Your browser is old and dusty. Try Google Chrome!

Details for slr0952

ORF slr0952
Accession NP_441738.1
Symbol fbpII
Category Glycolysis
Definition fructose-1,6-bisphosphatase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -302 -316 4.71948 0.145
NP_441061.1_2 Reverse -321 -335 1.76955 0.183
NP_440795.1_7 Forward -131 -124 14.6904 0.0123
NP_440795.1_7 Reverse -124 -131 14.6904 0.0123
NP_441418.1_6 Reverse -320 -339 -19.6667 0.093
NP_441418.1_6 Forward -132 -113 -21.0434 0.136
NP_442291.1_5 Reverse -122 -138 -2.79306 0.226
NP_442291.1_5 Forward -133 -117 -3.57971 0.245
NP_441453.1_4 Reverse -123 -131 16.539 0.00633
NP_441453.1_4 Forward -132 -124 16.539 0.00633
NP_441453.1_4 Reverse -320 -328 6.80426 0.121
NP_441453.1_4 Forward -329 -321 6.11594 0.121
NP_441623.1_1 Reverse -170 -188 -2.43913 0.241
NP_442151.1_6 Reverse -123 -137 14.6509 0.0321
NP_442151.1_6 Forward -329 -315 8.94771 0.162
NP_440226.1_1 Forward -132 -113 17.7974 0.0175
NP_440226.1_1 Reverse -123 -142 13.5691 0.0352
NP_440226.1_1 Forward -329 -310 3.83436 0.212
NP_441342.1_2 Forward -136 -122 10.226 0.209
NP_440813.1_1 Forward -335 -321 19.5668 0.0896
NP_440120.1_4 Forward -175 -161 13.8643 0.29
NP_442744.1_9 Reverse -117 -131 12.8353 0.288
NP_442655.1_2 Reverse -286 -305 0.294447 0.293
NP_442173.1_1 Forward -131 -123 15.4574 0.00633
NP_442173.1_1 Reverse -124 -132 15.4574 0.00633
NP_442173.1_1 Forward -328 -320 12.0158 0.0316
NP_442173.1_1 Forward -105 -97 5.13263 0.226
NP_442173.1_1 Reverse -321 -329 4.83764 0.241
NP_442752.1_4 Reverse -320 -327 13.8055 0.0199
NP_442752.1_4 Forward -132 -125 13.8055 0.0199
NP_442752.1_4 Reverse -123 -130 13.8055 0.0199
NP_442752.1_4 Forward -310 -303 9.47889 0.109
NP_442752.1_4 Forward -68 -61 5.54565 0.194
NP_443027.1_4 Reverse -379 -389 6.46988 0.275
NP_443027.1_4 Reverse -121 -131 5.87989 0.294
NP_442975.1_10 Reverse -119 -133 19.0751 0.00482
NP_442975.1_10 Forward -333 -319 4.32555 0.245
NP_442975.1_10 Forward -136 -122 1.47397 0.297
NP_440784.1_7 Forward -131 -124 15.9687 0.0123
NP_440784.1_7 Reverse -124 -131 15.9687 0.0123
NP_440784.1_7 Reverse -321 -328 6.23397 0.241
NP_440784.1_7 Forward -328 -321 6.13563 0.241
NP_442909.1_7 Reverse -124 -138 11.7987 0.131
NP_440061.1_9 Reverse -299 -313 9.6354 0.143
NP_440061.1_9 Reverse -121 -135 8.65209 0.167
NP_440061.1_9 Reverse -13 -27 7.27547 0.213
NP_441054.1_2 Forward -47 -28 14.8474 0.156
NP_442062.1_8 Forward -132 -122 19.4496 0.000558
NP_442062.1_8 Reverse -123 -133 17.3846 0.00193
NP_441859.1_3 Forward -133 -114 3.14526 0.249
NP_441802.1_1 Forward -113 -94 4.52268 0.296
NP_440304.1_4 Reverse -274 -284 2.53664 0.299
NP_440304.1_4 Forward -134 -124 1.84832 0.299
NP_440304.1_4 Reverse -121 -131 1.84832 0.299
NP_442242.1_4 Forward -131 -124 14.3954 0.0124
NP_442242.1_4 Reverse -124 -131 14.3954 0.0124
NP_440044.1_8 Reverse -124 -143 5.40766 0.103
NP_441619.1_8 Forward -138 -124 7.47213 0.277
NP_441208.1_9 Reverse -293 -307 8.55439 0.219
NP_441083.1_5 Reverse -123 -133 20.3345 0.00053
NP_441083.1_5 Forward -329 -319 17.7779 0.00336
NP_441083.1_5 Forward -132 -122 11.3864 0.0159
NP_441083.1_5 Reverse -320 -330 -0.904945 0.283
NP_441434.1_7 Reverse -125 -139 2.94952 0.266
NP_441434.1_7 Forward -130 -116 1.86788 0.29
NP_441738.1_2 Forward -327 -320 15.28 0.0102
NP_441738.1_2 Forward -130 -123 15.28 0.0102
NP_441738.1_2 Reverse -125 -132 15.28 0.0102
NP_441738.1_3 Forward -78 -60 26.5685 0.00162
NP_441738.1_4 Forward -142 -123 22.5172 0.0495
NP_440209.1_1 Reverse -123 -131 18.1123 0.00295
NP_440209.1_1 Forward -132 -124 18.1123 0.00295
NP_440209.1_1 Reverse -320 -328 8.57422 0.0425
NP_440209.1_1 Forward -329 -321 5.52596 0.0821
NP_442889.1_8 Reverse -120 -134 20.8451 0.00339
NP_442889.1_8 Forward -332 -318 11.2087 0.0735
NP_441713.1_3 Reverse -375 -394 2.16274 0.288
NP_441713.1_8 Forward -277 -259 15.1621 0.171
