184 0.255
NP_440607.1_8 Reverse -80 -99 -0.590531 0.289
NP_442937.1_5 Forward -105 -86 12.1925 0.116
NP_442937.1_5 Reverse -86 -105 6.29264 0.282
NP_441958.1_5 Forward -101 -91 21.2195 0.000805
NP_441958.1_5 Reverse -90 -100 12.2714 0.00183
NP_441958.1_5 Reverse -305 -315 0.275027 0.162
NP_439905.1_1 Forward -99 -86 11.3273 0.204
NP_439905.1_1 Forward -186 -173 9.36073 0.221
NP_439905.1_1 Reverse -92 -105 6.90245 0.272
NP_440984.1_7 Reverse -86 -100 10.3243 0.126
NP_439990.1_5 Reverse -301 -314 12.114 0.121
NP_439990.1_5 Forward -105 -92 9.65572 0.136
NP_442911.1_2 Reverse -81 -100 5.60432 0.0325
NP_442911.1_2 Forward -110 -91 -1.57384 0.0871
NP_441580.1_6 Forward -111 -92 4.32602 0.117
NP_440153.1_5 Reverse -92 -106 4.22782 0.199
NP_442536.1_8 Forward -48 -29 12.0942 0.253
NP_440993.1_2 Forward -105 -89 15.2998 0.0631
NP_440138.1_6 Reverse -92 -111 12.3883 0.121
NP_441099.1_5 Forward -110 -91 7.57094 0.0426
NP_441099.1_5 Reverse -81 -100 -10.7186 0.261
NP_442002.1_9 Reverse -90 -97 10.7572 0.185
NP_441938.1_1 Forward -317 -298 9.3409 0.229
NP_441646.1_1 Forward -107 -88 6.78429 0.17
NP_442438.1_10 Reverse -86 -100 12.0943 0.0412
NP_442438.1_10 Forward -105 -91 3.04785 0.166
NP_441000.1_6 Forward -101 -87 -3.34366 0.221
NP_441000.1_6 Reverse -305 -319 -4.91696 0.254
NP_442771.1_1 Reverse -89 -107 1.19912 0.081
NP_442771.1_1 Forward -102 -84 -6.1757 0.168
NP_440147.1_4 Reverse -89 -102 12.2123 0.0326
NP_440147.1_4 Forward -102 -89 11.819 0.0326
NP_440147.1_4 Forward -317 -304 7.00078 0.0778
NP_441550.1_8 Forward -102 -92 17.4824 0.00754
NP_441550.1_8 Reverse -304 -314 11.6809 0.0446
NP_441550.1_8 Reverse -89 -99 10.501 0.066
NP_441916.1_7 Reverse -91 -101 18.9579 0.00144
NP_441916.1_7 Forward -100 -90 18.4663 0.00144
NP_440206.1_4 Forward -110 -91 -1.37794 0.29
NP_440465.1_10 Forward -103 -84 8.75091 0.173
NP_440465.1_10 Forward -322 -303 5.40766 0.212
NP_441041.1_4 Reverse -91 -110 -8.94866 0.209
NP_441041.1_7 Reverse -88 -100 19.5648 0.00277
NP_441041.1_7 Forward -103 -91 8.87526 0.128
NP_442642.1_9 Forward -107 -90 5.05372 0.192
NP_442396.1_5 Reverse -155 -168 11.229 0.105
NP_442004.1_6 Reverse -91 -105 7.27608 0.161
NP_441725.1_4 Forward -105 -91 11.012 0.0977
NP_441725.1_5 Forward -99 -89 9.02648 0.0553
NP_441725.1_5 Reverse -92 -102 8.92815 0.0553
NP_439966.1_7 Reverse -89 -99 17.4824 0.00636
NP_439966.1_7 Forward -102 -92 13.8442 0.0234
NP_439966.1_9 Reverse -89 -98 10.7178 0.0863
NP_439966.1_9 Forward -102 -93 0.983037 0.253
NP_442941.1_3 Reverse -92 -102 10.9931 0.0116
NP_442941.1_3 Forward -99 -89 2.53664 0.14
NP_442941.1_3 Forward -314 -304 -1.00328 0.282
NP_440289.1_2 Reverse -88 -101 12.9006 0.0132
NP_440289.1_2 Forward -103 -90 -4.50394 0.288
NP_440983.1_5 Reverse -91 -110 0.982764 0.214
NP_440983.1_9 Forward -109 -90 2.16274 0.292
NP_442281.1_1 Reverse -86 -100 15.8302 0.0104
NP_442281.1_1 Forward -105 -91 4.91554 0.176
NP_441334.1_7 Reverse -89 -108 -9.24366 0.12
NP_441334.1_7 Forward -102 -83 -19.3717 0.275
NP_441457.1_7 Forward -102 -83 13.0775 0.0792
NP_441556.1_6 Reverse -121 -139 16.9778 0.215
NP_441644.1_6 Reverse -91 -101 19.0557 0.000803
NP_441644.1_6 Forward -315 -305 10.9926 0.058
NP_441644.1_6 Forward -100 -90 10.1076 0.0628
NP_442215.1_2 Forward -25 -9 -7.51295 0.297
NP_441810.1_9 Forward -107 -88 0.0977854 0.292
NP_440253.1_2 Forward -100 -82 0.805796 0.176
NP_440929.1_8 Forward -100 -91 19.2726 0.000701
NP_440929.1_8 Reverse -91 -100 19.2726 0.000701
NP_440780.1_1 Forward -390 -371 11.4109 0.243
NP_442933.1_2 Reverse -241 -259 5.63601 0.291
NP_442933.1_10 Forward -100 -91 17.601 0.00325
NP_442933.1_10 Reverse -91 -100 17.601 0.00325
NP_442933.1_10 Reverse -306 -315 5.3096 0.203
NP_441751.2_8 Forward -99 -85 11.701 0.0222
NP_441751.2_8 Reverse -92 -106 5.50613 0.0423
NP_442554.1_8 Reverse -92 -102 19.1546 0.00369
NP_442554.1_8 Forward -99 -89 16.008 0.0065
NP_442554.1_8 Forward -314 -304 6.07655 0.126
NP_441762.1_7 Forward -101 -89 12.527 0.0142
NP_441762.1_7 Reverse -90 -102 11.7404 0.0142
NP_441762.1_7 Forward -316 -304 -3.59927 0.118
NP_441762.1_7 Reverse -81 -93 -3.59927 0.118
NP_442142.1_4 Reverse -88 -101 14.4733 0.0311
NP_442142.1_4 Reverse -33 -46 9.85179 0.0854
NP_442142.1_4 Forward -103 -90 6.21356 0.17
NP_442292.1_1 Reverse -92 -101 17.5026 0.00435
NP_442292.1_1 Forward -99 -90 9.63616 0.0183
NP_442292.1_1 Forward -314 -305 7.17789 0.0777
NP_442476.1_6 Forward -99 -85 6.19444 0.13
NP_442381.1_8 Reverse -88 -107 -13.7669 0.279
NP_443009.1_5 Forward -101 -90 19.626 0.00102
NP_443009.1_5 Reverse -90 -101 7.82632 0.118
NP_443009.1_5 Reverse -305 -316 5.17139 0.214
NP_441741.1_1 Forward -159 -140 31.4654 0.000123
NP_441741.1_2 Forward -261 -242 31.7604 0.0000572
NP_441741.1_3 Forward -354 -335 29.5971 0.000456
NP_441741.1_5 Forward -183 -164 26.9421 0.00221
NP_441741.1_6 Forward -138 -119 22.8122 0.0421
NP_441741.1_7 Forward -378 -359 26.8438 0.0039
NP_441741.1_9 Forward -333 -314 26.9421 0.00244
NP_441715.1_4 Forward -99 -89 9.32148 0.097
NP_441715.1_4 Reverse -92 -102 7.25653 0.108
NP_440357.1_3 Forward -102 -83 -0.885524 0.296
NP_440015.1_9 Reverse -91 -109 -1.65248 0.291
NP_440183.1_1 Reverse -190 -209 6.09597 0.278
NP_441198.1_8 Forward -102 -92 15.4199 0.0427
NP_440379.1_5 Forward -109 -90 -11.4069 0.296
NP_440379.1_6 Forward -50 -31 7.47261 0.241
NP_441468.1_1 Forward -99 -92 15.8704 0.0124
NP_441468.1_1 Reverse -92 -99 15.8704 0.0124
NP_441468.1_1 Reverse -307 -314 6.3323 0.202
NP_441468.1_1 Forward -314 -307 6.13563 0.209
NP_441020.2_6 Forward -102 -85 12.0352 0.105
NP_441020.2_6 Reverse -89 -106 10.9536 0.131
NP_441673.1_1 Forward -100 -91 20.8459 0.000698
NP_441673.1_1 Reverse -91 -100 20.8459 0.000698
NP_440286.1_2 Reverse -142 -155 18.8988 0.211
NP_441826.1_2 Reverse -85 -99 4.42448 0.103
NP_441826.1_2 Forward -106 -92 -1.47537 0.248
NP_441826.1_2 Reverse -62 -76 -4.7203 0.299
NP_441330.1_1 Forward -117 -98 -13.6686 0.198
NP_441764.1_8 Forward -390 -380 13.6076 0.284
NP_442868.1_6 Forward -102 -92 8.63316 0.0555
NP_442868.1_6 Reverse -89 -99 8.53483 0.0555
NP_442719.1_2 Forward -142 -124 -5.09477 0.218
NP_441056.1_1 Forward -100 -81 -8.26035 0.282
NP_442808.1_1 Reverse -90 -100 18.4657 0.00201
NP_442808.1_1 Forward -101 -91 8.73102 0.0481
NP_442808.1_1 Forward -127 -117 5.38779 0.155
NP_442113.1_10 Reverse -23 -42 -3.44213 0.214
NP_442050.1_5 Forward -102 -92 17.1874 0.00812
NP_442050.1_5 Reverse -89 -99 8.23937 0.234
NP_442050.1_5 Reverse -304 -314 7.0594 0.27
NP_440038.1_4 Reverse -131 -150 -0.197208 0.279
NP_442342.1_9 Reverse -89 -105 17.3648 0.0732
NP_440558.1_2 Reverse -265 -284 -4.22878 0.243
NP_442789.1_4 Reverse -89 -108 -1.86883 0.229
NP_441878.1_6 Forward -101 -91 10.5014 0.0176
NP_441878.1_6 Reverse -90 -100 10.4031 0.0176
NP_441036.1_8 Reverse -90 -100 17.7779 0.000554
NP_441036.1_8 Forward -101 -91 15.713 0.00724
NP_441557.1_5 Forward -100 -91 19.9609 0.000699
NP_441557.1_5 Reverse -91 -100 19.9609 0.000699
NP_441557.1_5 Reverse -306 -315 6.29291 0.0666
NP_441445.1_1 Reverse -82 -101 1.17943 0.259
NP_441590.1_4 Reverse -32 -51 1.76863 0.299
NP_442066.2_4 Reverse -91 -110 -0.197208 0.173
NP_442066.2_9 Reverse -87 -100 17.9155 0.0209
NP_442066.2_9 Forward -104 -91 12.0157 0.154
NP_442419.1_2 Forward -105 -86 0.786102 0.238
NP_441308.1_7 Forward -323 -304 13.6666 0.147
NP_441308.1_8 Reverse -304 -314 12.9597 0.218
NP_441308.1_8 Forward -102 -92 12.4681 0.218
NP_441308.1_8 Reverse -89 -99 9.22315 0.226
NP_440101.1_3 Reverse -86 -105 0.491109 0.298
NP_440101.1_3 Forward -68 -49 0.392778 0.299
NP_442183.1_1 Forward -100 -86 19.8624 0.0054
NP_442183.1_1 Reverse -91 -105 17.9942 0.00913
NP_441574.1_1 Reverse -91 -110 7.17762 0.11
NP_441574.1_1 Forward -100 -81 -6.29373 0.276
NP_441549.1_9 Reverse -87 -105 -7.35568 0.207
NP_440861.1_3 Forward -50 -32 17.0304 0.174
NP_442347.1_2 Forward -99 -90 11.1111 0.056
NP_442347.1_2 Reverse -307 -316 3.83464 0.284
NP_442347.1_2 Reverse -92 -101 3.34298 0.284
NP_441037.1_4 Forward -102 -92 16.5761 0.0168
NP_441037.1_4 Reverse -89 -99 16.2838 0.0168
NP_442508.1_8 Reverse -193 -210 14.5918 0.256
NP_441633.1_3 Reverse -89 -102 5.91914 0.0481
NP_441633.1_3 Forward -102 -89 3.95252 0.0699