NP_440178.1_7 Reverse -122 -141 -1.96717 0.0334
NP_442570.1_3 Forward -293 -274 -6.68705 0.259
NP_442570.1_3 Forward -294 -275 -8.35868 0.285
NP_441792.1_1 Forward -336 -317 8.16093 0.172
NP_442111.1_4 Forward -133 -119 9.2427 0.0619
NP_442111.1_4 Forward -330 -316 2.94952 0.259
NP_440906.1_5 Forward -131 -124 15.8704 0.0124
NP_440906.1_5 Reverse -124 -131 15.8704 0.0124
NP_440906.1_5 Reverse -321 -328 6.23397 0.234
NP_440906.1_5 Forward -328 -321 6.13563 0.241
NP_440747.1_10 Forward -135 -123 14.887 0.00223
NP_440747.1_10 Reverse -120 -132 5.34885 0.0141
NP_440747.1_10 Reverse -317 -329 5.25052 0.0154
NP_440747.1_10 Forward -332 -320 -12.3507 0.27
NP_441486.1_1 Reverse -120 -134 14.1593 0.00654
NP_441486.1_1 Forward -135 -121 13.8643 0.00743
NP_441486.1_1 Forward -332 -318 -4.7203 0.205
NP_440403.1_10 Reverse -267 -286 4.52268 0.255
NP_441014.1_10 Forward -151 -132 1.57197 0.227
NP_442848.1_1 Forward -138 -124 -1.47537 0.263
NP_443018.1_3 Forward -131 -124 14.8871 0.0123
NP_443018.1_3 Reverse -124 -131 14.8871 0.0123
NP_443018.1_3 Forward -328 -321 11.7405 0.0655
NP_443018.1_3 Reverse -321 -328 5.44732 0.193
NP_441634.1_8 Reverse -379 -393 -1.08205 0.278
NP_441634.1_8 Forward -134 -120 -3.04867 0.295
NP_441634.1_8 Reverse -318 -332 -4.32697 0.295
NP_440376.1_1 Forward -132 -123 19.4693 0.000692
NP_440376.1_1 Reverse -123 -132 19.4693 0.000692
NP_440376.1_1 Reverse -320 -329 5.99792 0.111
NP_440376.1_1 Forward -68 -59 1.57302 0.246
NP_440376.1_1 Reverse -295 -304 0.688044 0.262
NP_440376.1_1 Forward -329 -320 -0.196935 0.285
NP_441588.1_4 Reverse -125 -135 15.9097 0.0369
NP_441588.1_4 Forward -130 -120 14.238 0.0773
NP_441588.1_4 Forward -327 -317 9.02648 0.14
NP_442687.1_7 Reverse -122 -132 15.8113 0.0125
NP_442687.1_7 Forward -133 -123 8.92815 0.0994
NP_442589.1_3 Forward -227 -208 16.9521 0.237
NP_442485.1_3 Reverse -370 -389 6.09597 0.167
NP_441013.1_2 Reverse -309 -327 -4.79907 0.299
NP_441422.1_7 Forward -331 -314 8.00365 0.0992
NP_441422.1_7 Reverse -121 -138 -1.82945 0.194
NP_442658.1_1 Reverse -121 -131 15.9091 0.00966
NP_442658.1_1 Forward -134 -124 6.76441 0.214
NP_442658.1_1 Forward -331 -321 5.28945 0.274
NP_441855.2_4 Forward -312 -293 9.42666 0.278
NP_442782.1_2 Forward -322 -308 2.2612 0.275
NP_441414.1_9 Forward -132 -113 0.491109 0.0814
NP_441414.1_9 Reverse -123 -142 -0.590531 0.0929
NP_441414.1_9 Forward -68 -49 -9.44032 0.259
NP_442937.1_5 Forward -137 -118 17.8957 0.0288
NP_442937.1_5 Reverse -118 -137 15.3391 0.0581
NP_442937.1_5 Reverse -315 -334 6.98095 0.265
NP_442321.1_4 Reverse -79 -98 -1.67217 0.27
NP_441958.1_5 Forward -133 -123 12.2714 0.00183
NP_441958.1_5 Reverse -122 -132 12.2714 0.00183
NP_441958.1_5 Reverse -319 -329 0.865012 0.12
NP_440950.1_8 Forward -249 -230 11.8555 0.182
NP_440203.1_5 Forward -326 -316 14.2375 0.0886
NP_440984.1_7 Reverse -118 -132 7.86607 0.161
NP_440984.1_7 Forward -137 -123 7.57108 0.166
NP_439990.1_5 Reverse -315 -328 11.524 0.128
NP_441338.2_9 Forward -99 -80 15.7324 0.146
NP_442911.1_2 Reverse -113 -132 5.30933 0.0341
NP_442911.1_2 Forward -142 -123 -2.85214 0.104
NP_441580.1_6 Forward -143 -124 -8.55534 0.263
NP_440153.1_5 Forward -131 -117 0.589577 0.297
NP_442064.1_4 Reverse -244 -263 6.09517 0.257
NP_443055.1_6 Forward -224 -206 7.19654 0.163
NP_443055.1_6 Forward -140 -122 1.78836 0.224
NP_442210.1_1 Forward -325 -306 11.6025 0.156
NP_441099.1_5 Forward -339 -320 -0.983855 0.101
NP_441099.1_5 Forward -142 -123 -9.34199 0.219
NP_442002.1_9 Reverse -122 -129 10.7572 0.185
NP_441938.1_1 Forward -392 -373 8.45592 0.229
NP_441294.1_7 Forward -333 -319 15.2019 0.0285
NP_441294.1_7 Reverse -119 -133 11.5544 0.137
NP_441646.1_1 Reverse -294 -313 -1.7705 0.294
NP_442438.1_10 Forward -111 -97 10.9143 0.0478
NP_441000.1_6 Forward -133 -119 -3.73699 0.225
NP_441000.1_6 Reverse -122 -136 -5.21195 0.266
NP_440147.1_4 Reverse -121 -134 12.704 0.0326
NP_440147.1_4 Forward -134 -121 10.1474 0.0355
NP_440147.1_4 Reverse -318 -331 6.60746 0.0881
NP_441550.1_8 Forward -134 -124 14.6309 0.0132
NP_441550.1_8 Reverse -318 -328 13.3526 0.0252
NP_441550.1_8 Reverse -121 -131 8.3377 0.124
NP_441916.1_7 Forward -132 -122 18.4663 0.00144
NP_441916.1_7 Reverse -123 -133 10.3048 0.0261
NP_441916.1_10 Forward -374 -355 -0.000545616 0.294
NP_441041.1_4 Forward -329 -310 1.76941 0.0792
NP_441041.1_4 Reverse -123 -142 -4.6221 0.14
NP_441041.1_7 Reverse -120 -132 9.55551 0.109
NP_441041.1_7 Forward -332 -320 5.57123 0.25
NP_442396.1_5 Forward -136 -123 12.2123 0.0913
NP_442396.1_5 Reverse -119 -132 9.95071 0.128
NP_441547.1_1 Reverse -316 -335 4.52268 0.226
NP_441725.1_5 Forward -131 -121 2.04498 0.115
NP_441725.1_5 Reverse -124 -134 2.04498 0.115
NP_439966.1_7 Forward -331 -321 17.6791 0.00636
NP_439966.1_7 Reverse -121 -131 9.91099 0.0968
NP_439966.1_7 Forward -134 -124 7.25606 0.15
NP_439966.1_9 Reverse -121 -130 0.884706 0.253
NP_442941.1_3 Reverse -124 -134 11.0914 0.0116
NP_442941.1_3 Forward -131 -121 2.63497 0.14
NP_442941.1_3 Forward -328 -318 1.25834 0.15
NP_440289.1_2 Forward -332 -319 10.4424 0.0265
NP_440289.1_2 Reverse -120 -133 3.06754 0.0811
NP_440983.1_5 Reverse -123 -142 -2.26216 0.231
NP_440983.1_9 Forward -300 -281 3.73603 0.285
NP_440260.1_8 Reverse -260 -278 1.88744 0.182
NP_440260.1_8 Reverse -292 -310 -5.19239 0.273
NP_441514.1_6 Forward -174 -167 14.2971 0.248
NP_442281.1_1 Reverse -118 -132 12.782 0.034
NP_442281.1_1 Forward -334 -320 9.93039 0.0648
NP_442281.1_1 Forward -137 -123 7.96378 0.089
NP_440177.1_9 Forward -140 -121 15.3391 0.19
NP_440395.1_9 Reverse -261 -280 17.5024 0.212
NP_001035871.2_7 Forward -294 -284 15.9097 0.14
NP_441644.1_6 Reverse -123 -133 17.3841 0.00127
NP_441644.1_6 Forward -329 -319 14.4342 0.0126
NP_441644.1_6 Forward -132 -122 10.1076 0.0628
NP_443049.1_2 Reverse -274 -293 9.63589 0.279
NP_443049.1_6 Reverse -319 -329 14.4711 0.114
NP_440867.1_10 Reverse -286 -305 0.687771 0.299
NP_442215.1_2 Reverse -121 -137 -1.51476 0.186
NP_441810.1_9 Forward -336 -317 2.26107 0.269
NP_442029.1_1 Reverse -318 -337 -10.4236 0.219
NP_442247.1_8 Forward -134 -120 8.65272 0.266
NP_440253.1_2 Forward -132 -114 12.6055 0.027
NP_440253.1_2 Reverse -320 -338 -1.94747 0.254
NP_440253.1_2 Reverse -123 -141 -2.24246 0.262
NP_440929.1_8 Forward -132 -123 19.2726 0.000701
NP_440929.1_8 Reverse -123 -132 19.2726 0.000701
NP_440929.1_8 Forward -329 -320 7.07956 0.0713
NP_440929.1_8 Reverse -59 -68 2.06468 0.268
NP_441346.1_7 Reverse -84 -103 10.1275 0.274
NP_442933.1_10 Forward -132 -123 17.601 0.00325
NP_442933.1_10 Reverse -123 -132 17.601 0.00325
NP_441751.2_8 Reverse -16 -30 -5.90027 0.244
NP_442554.1_8 Reverse -124 -134 15.3197 0.00882
NP_442554.1_8 Forward -131 -121 13.2547 0.0187
NP_442554.1_8 Forward -328 -318 5.48657 0.146
NP_442554.1_8 Reverse -321 -331 2.24165 0.276
NP_441762.1_7 Forward -133 -121 10.1671 0.0142
NP_441762.1_7 Reverse -122 -134 9.57708 0.0142
NP_441762.1_7 Reverse -319 -331 -4.68091 0.181
NP_442142.1_4 Forward -332 -319 7.98351 0.125
NP_442142.1_4 Forward -135 -122 5.52525 0.188
NP_442142.1_4 Reverse -120 -133 4.64028 0.214
NP_442292.1_1 Reverse -124 -133 18.486 0.00229
NP_442292.1_1 Forward -131 -122 9.63616 0.0183
NP_442292.1_1 Forward -328 -319 8.65285 0.0335
NP_442476.1_6 Forward -131 -117 0.392915 0.262
NP_442476.1_6 Reverse -124 -138 0.0979218 0.274
NP_440895.1_6 Reverse -314 -327 11.4257 0.202
NP_443009.1_5 Forward -133 -122 18.3477 0.00265
NP_441715.1_4 Forward -131 -121 9.41981 0.097
NP_441715.1_4 Reverse -124 -134 7.94484 0.107
NP_440357.1_3 Forward -70 -51 2.16274 0.269
NP_440379.1_5 Reverse -372 -391 -4.03212 0.208
NP_440379.1_5 Forward -225 -206 -10.1286 0.276
NP_440464.1_10 Reverse -124 -134 13.0082 0.169