NP_441633.1_3 Forward -317 -304 -6.2739 0.242
NP_440136.1_2 Forward -99 -92 15.9687 0.0123
NP_440136.1_2 Reverse -92 -99 15.9687 0.0123
NP_440136.1_2 Reverse -307 -314 6.43063 0.154
NP_440136.1_2 Forward -314 -307 6.23397 0.171
NP_442590.1_10 Forward -255 -236 6.39097 0.245
NP_442998.1_5 Forward -137 -127 12.0747 0.176
NP_442998.1_5 Forward -190 -180 8.73149 0.261
NP_442998.1_10 Forward -98 -91 15.5754 0.0102
NP_442998.1_10 Reverse -93 -100 15.5754 0.0102
NP_440299.1_1 Forward -104 -91 13.0967 0.0319
NP_441799.1_1 Reverse -87 -101 12.2903 0.0441
NP_441799.1_1 Forward -319 -305 9.93039 0.082
NP_441799.1_1 Forward -104 -90 7.47213 0.141
NP_441799.1_4 Forward -99 -80 -3.73712 0.203
NP_441007.1_10 Reverse -86 -99 14.9656 0.0499
NP_441007.1_10 Forward -105 -92 12.8023 0.0499
NP_441007.1_10 Reverse -301 -314 2.67422 0.183
NP_440087.1_1 Reverse -288 -307 -3.83545 0.239
NP_442007.1_8 Forward -101 -83 10.0481 0.258
NP_441559.1_8 Forward -105 -91 -7.57189 0.295
NP_440915.1_6 Reverse -87 -101 15.3392 0.0183
NP_440915.1_6 Forward -104 -90 13.0776 0.0198
NP_442855.1_3 Forward -109 -90 14.2574 0.21
NP_441179.1_9 Reverse -34 -44 8.92768 0.284
NP_441866.1_6 Forward -270 -251 8.75009 0.253
NP_442069.1_10 Reverse -92 -110 17.0304 0.0593
NP_441464.1_8 Forward -100 -86 9.2427 0.192
NP_441199.1_6 Reverse -87 -106 9.83255 0.0819
NP_441199.1_6 Forward -104 -85 6.78429 0.129
NP_441199.1_6 Forward -319 -300 -0.0988766 0.259
NP_441494.1_6 Forward -105 -92 9.75405 0.227
NP_442993.1_1 Forward -100 -84 8.22001 0.0263
NP_442993.1_1 Reverse -306 -322 -7.0213 0.146
NP_442993.1_1 Reverse -91 -107 -10.5612 0.222
NP_442386.1_9 Reverse -90 -99 15.7322 0.0144
NP_442386.1_9 Forward -316 -307 7.17747 0.219
NP_442386.1_9 Forward -101 -92 6.39082 0.219
NP_441340.1_5 Forward -99 -92 15.6737 0.0124
NP_441340.1_5 Reverse -92 -99 15.6737 0.0124
NP_441340.1_5 Forward -314 -307 5.93897 0.198
NP_441340.1_5 Reverse -307 -314 5.84064 0.208
NP_441340.1_9 Forward -390 -380 16.4498 0.194
NP_441340.1_9 Forward -138 -128 8.15881 0.256
NP_441271.1_8 Forward -110 -100 20.1379 0.12
NP_440146.1_2 Forward -106 -92 16.6175 0.23
NP_440586.1_1 Forward -107 -88 -4.72043 0.278
NP_440586.1_8 Forward -99 -92 13.2151 0.026
NP_440586.1_8 Reverse -92 -99 13.2151 0.026
NP_440586.1_8 Forward -314 -307 11.1501 0.0845
NP_442251.1_6 Forward -99 -92 15.2804 0.0124
NP_442251.1_6 Reverse -92 -99 15.2804 0.0124
NP_442251.1_6 Forward -314 -307 13.7071 0.0268
NP_440684.1_9 Reverse -85 -99 10.4227 0.198
NP_441262.1_3 Reverse -91 -98 14.7888 0.0223
NP_441262.1_3 Forward -100 -93 14.7888 0.0223
NP_443051.1_1 Forward -101 -92 19.5676 0.00335
NP_443051.1_1 Reverse -90 -99 10.4228 0.00754
NP_443051.1_1 Reverse -305 -314 7.66954 0.0571
NP_441232.1_10 Forward -111 -92 9.63589 0.133
NP_439937.1_8 Reverse -89 -108 3.14605 0.207
NP_439937.1_9 Reverse -90 -107 -8.41828 0.176
NP_439937.1_9 Reverse -7 -24 -12.9415 0.278
NP_439937.1_9 Forward -101 -84 -16.1864 0.287
NP_441595.1_5 Forward -107 -89 9.36059 0.217
NP_440398.1_2 Reverse -79 -98 1.76941 0.253
NP_440408.1_10 Forward -106 -87 8.55425 0.176
NP_440408.1_10 Reverse -85 -104 5.89931 0.242
NP_440439.1_1 Forward -103 -90 10.2457 0.0372
NP_440439.1_1 Reverse -88 -101 9.36073 0.0465
NP_440439.1_1 Reverse -303 -316 0.117615 0.202
NP_442239.1_8 Forward -290 -271 13.1758 0.237
NP_440372.1_2 Forward -99 -92 16.3621 0.0124
NP_440372.1_2 Reverse -92 -99 16.3621 0.0124
NP_440372.1_2 Forward -314 -307 6.62729 0.151
NP_440372.1_2 Reverse -307 -314 6.52896 0.188
NP_441789.1_7 Reverse -60 -79 -2.75457 0.262
NP_441803.1_2 Forward -105 -86 6.09597 0.159
NP_441803.1_2 Forward -96 -77 1.17943 0.238
NP_441803.1_2 Reverse -86 -105 -0.983855 0.293
NP_441803.1_2 Forward -99 -80 -1.08219 0.294
NP_439977.1_5 Reverse -85 -104 17.2074 0.0384
NP_439977.1_5 Forward -106 -87 -2.95047 0.293
NP_440139.1_1 Forward -51 -32 0.981987 0.275
NP_442384.1_10 Reverse -91 -104 9.65572 0.0508
NP_442384.1_10 Forward -100 -87 0.412608 0.291
NP_442114.1_4 Forward -100 -89 12.1534 0.107
NP_441604.1_9 Forward -260 -241 16.2241 0.167
NP_441877.1_7 Reverse -74 -93 2.35861 0.23