NP_441468.1_1 Forward -131 -124 15.8704 0.0124
NP_441468.1_1 Reverse -124 -131 15.8704 0.0124
NP_441468.1_1 Reverse -321 -328 6.13563 0.209
NP_441468.1_1 Forward -328 -321 6.0373 0.223
NP_441020.2_6 Forward -134 -117 12.3302 0.0975
NP_441020.2_6 Reverse -121 -138 6.62702 0.26
NP_441673.1_1 Forward -132 -123 20.8459 0.000698
NP_441673.1_1 Reverse -123 -132 20.8459 0.000698
NP_441673.1_1 Reverse -320 -329 1.37636 0.114
NP_441673.1_1 Forward -329 -320 1.1797 0.163
NP_441826.1_2 Forward -335 -321 0.0979218 0.198
NP_441826.1_2 Reverse -314 -328 -4.81863 0.3
NP_441330.1_1 Reverse -118 -137 -12.3902 0.183
NP_441330.1_1 Forward -137 -118 -12.4886 0.183
NP_442868.1_6 Forward -134 -124 9.81313 0.038
NP_442868.1_6 Reverse -121 -131 0.865012 0.205
NP_442868.1_6 Forward -331 -321 0.176696 0.247
NP_442868.1_6 Reverse -318 -328 0.0783647 0.248
NP_442719.1_2 Reverse -188 -206 -10.4046 0.273
NP_441056.1_1 Reverse -123 -142 1.0811 0.151
NP_441056.1_1 Forward -329 -310 -6.88371 0.271
NP_441612.1_2 Reverse -123 -133 8.54929 0.21
NP_442427.1_8 Reverse -114 -133 12.9791 0.152
NP_442427.1_8 Forward -141 -122 8.06259 0.203
NP_442808.1_1 Forward -330 -320 19.449 0.00201
NP_442808.1_1 Reverse -122 -132 18.4657 0.00201
NP_442808.1_1 Forward -133 -123 8.63269 0.0481
NP_442808.1_1 Reverse -281 -291 2.24121 0.274
NP_440145.1_3 Reverse -310 -329 -3.54046 0.202
NP_440145.1_3 Forward -142 -123 -6.29373 0.295
NP_442542.1_2 Reverse -293 -306 10.1474 0.129
NP_442050.1_1 Reverse -320 -339 10.3242 0.243
NP_442050.1_5 Forward -134 -124 7.64939 0.243
NP_442342.1_9 Forward -331 -315 7.43336 0.207
NP_440558.1_2 Reverse -292 -311 -6.98204 0.284
NP_442789.1_4 Reverse -124 -143 -5.80207 0.279
NP_441878.1_6 Forward -133 -123 10.4031 0.0176
NP_441878.1_6 Reverse -122 -132 10.4031 0.0176
NP_441036.1_8 Reverse -122 -132 17.7779 0.000554
NP_441036.1_8 Forward -107 -97 13.2547 0.0513
NP_441036.1_8 Forward -133 -123 8.33817 0.174
NP_441036.1_8 Forward -330 -320 6.07655 0.242
NP_442650.1_2 Forward -310 -296 12.291 0.13
NP_441534.1_1 Reverse -51 -70 11.9958 0.13
NP_441557.1_5 Forward -132 -123 19.9609 0.000699
NP_441557.1_5 Reverse -123 -132 19.9609 0.000699
NP_441557.1_5 Reverse -320 -329 1.08137 0.0794
NP_441557.1_5 Forward -329 -320 0.589713 0.134
NP_441445.1_1 Reverse -311 -330 4.71934 0.189
NP_441445.1_1 Forward -141 -122 2.45773 0.233
NP_441445.1_1 Reverse -114 -133 0.58944 0.272
NP_441445.1_8 Reverse -289 -308 -9.44032 0.277
NP_442066.2_9 Reverse -93 -106 7.09911 0.247
NP_442350.1_1 Reverse -128 -147 12.0942 0.278
NP_442777.1_1 Forward -303 -284 11.11 0.194
NP_442419.1_2 Forward -137 -118 -3.24547 0.255
NP_442830.1_5 Forward -391 -377 -0.689302 0.297
NP_442183.1_1 Forward -132 -118 11.111 0.0757
NP_442183.1_1 Reverse -320 -334 8.25939 0.119
NP_442183.1_1 Reverse -123 -137 5.99778 0.193
NP_442397.1_9 Forward -106 -87 3.24438 0.264
NP_440058.1_7 Forward -290 -271 7.57094 0.247
NP_440540.1_7 Reverse -302 -321 20.7473 0.132
NP_442347.1_2 Reverse -124 -133 12.4878 0.056
NP_442347.1_2 Forward -131 -122 11.1111 0.056
NP_442347.1_2 Forward -328 -319 10.3245 0.058
NP_442347.1_2 Reverse -60 -69 7.96454 0.122
NP_442645.1_2 Forward -140 -121 16.4207 0.00345
NP_442645.1_2 Reverse -115 -134 -22.3217 0.29
NP_442645.1_2 Reverse -312 -331 -22.9117 0.299
NP_440547.1_1 Forward -149 -130 7.17681 0.294
NP_441037.1_4 Reverse -121 -131 14.7245 0.028
NP_441037.1_4 Forward -134 -124 7.9999 0.237
NP_440151.1_5 Forward -297 -278 13.2741 0.107
NP_441633.1_3 Forward -134 -121 8.57408 0.0377
NP_441633.1_3 Reverse -121 -134 3.46087 0.0699
NP_440136.1_2 Forward -131 -124 15.9687 0.0123
NP_440136.1_2 Reverse -124 -131 15.9687 0.0123
NP_440136.1_2 Reverse -321 -328 6.23397 0.171
NP_440136.1_2 Forward -328 -321 6.13563 0.193
NP_442590.1_10 Forward -329 -310 6.09597 0.25
NP_442998.1_5 Forward -208 -198 9.7148 0.236
NP_442998.1_10 Forward -327 -320 15.5754 0.0102