NP_441018.1_3 Reverse -190 -209 10.1267 0.286
NP_442790.1_4 Reverse -82 -101 0.196116 0.0924
NP_442790.1_4 Forward -109 -90 -8.65367 0.173
NP_442262.1_10 Forward -99 -92 14.1988 0.0123
NP_442262.1_10 Reverse -92 -99 14.1988 0.0123
NP_442262.1_10 Reverse -9 -16 8.8889 0.219
NP_442262.1_10 Reverse -118 -125 8.20058 0.25
NP_441689.1_5 Forward -102 -92 8.43603 0.132
NP_440344.1_10 Reverse -84 -101 1.90713 0.0294
NP_440344.1_10 Forward -107 -90 0.235503 0.0365
NP_440531.1_8 Forward -68 -49 2.94938 0.279
NP_442123.1_3 Forward -100 -81 13.4708 0.166
NP_442123.1_3 Reverse -91 -110 12.6841 0.196
NP_441060.1_1 Forward -80 -61 11.8889 0.294
NP_442832.1_5 Reverse -263 -282 13.1758 0.298
NP_441965.1_10 Forward -103 -87 4.77842 0.231
NP_441965.1_10 Forward -300 -284 2.02515 0.292
NP_441640.1_8 Reverse -9 -28 -4.22878 0.26
NP_440297.1_9 Forward -99 -89 -0.216628 0.282
NP_440297.1_9 Reverse -92 -102 -0.314959 0.282
NP_441896.1_3 Reverse -82 -101 8.84924 0.0879
NP_440894.1_10 Reverse -86 -105 5.99764 0.227
NP_440999.1_9 Reverse -87 -101 18.0925 0.0163
NP_440888.1_2 Reverse -91 -105 18.5835 0.00223
NP_440888.1_2 Forward -100 -86 15.5352 0.0102
NP_440600.1_4 Forward -108 -90 -5.97904 0.284
NP_440491.1_1 Reverse -88 -107 13.9339 0.114
NP_440491.1_1 Forward -26 -7 6.91701 0.284
NP_441787.1_7 Forward -311 -292 8.55425 0.279
NP_442277.1_4 Reverse -82 -101 5.01354 0.181
NP_442033.1_10 Reverse -89 -108 -4.91709 0.179
NP_441949.1_6 Reverse -48 -67 7.57013 0.289
NP_442818.1_3 Reverse -203 -220 2.89044 0.234
NP_441543.1_2 Forward -99 -90 18.486 0.00236
NP_441543.1_2 Reverse -92 -101 15.9293 0.00518
NP_441543.1_2 Reverse -247 -256 7.37455 0.127
NP_441543.1_2 Reverse -307 -316 5.60459 0.189
NP_442845.1_2 Forward -106 -92 16.2242 0.0636
NP_442845.1_2 Reverse -85 -99 8.65272 0.19
NP_441918.1_7 Reverse -116 -135 5.11266 0.262
NP_441469.1_8 Reverse -90 -99 16.126 0.00797
NP_441469.1_8 Forward -10 -1 8.35786 0.227
NP_441469.1_8 Forward -101 -92 6.5879 0.227
NP_443064.1_6 Reverse -91 -101 10.8217 0.13
NP_442337.1_8 Forward -113 -94 1.17943 0.241
NP_442578.1_7 Forward -99 -92 14.5921 0.026
NP_442578.1_7 Reverse -92 -99 14.5921 0.026
NP_442578.1_7 Forward -314 -307 12.5271 0.0544
NP_440148.1_8 Forward -78 -68 18.6629 0.28
NP_441462.1_2 Reverse -91 -101 20.2362 0.000805
NP_441462.1_2 Forward -100 -90 11.5831 0.00406
NP_441621.1_7 Reverse -89 -103 14.0609 0.0266
NP_441621.1_7 Forward -102 -88 6.48943 0.068
NP_442736.1_5 Reverse -98 -117 14.2574 0.201
NP_443062.1_1 Reverse -91 -109 13.8113 0.0569
NP_443062.1_1 Forward -100 -82 6.69328 0.194
NP_442204.1_1 Forward -104 -93 2.51695 0.266
NP_442204.1_2 Forward -377 -358 7.17762 0.287
NP_442204.1_5 Reverse -81 -100 5.60432 0.155
NP_440516.1_8 Forward -100 -91 16.9127 0.00442
NP_440516.1_8 Reverse -91 -100 16.9127 0.00442
NP_442428.1_5 Forward -99 -92 15.8704 0.0124
NP_442428.1_5 Reverse -92 -99 15.8704 0.0124
NP_442428.1_5 Reverse -307 -314 13.1171 0.038
NP_442428.1_5 Forward -314 -307 6.23397 0.201
NP_442120.1_10 Reverse -85 -104 -4.72043 0.199
NP_442120.1_10 Reverse -91 -110 -10.3253 0.257
NP_440673.1_3 Forward -98 -91 12.4288 0.0426
NP_440673.1_3 Reverse -93 -100 12.4288 0.0426
NP_440673.1_3 Reverse -308 -315 11.7405 0.0653
NP_440673.1_7 Forward -111 -92 14.4541 0.0925
NP_440673.1_7 Reverse -80 -99 7.66927 0.139
NP_440865.1_9 Reverse -85 -104 -5.31042 0.213
NP_440865.1_9 Forward -106 -87 -8.26035 0.263
NP_441052.1_2 Forward -100 -90 10.5014 0.0285
NP_441052.1_2 Reverse -91 -101 10.4031 0.0285
NP_442219.1_8 Reverse -87 -106 6.91087 0.282
NP_442219.1_9 Forward -99 -90 8.35786 0.0681
NP_442219.1_9 Reverse -92 -101 8.25953 0.0681
NP_442219.1_9 Reverse -307 -316 5.80125 0.113
NP_440436.1_4 Forward -99 -90 18.1905 0.00233
NP_440436.1_4 Reverse -92 -101 9.24241 0.0871
NP_440436.1_4 Reverse -307 -316 7.07914 0.142
NP_441884.1_8 Reverse -90 -109 -0.4922 0.138
NP_441884.1_9 Reverse -88 -107 -12.8819 0.138
NP_441884.1_9 Reverse -24 -43 -15.3402 0.138
NP_441719.1_4 Forward -99 -92 16.3621 0.0124
NP_441719.1_4 Reverse -92 -99 16.3621 0.0124
NP_441719.1_4 Forward -314 -307 6.62729 0.151
NP_441719.1_4 Reverse -307 -314 6.52896 0.188
NP_441733.1_10 Forward -103 -90 15.3589 0.06
NP_441733.1_10 Reverse -88 -101 10.5407 0.106
NP_441733.1_10 Reverse -303 -316 7.78743 0.15
NP_441004.1_1 Forward -106 -87 -8.45701 0.2
NP_441004.1_1 Forward -54 -35 -15.4385 0.275
NP_442813.1_4 Reverse -192 -211 -2.16383 0.262
NP_442366.1_3 Reverse -90 -108 -1.75081 0.217
NP_442366.1_5 Forward -318 -308 10.3043 0.276
NP_442139.1_7 Forward -260 -241 10.9142 0.198
NP_442873.1_9 Reverse -81 -100 8.35677 0.236
NP_441115.1_4 Reverse -90 -108 13.3914 0.0802
NP_441115.1_4 Forward -316 -298 9.75313 0.202
NP_442854.1_6 Reverse -91 -110 0.982764 0.287
NP_440328.1_4 Forward -321 -302 3.34271 0.181
NP_443054.1_2 Forward -102 -88 12.586 0.0722
NP_442430.1_4 Reverse -89 -108 11.7008 0.296
NP_441966.1_7 Reverse -99 -118 -0.0996487 0.253
NP_442308.1_3 Forward -109 -90 16.9124 0.251
NP_440864.1_9 Forward -27 -8 -5.80207 0.239
NP_441851.1_10 Reverse -90 -100 16.008 0.00552
NP_441851.1_10 Forward -101 -91 8.53483 0.114
NP_441555.1_3 Forward -394 -375 18.1493 0.199
NP_441157.1_1 Forward -164 -150 5.21053 0.249
NP_442011.1_1 Reverse -90 -109 -2.16383 0.272
NP_441668.1_4 Reverse -107 -126 -2.16383 0.288
NP_442515.1_1 Reverse -90 -104 -1.8687 0.266
NP_442515.1_1 Forward -101 -87 -2.06536 0.268
NP_440593.1_3 Reverse -86 -105 -3.93378 0.242
NP_440593.1_3 Forward -105 -86 -5.80207 0.266
NP_441349.1_10 Forward -110 -91 -8.35868 0.274
NP_440155.1_3 Forward -305 -286 11.0125 0.225
NP_441394.1_1 Reverse -193 -207 16.8142 0.271
NP_441394.1_10 Reverse -351 -369 9.06482 0.263
NP_442843.1_1 Forward -142 -123 -10.817 0.281
NP_442843.1_1 Forward -160 -141 -12.0953 0.298
NP_440474.1_8 Forward -99 -85 20.9434 0.0423
NP_440474.1_8 Reverse -92 -106 10.8154 0.126
NP_440474.1_8 Forward -314 -300 6.98048 0.213
NP_441124.1_5 Forward -138 -128 11.7668 0.245
NP_441124.1_5 Reverse -375 -385 11.0983 0.267
NP_440588.1_2 Forward -109 -90 -1.08219 0.155
NP_440195.1_4 Reverse -105 -124 11.2092 0.148
NP_442006.1_2 Forward -18 -1 -19.1357 0.299
NP_443047.1_6 Forward -47 -28 19.469 0.0993
NP_440483.1_1 Reverse -164 -183 -7.76869 0.267
NP_441570.1_1 Reverse -91 -109 -6.96235 0.0829
NP_441078.1_4 Forward -100 -91 19.6659 0.0007
NP_441078.1_4 Reverse -91 -100 19.6659 0.0007
NP_442729.1_8 Forward -104 -91 10.1474 0.125
NP_442729.1_8 Reverse -87 -100 9.75405 0.125
NP_441539.1_10 Forward -26 -7 -1.18052 0.171
NP_442443.1_1 Forward -108 -89 -6.88371 0.299
NP_440526.1_3 Forward -99 -88 11.7595 0.0646
NP_440526.1_3 Reverse -92 -103 2.41814 0.267
NP_441432.1_8 Forward -101 -92 16.8143 0.00595
NP_441432.1_8 Reverse -90 -99 8.25953 0.0755
NP_442320.1_8 Reverse -85 -99 7.9644 0.0185
NP_442320.1_8 Forward -106 -92 7.66941 0.0189
NP_442344.1_7 Forward -99 -80 0.786102 0.0908
NP_441732.1_2 Forward -104 -88 -5.54633 0.0476
NP_441732.1_2 Reverse -236 -252 -8.20127 0.124
NP_440760.1_1 Reverse -91 -110 -2.26216 0.0332
NP_440760.1_1 Forward -100 -81 -11.8003 0.0882
NP_440760.1_7 Reverse -370 -389 6.39016 0.192
NP_443011.1_4 Forward -46 -27 8.06259 0.251
NP_442400.1_10 Forward -216 -203 7.31916 0.29
NP_440713.1_4 Forward -110 -91 12.7825 0.103
NP_442489.1_7 Forward -100 -91 20.1576 0.000695
NP_442489.1_7 Reverse -91 -100 20.1576 0.000695
NP_440757.1_6 Reverse -87 -106 8.84924 0.28
NP_440559.1_1 Forward -99 -90 8.75118 0.0586
NP_440559.1_1 Reverse -92 -101 8.65285 0.0586
NP_441659.2_8 Reverse -91 -101 20.9245 0.000805
NP_441659.2_8 Forward -100 -90 11.9764 0.0147
NP_441659.2_8 Forward -315 -305 5.5849 0.104
NP_442346.1_5 Forward -101 -91 16.303 0.00248
NP_442346.1_5 Reverse -90 -100 9.02648 0.118
NP_440545.1_3 Forward -104 -87 7.70866 0.0488
NP_440545.1_3 Forward -319 -302 -5.76269 0.259
NP_440545.1_3 Reverse -87 -104 -5.95935 0.265
NP_440025.1_3 Forward -138 -124 10.0299 0.29
NP_440831.1_3 Forward -109 -90 9.29946 0.202
NP_441923.1_6 Forward -44 -30 15.2409 0.175
NP_440010.1_4 Forward -110 -91 -3.24622 0.294
NP_440010.1_4 Reverse -75 -94 -3.54122 0.299
NP_440010.1_10 Forward -295 -276 9.93088 0.209
NP_442875.1_8 Forward -396 -377 10.5209 0.269
NP_442603.1_7 Forward -126 -112 5.60385 0.284