NP_442998.1_10 Forward -130 -123 15.5754 0.0102
NP_442998.1_10 Reverse -125 -132 15.5754 0.0102
NP_440899.1_1 Reverse -276 -295 8.40744 0.231
NP_440899.1_8 Reverse -80 -99 2.55606 0.131
NP_440299.1_1 Forward -136 -123 13.0967 0.0319
NP_440299.1_1 Reverse -119 -132 10.9334 0.0529
NP_440299.1_1 Reverse -316 -329 4.24695 0.213
NP_441799.1_1 Forward -136 -122 16.1252 0.0153
NP_441799.1_1 Reverse -119 -133 12.2903 0.0441
NP_441007.1_10 Forward -137 -124 1.10092 0.209
NP_442201.1_10 Forward -110 -91 -13.9635 0.28
NP_442201.1_10 Reverse -112 -131 -14.9469 0.295
NP_440256.1_1 Forward -135 -116 4.32602 0.0453
NP_440256.1_1 Reverse -317 -336 3.83436 0.049
NP_441559.1_8 Reverse -64 -78 -5.40861 0.261
NP_441559.1_8 Reverse -183 -197 -6.68692 0.279
NP_441559.1_8 Forward -296 -282 -7.57189 0.295
NP_441559.1_8 Reverse -259 -273 -7.57189 0.295
NP_442756.1_2 Reverse -115 -134 5.30933 0.27
NP_440915.1_6 Reverse -291 -305 2.45787 0.118
NP_440915.1_6 Reverse -316 -330 2.16287 0.124
NP_441866.1_6 Reverse -94 -113 8.25844 0.258
NP_441704.1_8 Forward -143 -124 7.57013 0.234
NP_442866.1_1 Reverse -258 -277 -8.752 0.282
NP_441464.1_8 Reverse -123 -137 6.48943 0.232
NP_441464.1_8 Forward -132 -118 3.93283 0.283
NP_441464.1_10 Reverse -318 -332 8.16106 0.287
NP_441464.1_10 Reverse -292 -306 7.76774 0.292
NP_440787.1_5 Reverse -115 -129 11.406 0.256
NP_441417.1_1 Forward -269 -250 7.17762 0.29
NP_442386.1_9 Reverse -122 -131 15.7322 0.0144
NP_442386.1_9 Forward -330 -321 13.8639 0.0289
NP_442386.1_9 Forward -133 -124 13.8639 0.0289
NP_442386.1_9 Forward -391 -382 11.4057 0.0942
NP_442386.1_9 Reverse -380 -389 9.34074 0.166
NP_442386.1_9 Forward -198 -189 5.9975 0.23
NP_440570.1_5 Forward -148 -129 6.78429 0.183
NP_440570.1_5 Forward -295 -276 0.687771 0.254
NP_440570.1_7 Reverse -206 -225 19.764 0.123
NP_441750.1_1 Forward -192 -173 -7.76869 0.27
NP_441340.1_5 Forward -131 -124 15.6737 0.0124
NP_441340.1_5 Reverse -124 -131 15.6737 0.0124
NP_441340.1_5 Reverse -321 -328 13.5105 0.0314
NP_441340.1_5 Forward -328 -321 5.84064 0.208
NP_442484.1_2 Forward -143 -124 12.0942 0.0788
NP_440586.1_8 Forward -131 -124 13.2151 0.026
NP_440586.1_8 Reverse -124 -131 13.2151 0.026
NP_440586.1_8 Forward -328 -321 9.47853 0.146
NP_440586.1_8 Reverse -321 -328 5.74197 0.283
NP_442251.1_6 Forward -131 -124 15.2804 0.0124
NP_442251.1_6 Reverse -124 -131 15.2804 0.0124
NP_440192.1_4 Forward -41 -22 8.62144 0.292
NP_441912.1_3 Forward -323 -304 7.66927 0.27
NP_440684.1_9 Reverse -117 -131 11.8976 0.168
NP_440684.1_9 Reverse -91 -105 10.0294 0.209
NP_440684.1_9 Forward -138 -124 8.94771 0.221
NP_441262.1_3 Reverse -320 -327 14.7888 0.0223
NP_441262.1_3 Reverse -123 -130 14.7888 0.0223
NP_441262.1_3 Forward -132 -125 14.7888 0.0223
NP_443051.1_1 Reverse -122 -131 10.4228 0.00754
NP_443051.1_1 Forward -133 -124 10.4228 0.00754
NP_443051.1_1 Reverse -319 -328 7.47288 0.0571
NP_441232.1_10 Forward -143 -124 2.65439 0.243
NP_439937.1_9 Reverse -96 -113 -9.7949 0.209
NP_439937.1_9 Reverse -98 -115 -11.5649 0.257
NP_440836.1_6 Reverse -87 -101 11.7993 0.214
NP_440408.1_7 Forward -269 -250 9.3409 0.262
NP_440626.1_8 Forward -385 -366 8.94757 0.264
NP_440372.1_2 Forward -131 -124 16.3621 0.0124
NP_440372.1_2 Reverse -124 -131 16.3621 0.0124
NP_440372.1_2 Reverse -321 -328 13.8055 0.0214
NP_440372.1_2 Forward -328 -321 6.52896 0.188
NP_440574.1_7 Reverse -8 -27 9.43923 0.283
NP_442783.1_2 Reverse -172 -191 10.7175 0.223
NP_440819.1_5 Forward -209 -201 7.98423 0.228
NP_440139.1_1 Reverse -338 -357 11.405 0.0797
NP_440210.1_2 Reverse -274 -293 16.5191 0.173
NP_442384.1_10 Reverse -123 -136 8.77074 0.0608
NP_442384.1_10 Forward -132 -119 7.09911 0.0875
NP_442384.1_10 Forward -329 -316 5.32916 0.131
NP_441877.1_7 Forward -334 -315 5.80018 0.218
NP_441877.1_7 Reverse -118 -137 3.34192 0.218
NP_441877.1_7 Forward -268 -249 0.981987 0.248