NP_440449.1_6 Forward -108 -90 14.1889 0.0983
NP_440449.1_6 Reverse -83 -101 11.5628 0.129
NP_441833.1_4 Forward -99 -92 15.9687 0.0124
NP_441833.1_4 Reverse -92 -99 15.9687 0.0124
NP_441833.1_4 Reverse -307 -314 6.3323 0.134
NP_441833.1_4 Forward -314 -307 6.23397 0.163
NP_442162.1_9 Forward -99 -92 16.2637 0.0124
NP_442162.1_9 Reverse -92 -99 16.2637 0.0124
NP_442162.1_9 Forward -314 -307 6.52896 0.178
NP_442162.1_9 Reverse -307 -314 6.43063 0.208
NP_442199.1_5 Forward -108 -89 -0.885524 0.177
NP_442199.1_5 Reverse -83 -102 -4.72043 0.229
NP_442140.1_3 Forward -99 -89 17.4829 0.0159
NP_442140.1_3 Reverse -92 -102 7.94484 0.124
NP_442140.1_3 Reverse -307 -317 6.07655 0.184
NP_442021.1_3 Reverse -85 -104 -6.39206 0.257
NP_440875.1_9 Forward -98 -88 17.619 0.0104
NP_440875.1_9 Reverse -93 -103 8.66404 0.233
NP_441813.1_5 Reverse -89 -99 10.0098 0.0208
NP_441813.1_5 Forward -102 -92 8.73149 0.0367
NP_441813.1_5 Forward -317 -307 -0.609952 0.261
NP_440594.1_6 Forward -132 -113 4.71854 0.292
NP_440590.1_4 Forward -99 -86 12.0157 0.0166
NP_440590.1_4 Reverse -92 -105 11.1307 0.0221
NP_440567.1_1 Forward -99 -85 17.2075 0.0153
NP_440567.1_1 Reverse -92 -106 15.1426 0.0179
NP_442497.1_10 Reverse -92 -101 17.601 0.00813
NP_442497.1_10 Forward -99 -90 10.4228 0.0087
NP_442497.1_10 Forward -314 -305 5.99792 0.095
NP_440821.1_4 Reverse -89 -99 18.7612 0.00422
NP_440821.1_4 Forward -102 -92 10.7964 0.0146
NP_440821.1_4 Reverse -304 -314 0.57002 0.169
NP_441239.1_9 Forward -102 -90 17.4436 0.0146
NP_441239.1_9 Reverse -89 -101 16.0669 0.0175
NP_441239.1_9 Reverse -304 -316 3.67722 0.279
NP_441727.1_3 Reverse -84 -103 5.99764 0.248
NP_440400.1_1 Reverse -49 -68 -3.14789 0.291
NP_441892.1_1 Forward -109 -92 12.1336 0.0501
NP_441892.1_1 Reverse -82 -99 -3.10775 0.233
NP_440604.1_6 Reverse -91 -110 -5.99873 0.289
NP_442044.1_1 Forward -105 -86 -10.817 0.271
NP_440833.1_6 Forward -219 -205 8.84875 0.272
NP_440876.1_5 Reverse -93 -112 10.4225 0.248
NP_440354.1_7 Forward -106 -88 8.18062 0.25
NP_441782.1_10 Forward -108 -94 14.3948 0.296
NP_440546.1_4 Reverse -91 -101 13.5365 0.0459
NP_440546.1_4 Forward -100 -90 11.8882 0.0679
NP_440546.1_4 Forward -249 -239 6.45857 0.296
NP_441230.1_5 Forward -105 -86 4.32602 0.188
NP_440675.1_3 Forward -370 -351 4.52268 0.3
NP_440462.1_6 Forward -102 -92 19.4496 0.00371
NP_440462.1_6 Reverse -89 -99 17.9746 0.00578
NP_440462.1_6 Reverse -304 -314 1.35667 0.294
NP_440868.1_4 Reverse -87 -99 12.0354 0.0254
NP_440868.1_4 Forward -319 -307 0.333971 0.217
NP_440868.1_4 Forward -104 -92 0.333971 0.217
NP_442499.1_3 Reverse -90 -108 3.85406 0.289
NP_440036.1_1 Forward -198 -179 9.14423 0.277
NP_441084.1_6 Forward -102 -88 11.2833 0.208
NP_441084.1_6 Reverse -244 -258 9.44108 0.282
NP_440653.1_10 Forward -111 -92 5.211 0.234
NP_442039.1_4 Forward -99 -92 15.1821 0.0124
NP_442039.1_4 Reverse -92 -99 15.1821 0.0124
NP_441811.1_4 Reverse -89 -108 -0.0988766 0.295
NP_441811.1_8 Forward -106 -92 9.04604 0.227
NP_441811.1_8 Forward -80 -66 5.70279 0.293
NP_440825.1_7 Reverse -307 -317 14.7639 0.152
NP_442837.1_3 Forward -99 -92 15.7721 0.0124
NP_442837.1_3 Reverse -92 -99 15.7721 0.0124
NP_442837.1_3 Reverse -307 -314 13.5105 0.0268
NP_442837.1_3 Forward -314 -307 6.13563 0.25
NP_442053.1_1 Forward -100 -91 18.3876 0.0007
NP_442053.1_1 Reverse -91 -100 18.3876 0.0007
NP_440505.1_3 Forward -102 -92 15.418 0.0114
NP_440505.1_3 Reverse -89 -99 14.1397 0.0235
NP_441102.1_2 Reverse -117 -136 11.3075 0.224
NP_442532.1_3 Forward -269 -250 16.0501 0.284
NP_442532.1_7 Reverse -91 -105 15.6342 0.0587
NP_442532.1_7 Forward -100 -86 7.17775 0.171
NP_440914.1_1 Reverse -91 -101 16.3248 0.00196
NP_440914.1_1 Forward -315 -305 10.9573 0.116
NP_440914.1_1 Forward -100 -90 8.6151 0.186
NP_440914.1_1 Reverse -353 -363 6.56569 0.273
NP_441011.1_8 Forward -99 -90 16.9127 0.00602
NP_441011.1_8 Reverse -92 -101 16.6177 0.00602
NP_441011.1_8 Reverse -307 -316 15.4377 0.0109
NP_442101.1_6 Forward -240 -221 12.1925 0.257
NP_442533.1_6 Forward -100 -91 17.2076 0.00137
NP_442533.1_6 Reverse -91 -100 17.2076 0.00137