NP_441018.1_7 Reverse -316 -335 8.65258 0.241
NP_441018.1_7 Reverse -244 -263 7.27595 0.273
NP_442790.1_4 Forward -338 -319 -9.14533 0.18
NP_442262.1_10 Forward -131 -124 14.1988 0.0123
NP_442262.1_10 Reverse -124 -131 14.1988 0.0123
NP_442262.1_10 Forward -328 -321 13.2155 0.0213
NP_441689.1_5 Forward -134 -124 5.78111 0.197
NP_440163.1_10 Reverse -138 -148 12.7631 0.154
NP_440344.1_10 Forward -336 -319 2.98877 0.0276
NP_440344.1_10 Reverse -116 -133 0.235503 0.0365
NP_440344.1_10 Forward -139 -122 -9.79426 0.156
NP_441060.1_4 Forward -149 -131 8.96727 0.186
NP_441965.1_10 Forward -393 -377 9.59664 0.117
NP_442065.1_7 Reverse -311 -329 8.27895 0.215
NP_442102.1_7 Forward -103 -84 16.9124 0.167
NP_440297.1_9 Reverse -170 -180 -0.0199663 0.282
NP_440297.1_9 Forward -284 -274 -0.118297 0.282
NP_440297.1_9 Forward -131 -121 -0.118297 0.282
NP_440297.1_9 Reverse -124 -134 -0.118297 0.282
NP_440297.1_9 Forward -389 -379 -0.216628 0.282
NP_442187.1_3 Reverse -319 -329 15.6147 0.105
NP_442280.1_10 Reverse -244 -262 6.91543 0.268
NP_443036.1_1 Reverse -167 -186 8.65176 0.291
NP_440999.1_9 Forward -333 -319 11.111 0.0474
NP_440888.1_2 Reverse -123 -137 8.94708 0.142
NP_440888.1_2 Forward -132 -118 7.17714 0.205
NP_440888.1_2 Reverse -97 -111 5.99717 0.254
NP_440888.1_2 Forward -329 -315 5.1122 0.293
NP_440600.1_4 Reverse -115 -133 2.77242 0.121
NP_440600.1_4 Forward -337 -319 -2.24246 0.193
NP_440600.1_4 Forward -140 -122 -7.65067 0.293
NP_442033.1_10 Forward -331 -312 3.24438 0.0873
NP_441543.1_2 Forward -131 -122 18.486 0.00236
NP_441543.1_2 Reverse -124 -133 16.9127 0.00359
NP_441543.1_2 Forward -328 -319 7.07956 0.131
NP_442845.1_2 Forward -138 -124 6.6861 0.205
NP_442845.1_2 Reverse -314 -328 4.42448 0.259
NP_440380.1_1 Reverse -321 -340 -1.08219 0.156
NP_441918.1_7 Forward -133 -114 4.22769 0.265
NP_441469.1_8 Reverse -122 -131 16.126 0.00797
NP_441469.1_8 Forward -391 -382 12.7828 0.0967
NP_441469.1_8 Forward -264 -255 10.8161 0.195
NP_441469.1_8 Forward -133 -124 6.48957 0.227
NP_441469.1_8 Forward -330 -321 5.60459 0.258
NP_443064.1_6 Reverse -123 -133 12.5669 0.0796
NP_443064.1_8 Forward -214 -204 14.8275 0.29
NP_442337.1_8 Reverse -10 -29 5.60432 0.21
NP_442578.1_7 Forward -131 -124 14.5921 0.026
NP_442578.1_7 Reverse -124 -131 14.5921 0.026
NP_442578.1_7 Reverse -321 -328 6.0373 0.18
NP_441462.1_2 Forward -132 -122 11.5831 0.00406
NP_441462.1_2 Reverse -123 -133 11.5831 0.00406
NP_441462.1_2 Reverse -320 -330 7.55152 0.0543
NP_441462.1_5 Forward -237 -218 3.83436 0.285
NP_443062.1_1 Reverse -123 -141 10.2035 0.121
NP_443062.1_1 Forward -329 -311 5.32818 0.231
NP_443062.1_1 Forward -132 -114 4.35311 0.264
NP_443062.1_6 Forward -361 -342 4.81767 0.214
NP_442204.1_1 Reverse -316 -327 8.7118 0.0852
NP_441351.1_8 Reverse -121 -140 3.24438 0.232
NP_440516.1_2 Forward -335 -317 4.14905 0.139
NP_440516.1_2 Reverse -53 -71 3.26407 0.152
NP_440516.1_8 Reverse -320 -329 18.9776 0.00442
NP_440516.1_8 Forward -132 -123 16.9127 0.00442
NP_440516.1_8 Reverse -123 -132 16.9127 0.00442
NP_440516.1_8 Forward -329 -320 5.01461 0.118
NP_440516.1_8 Reverse -295 -304 -0.393597 0.255
NP_441785.1_1 Reverse -351 -365 12.1566 0.266
NP_441033.1_2 Forward -142 -123 -9.93197 0.293
NP_442428.1_5 Forward -131 -124 15.8704 0.0124
NP_442428.1_5 Reverse -124 -131 15.8704 0.0124
NP_442428.1_5 Reverse -321 -328 6.13563 0.209
NP_442428.1_5 Forward -328 -321 6.0373 0.212
NP_442823.1_9 Reverse -80 -99 15.7268 0.206
NP_440673.1_3 Forward -327 -320 12.4288 0.0426
NP_440673.1_3 Forward -130 -123 12.4288 0.0426
NP_440673.1_3 Reverse -125 -132 12.4288 0.0426
NP_441052.1_2 Reverse -123 -133 19.9412 0.00106
NP_441052.1_2 Forward -329 -319 10.6981 0.0285
NP_441052.1_2 Forward -132 -122 10.5014 0.0285
NP_442219.1_8 Forward -142 -123 6.52434 0.294
NP_442219.1_9 Reverse -124 -133 17.7976 0.00718
NP_442219.1_9 Forward -131 -122 8.35786 0.0681
NP_442219.1_9 Forward -328 -319 7.96454 0.0696
NP_440436.1_4 Forward -131 -122 18.1905 0.00233
NP_440436.1_4 Reverse -124 -133 17.2072 0.00233
NP_440436.1_4 Forward -328 -319 7.57079 0.124
NP_441884.1_8 Reverse -122 -141 -10.817 0.268
NP_442086.1_4 Forward -341 -322 15.7394 0.268
NP_440314.1_9 Reverse -124 -143 -9.34199 0.264
NP_441719.1_4 Forward -131 -124 16.3621 0.0124
NP_441719.1_4 Reverse -124 -131 16.3621 0.0124
NP_441719.1_4 Reverse -321 -328 6.82395 0.0855
NP_441719.1_4 Forward -328 -321 6.52896 0.188
NP_441733.1_10 Reverse -317 -330 8.08242 0.143
NP_441733.1_10 Forward -135 -122 7.09911 0.156
NP_440746.1_7 Reverse -52 -71 15.6341 0.23
NP_442366.1_3 Reverse -122 -140 -5.48739 0.288
NP_442366.1_3 Reverse -343 -361 -5.58572 0.289
NP_442366.1_5 Forward -135 -125 15.4175 0.0374
NP_442366.1_5 Reverse -317 -327 14.0409 0.0497
NP_442366.1_5 Reverse -120 -130 13.3526 0.0775
NP_442694.1_4 Reverse -294 -303 14.1594 0.2
NP_442206.1_10 Forward -390 -375 0.864876 0.243
NP_443054.1_2 Forward -134 -120 1.76955 0.245
NP_443054.1_2 Forward -306 -292 -0.197071 0.288
NP_441851.1_10 Reverse -122 -132 16.008 0.00552
NP_441851.1_10 Forward -133 -123 15.8113 0.00552
NP_442622.1_1 Reverse -371 -390 -13.2752 0.296
NP_442856.1_7 Forward -390 -371 -2.65548 0.236
NP_441668.1_4 Reverse -113 -132 10.7175 0.106
NP_441668.1_4 Forward -142 -123 3.04771 0.188
NP_442515.1_1 Forward -133 -119 5.40779 0.107
NP_442515.1_1 Reverse -122 -136 3.34284 0.12
NP_441982.1_6 Forward -211 -202 11.6259 0.288
NP_441349.1_10 Forward -142 -123 -0.885524 0.0967
NP_441409.1_6 Reverse -204 -223 -8.06369 0.162
NP_440389.1_5 Reverse -83 -102 13.2829 0.261
NP_440432.1_9 Forward -131 -116 -1.69173 0.167
NP_442843.1_1 Reverse -124 -143 -3.44213 0.222
NP_442843.1_1 Reverse -321 -340 -5.60541 0.244
NP_442843.1_1 Forward -84 -65 -12.0953 0.298
NP_442450.1_5 Reverse -121 -131 7.55152 0.13
NP_442450.1_5 Forward -134 -124 7.55152 0.13
NP_442168.1_5 Reverse -124 -143 11.6025 0.137
NP_442168.1_5 Reverse -337 -356 -2.16383 0.264
NP_442006.1_2 Forward -390 -373 -17.1691 0.27
NP_442006.1_2 Reverse -381 -398 -17.7591 0.282
NP_441003.1_9 Forward -147 -128 7.17762 0.237
NP_441570.1_1 Reverse -123 -141 -7.84733 0.0968
NP_441078.1_4 Forward -132 -123 19.6659 0.0007
NP_441078.1_4 Reverse -123 -132 19.6659 0.0007
NP_441078.1_4 Reverse -320 -329 0.196389 0.205
NP_441078.1_4 Forward -329 -320 -0.000272808 0.205
NP_442729.1_8 Forward -314 -301 10.7374 0.125
NP_440539.1_9 Forward -321 -302 -3.73712 0.286
NP_441663.1_8 Forward -335 -316 4.22769 0.169
NP_440707.1_9 Reverse -321 -340 0.982764 0.292
NP_440526.1_3 Reverse -124 -135 1.04151 0.267
NP_441432.1_8 Forward -133 -124 16.8143 0.00595
NP_441432.1_8 Reverse -319 -328 14.0611 0.0258
NP_441432.1_8 Reverse -122 -131 8.25953 0.0755
NP_441432.1_8 Reverse -263 -272 4.22796 0.235
NP_442320.1_8 Forward -138 -124 5.99778 0.0309
NP_442320.1_8 Reverse -117 -131 5.01447 0.0442
NP_442344.1_7 Reverse -124 -143 11.4058 0.0277
NP_442344.1_7 Forward -131 -112 -6.98204 0.176
NP_441732.1_2 Reverse -119 -135 -16.5594 0.174
NP_440629.1_4 Forward -110 -91 11.3075 0.222
NP_442003.1_4 Forward -328 -309 10.7175 0.288
NP_440759.1_10 Reverse -311 -330 4.81767 0.249
NP_440760.1_1 Reverse -123 -142 6.98095 0.0115
NP_440760.1_1 Forward -132 -113 -19.9617 0.22
NP_442797.1_7 Reverse -294 -312 2.96908 0.236
NP_440578.1_7 Reverse -65 -84 9.53674 0.292
NP_441057.1_3 Reverse -82 -101 7.66927 0.0829
NP_441072.1_2 Forward -235 -216 7.37428 0.257
NP_440713.1_4 Reverse -254 -273 4.03102 0.231
NP_442489.1_2 Forward -143 -124 2.0644 0.278
NP_442489.1_7 Forward -132 -123 20.1576 0.000695
NP_442489.1_7 Reverse -123 -132 20.1576 0.000695
NP_442489.1_7 Forward -329 -320 0.688044 0.152
NP_442489.1_7 Reverse -320 -329 0.688044 0.152
NP_442079.1_7 Reverse -124 -143 2.65439 0.225