NP_442533.1_6 Reverse -240 -249 3.63797 0.206
NP_442533.1_6 Reverse -288 -297 3.14632 0.224
NP_442533.1_6 Reverse -274 -283 2.65466 0.246
NP_442533.1_6 Reverse -27 -36 2.55633 0.25
NP_442541.1_3 Reverse -281 -300 7.37428 0.222
NP_442541.1_10 Reverse -268 -282 2.75226 0.254
NP_442232.1_3 Forward -108 -89 3.73603 0.0917
NP_442232.1_3 Reverse -83 -102 -14.6519 0.288
NP_442229.1_1 Forward -102 -88 8.94708 0.184
NP_441482.1_7 Forward -106 -92 6.78443 0.026
NP_439944.1_9 Reverse -92 -102 17.7779 0.00341
NP_439944.1_9 Forward -99 -89 10.4031 0.0887
NP_439944.1_9 Forward -314 -304 5.87989 0.214
NP_441028.1_6 Forward -273 -263 7.74772 0.218
NP_440116.1_4 Forward -285 -266 11.7992 0.251
NP_440115.1_6 Forward -103 -93 7.74818 0.146
NP_440007.1_9 Forward -109 -95 0.687908 0.292
NP_441059.1_2 Forward -49 -30 -6.98204 0.278
NP_441961.1_2 Reverse -377 -396 5.89931 0.272
NP_441602.1_3 Reverse -86 -105 17.6007 0.0354
NP_441602.1_3 Forward -105 -86 7.66927 0.12
NP_441972.1_5 Reverse -92 -111 -2.16383 0.178
NP_441106.1_1 Forward -101 -92 18.486 0.0028
NP_441106.1_1 Reverse -90 -99 18.191 0.0028
NP_441106.1_1 Forward -316 -307 7.57121 0.0815
NP_440429.1_2 Forward -111 -92 8.55425 0.272
NP_440429.1_2 Forward -99 -80 7.66927 0.28
NP_439903.1_6 Reverse -88 -107 6.39016 0.167
NP_439903.1_6 Forward -103 -84 3.34192 0.21
NP_442306.1_10 Forward -105 -86 -19.0768 0.197
NP_442306.1_10 Reverse -86 -105 -19.2734 0.197
NP_441286.1_1 Forward -101 -89 5.34885 0.0259
NP_441286.1_1 Reverse -90 -102 5.15219 0.0259
NP_440670.1_8 Forward -100 -91 18.3876 0.000699
NP_440670.1_8 Reverse -91 -100 18.3876 0.000699
NP_441705.1_3 Reverse -103 -122 -6.1954 0.291
NP_440886.1_7 Reverse -90 -100 17.7774 0.0011
NP_440886.1_7 Forward -101 -91 8.04271 0.0805
NP_440886.1_7 Forward -127 -117 6.27276 0.134
NP_440886.1_7 Forward -92 -82 6.27276 0.134
NP_442072.1_9 Forward -101 -83 -12.3706 0.0852
NP_442072.1_9 Reverse -90 -108 -12.9605 0.095
NP_440028.1_6 Forward -28 -10 11.4255 0.261
NP_440907.2_8 Reverse -92 -102 19.1541 0.00362
NP_440907.2_8 Forward -99 -89 17.4824 0.00685
NP_440907.2_8 Forward -314 -304 8.14104 0.117
NP_442264.1_2 Reverse -107 -124 4.56207 0.298
NP_441021.1_1 Reverse -92 -111 -6.68705 0.18
NP_441021.1_1 Forward -99 -80 -12.1936 0.281
NP_441463.1_3 Forward -110 -91 5.50599 0.074
NP_441463.1_3 Reverse -81 -100 -9.73531 0.284
NP_441626.1_2 Forward -99 -92 15.7721 0.0124
NP_441626.1_2 Reverse -92 -99 15.7721 0.0124
NP_441626.1_2 Forward -314 -307 6.0373 0.212
NP_441626.1_2 Reverse -307 -314 5.93897 0.231
NP_440107.1_5 Forward -107 -88 -6.98204 0.272
NP_442615.1_1 Reverse -82 -100 4.9357 0.0418
NP_442615.1_1 Forward -109 -91 0.0191479 0.109
NP_441962.1_4 Forward -105 -86 11.6025 0.0495
NP_441962.1_4 Reverse -86 -105 -7.96535 0.195
NP_440387.1_1 Reverse -91 -107 17.8564 0.0044
NP_440387.1_1 Forward -100 -84 6.54838 0.0282
NP_440855.1_5 Reverse -89 -108 2.55527 0.288
NP_441431.1_2 Reverse -88 -102 15.0436 0.0537
NP_441488.1_7 Forward -106 -87 15.5357 0.0543
NP_441836.1_1 Forward -111 -92 13.2525 0.229
NP_441836.1_2 Reverse -85 -104 4.42435 0.141
NP_441836.1_2 Forward -106 -87 -6.29373 0.295
NP_441993.1_1 Forward -106 -87 9.35345 0.136
NP_441993.1_1 Reverse -91 -110 5.26024 0.205
NP_441993.1_1 Reverse -85 -104 2.72635 0.254
NP_441993.1_1 Forward -77 -58 2.53143 0.257
NP_441174.1_2 Forward -103 -89 12.4876 0.248
NP_442352.1_1 Reverse -85 -98 14.0007 0.281
NP_440358.1_8 Reverse -121 -140 -0.983855 0.274
NP_440114.1_10 Forward -100 -86 16.6175 0.0165
NP_440114.1_10 Reverse -91 -105 8.35772 0.207
NP_441858.1_2 Forward -178 -159 9.45297 0.293
NP_442437.1_8 Forward -111 -92 7.66927 0.242
NP_442437.1_8 Reverse -80 -99 4.62101 0.256
NP_440287.1_6 Reverse -304 -323 17.109 0.065
NP_440287.1_6 Reverse -82 -101 2.3594 0.244
NP_440095.1_8 Reverse -259 -278 9.63589 0.285
NP_440293.1_3 Forward -108 -89 -6.09707 0.286
NP_440293.1_10 Forward -51 -32 4.12936 0.219
NP_440766.1_4 Forward -104 -90 8.35772 0.0871
NP_440766.1_4 Reverse -302 -316 0.491246 0.28
NP_439910.1_2 Forward -323 -306 -21.6923 0.184
NP_442867.1_8 Forward -92 -73 4.12936 0.291
NP_440457.1_1 Forward -104 -92 5.44718 0.141
NP_442509.1_9 Forward -100 -90 16.2041 0.00739
NP_442509.1_9 Reverse -91 -101 8.04271 0.192
NP_442514.1_6 Forward -110 -91 6.98095 0.24
NP_440554.1_4 Reverse -92 -102 15.418 0.0199
NP_440554.1_4 Forward -99 -89 13.943 0.0218
NP_440554.1_4 Forward -314 -304 6.96153 0.107
NP_441885.1_5 Forward -100 -90 11.4848 0.00668
NP_441885.1_5 Reverse -91 -101 11.3864 0.00668
NP_442128.1_1 Reverse -112 -131 15.6341 0.278
NP_441428.1_8 Reverse -83 -102 19.2723 0.0281
NP_442341.1_7 Reverse -90 -104 12.0943 0.0478
NP_442341.1_7 Forward -101 -87 9.83269 0.0697
NP_442341.1_7 Forward -127 -113 3.34284 0.227
NP_442341.1_9 Forward -299 -285 7.66879 0.192
NP_442341.1_9 Reverse -285 -299 4.71887 0.294
NP_441173.1_9 Reverse -131 -139 12.1137 0.21
NP_441173.1_9 Forward -212 -204 10.2454 0.261
NP_442395.2_4 Reverse -90 -109 23.4013 0.0128
NP_440409.1_1 Reverse -83 -102 -2.0655 0.245
NP_440423.1_6 Reverse -83 -102 -14.7502 0.229
NP_443000.1_7 Forward -102 -92 10.7964 0.0345
NP_443000.1_7 Reverse -89 -99 2.04498 0.226
NP_440507.2_3 Forward -109 -90 11.2084 0.194
NP_440552.1_8 Forward -392 -375 14.8534 0.145
NP_441842.1_10 Forward -107 -93 10.4227 0.165
NP_441842.1_10 Reverse -84 -98 10.0294 0.175
NP_440275.1_3 Forward -102 -92 18.6629 0.0082
NP_440275.1_3 Reverse -89 -99 17.9746 0.0082
NP_440275.1_3 Reverse -304 -314 8.92815 0.0602
NP_442932.1_9 Reverse -120 -139 3.83436 0.289
NP_440091.1_1 Reverse -87 -99 12.6253 0.0353
NP_440091.1_1 Forward -319 -307 7.51213 0.081
NP_440679.1_10 Reverse -84 -103 -20.3551 0.284
NP_442451.1_2 Reverse -83 -102 6.4893 0.117
NP_442638.1_3 Reverse -112 -131 10.6469 0.298
NP_439962.1_4 Forward -95 -76 -4.03212 0.265
NP_439962.1_4 Forward -108 -89 -8.16202 0.292
NP_440149.1_10 Reverse -91 -110 -9.34199 0.263
NP_441105.1_3 Forward -111 -92 9.43923 0.0458
NP_441105.1_3 Reverse -80 -99 -9.047 0.283
NP_442373.1_2 Reverse -157 -176 -11.5053 0.297
NP_440216.1_1 Forward -100 -86 -1.5737 0.034
NP_440216.1_1 Reverse -91 -105 -2.85201 0.0608
NP_440216.1_9 Forward -392 -383 5.89959 0.289
NP_440678.1_9 Forward -105 -86 8.16093 0.279
NP_440172.1_1 Reverse -91 -101 17.5813 0.00421
NP_440172.1_1 Forward -100 -90 8.73149 0.0586
NP_441226.1_7 Forward -99 -92 14.4934 0.0123
NP_441226.1_7 Reverse -92 -99 14.4934 0.0123
NP_441757.1_3 Forward -250 -231 -2.65548 0.286
NP_441111.1_7 Forward -99 -91 18.7023 0.00294
NP_441111.1_7 Reverse -92 -100 18.7023 0.00294
NP_442379.1_10 Reverse -84 -101 -2.71443 0.242
NP_441766.1_2 Forward -100 -91 17.5026 0.00297
NP_441766.1_2 Reverse -91 -100 17.5026 0.00297
NP_441766.1_2 Reverse -306 -315 6.78456 0.0896
NP_441766.1_9 Forward -291 -272 -0.885524 0.261
NP_440416.1_1 Forward -71 -52 -7.86702 0.229
NP_443052.1_9 Forward -98 -79 -4.42544 0.258
NP_440591.1_9 Forward -107 -89 14.2771 0.0893
NP_440591.1_9 Reverse -84 -102 11.5239 0.0943
NP_442154.1_1 Forward -44 -26 -16.4021 0.239
NP_440261.1_5 Forward -99 -86 -1.06236 0.0655
NP_440261.1_5 Forward -314 -301 -3.61896 0.136
NP_440261.1_5 Reverse -92 -105 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTAGAAGTCAAGGAAAAGTTACAAATCTTCCGTCTGACGGGTTTGTTGGACGCATTTTCCGAGCCTACCTTCCGTAAGGTAGTCAGCGATCACATCGAAGCAGGGCCTCCCCATGTGGTGCTGGACTTGTCCACCATTGATTTTATTGATAGCTCTGGCCTAGGAGCTTTGGTGCAGGTAACCAAACTTTCCCAAAACAAACAGGGAAGTGTACAGATTGTCACCAACCCTAGGGTTACCCAAACGGTAAAACTGGTGCGTTTGGAAAAATTCCTCCATCTCCATAATTCCCTGGCTGAGGCGATCGCCGCTACCACTGAGGGGTAATGATGGTTGGTTGTTCACGGGTGGTCCAACCATGGTGGTGCTGTCCCGTTTTGACTGCAATGGGGAGGTGCC

CDS

ATGACCCAGTTTGATGACCATCCCCTTTGGCAATCTTCCCTGAACCCCGCTGATGCCCCTGCGGTACAGTCCCTATCCCCCGTGGCCCTGGCCTATCTAGGAGATGCTGTTTTTGAACTTTATGTCCGTTGTTGTTATCTGTTTCCCCCCCGTCGCATAGGGGATTTTCACCGTCGGGTAGTGGCCCAAGTTCGAGCTGAACAACAGGCCCAAATTTTAACCACCCTTTTACCCCAATTAACCGACCCAGAAAAGGAATGGGTGCGTCGGGGTCGTAATGCCGCCACATCTACCTCCCGGCGAGCTAATCCCGAACTGTACCAGGCCGCCAGTGGTTTAGAAACTCTTTTAGGTTATTTATACCTCAGGGATGCCCGTCGACTAGATGAACTATTAGCCTTAATTGAACTGCCCGACGCCGCCCCCCGTTAG

Protein

MTQFDDHPLWQSSLNPADAPAVQSLSPVALAYLGDAVFELYVRCCYLFPPRRIGDFHRRVVAQVRAEQQAQILTTLLPQLTDPEKEWVRRGRNAATSTSRRANPELYQAASGLETLLGYLYLRDARRLDELLALIELPDAAPR