NP_440559.1_1 Reverse -124 -133 17.4043 0.00658
NP_440559.1_1 Forward -131 -122 8.75118 0.0586
NP_440559.1_1 Forward -328 -319 7.76787 0.0918
NP_441659.2_8 Reverse -123 -133 18.1713 0.00133
NP_441659.2_8 Forward -132 -122 11.9764 0.0147
NP_441659.2_8 Forward -329 -319 5.48657 0.106
NP_442913.1_10 Forward -141 -122 -1.27885 0.168
NP_442346.1_5 Forward -133 -123 16.6963 0.00248
NP_442346.1_5 Reverse -122 -132 9.02648 0.118
NP_442346.1_10 Reverse -370 -389 -0.983855 0.28
NP_440545.1_5 Reverse -316 -333 4.75873 0.244
NP_440831.1_3 Forward -141 -122 6.29006 0.275
NP_441786.1_10 Forward -141 -122 12.7825 0.145
NP_441923.1_6 Forward -389 -375 9.5377 0.278
NP_440486.1_6 Forward -69 -50 6.78429 0.278
NP_440459.1_2 Forward -331 -314 7.217 0.299
NP_441653.1_2 Reverse -112 -131 2.56328 0.291
NP_440010.1_4 Forward -376 -357 -2.55791 0.284
NP_442603.1_7 Forward -329 -315 6.48882 0.24
NP_442603.1_10 Forward -320 -303 15.0379 0.297
NP_441585.1_5 Forward -194 -175 0.392004 0.291
NP_441888.1_7 Forward -334 -320 9.34103 0.154
NP_441888.1_7 Reverse -118 -132 2.85119 0.225
NP_441948.1_4 Forward -139 -121 -2.53746 0.169
NP_441948.1_4 Reverse -116 -134 -3.42244 0.193
NP_441948.1_4 Reverse -374 -392 -4.50408 0.231
NP_441833.1_4 Forward -131 -124 15.9687 0.0124
NP_441833.1_4 Reverse -124 -131 15.9687 0.0124
NP_441833.1_4 Forward -328 -321 6.52896 0.0924
NP_441833.1_4 Reverse -321 -328 6.23397 0.163
NP_441112.1_6 Reverse -106 -125 1.57275 0.252
NP_442162.1_9 Forward -131 -124 16.2637 0.0124
NP_442162.1_9 Reverse -124 -131 16.2637 0.0124
NP_442162.1_9 Forward -328 -321 12.9205 0.0282
NP_442162.1_9 Reverse -321 -328 12.9205 0.0282
NP_440671.1_4 Reverse -314 -328 8.45605 0.198
NP_440671.1_4 Forward -335 -321 6.78443 0.235
NP_440772.1_8 Forward -335 -316 17.6007 0.253
NP_440204.1_5 Reverse -235 -254 14.5603 0.23
NP_442199.1_5 Reverse -115 -134 -1.86883 0.183
NP_442199.1_5 Forward -140 -121 -6.39206 0.273
NP_442140.1_3 Forward -131 -121 16.2046 0.0255
NP_442140.1_3 Reverse -124 -134 12.2714 0.0632
NP_442140.1_3 Forward -328 -318 10.2065 0.0902
NP_442140.1_3 Reverse -321 -331 6.76487 0.159
NP_442140.1_3 Reverse -382 -392 4.69992 0.238
NP_442723.1_1 Reverse -92 -111 4.62021 0.276
NP_441609.1_1 Reverse -90 -109 -0.4922 0.242
NP_441813.1_3 Forward -210 -191 13.3647 0.291
NP_441813.1_5 Forward -331 -321 16.303 0.01
NP_441813.1_5 Reverse -121 -131 9.91146 0.021
NP_441813.1_5 Forward -134 -124 8.63316 0.0367
NP_440590.1_4 Reverse -124 -137 7.78743 0.0494
NP_440590.1_4 Reverse -321 -334 4.54251 0.0601
NP_440590.1_4 Forward -328 -315 3.26421 0.0749
NP_440590.1_4 Forward -131 -118 1.39592 0.125
NP_442497.1_10 Forward -131 -122 10.4228 0.0087
NP_442497.1_10 Reverse -124 -133 10.4228 0.0087
NP_442497.1_10 Forward -328 -319 0.589713 0.153
NP_440821.1_4 Reverse -121 -131 10.2065 0.0163
NP_440821.1_4 Forward -134 -124 9.41981 0.0286
NP_440821.1_4 Reverse -318 -328 -0.314959 0.251
NP_441239.1_9 Forward -331 -319 12.6253 0.0446
NP_441239.1_9 Reverse -121 -133 12.3303 0.0477
NP_441239.1_9 Forward -134 -122 5.93884 0.202
NP_441239.1_9 Forward -392 -380 4.46387 0.253
NP_442897.1_7 Reverse -289 -308 13.1758 0.3
NP_441892.1_1 Forward -332 -315 -1.82945 0.214
NP_441892.1_1 Reverse -311 -328 -4.18939 0.256
NP_440665.1_1 Forward -150 -131 -14.8485 0.264
NP_442270.1_9 Forward -143 -124 -6.58872 0.207
NP_442643.1_3 Reverse -277 -296 -5.50708 0.261
NP_441874.1_1 Reverse -266 -280 9.93102 0.265
NP_440354.1_7 Forward -138 -120 6.41066 0.283
NP_440412.1_7 Forward -208 -189 16.5191 0.265
NP_440546.1_4 Reverse -320 -330 14.0213 0.0459
NP_440546.1_4 Forward -132 -122 11.8882 0.0679
NP_440546.1_4 Reverse -123 -133 10.046 0.109
NP_440546.1_6 Forward -116 -97 7.96426 0.265
NP_441230.1_5 Forward -334 -315 1.67108 0.238
NP_440462.1_6 Forward -331 -321 13.353 0.0279
NP_440462.1_6 Reverse -121 -131 9.02648 0.0498
NP_440462.1_6 Forward -134 -124 1.35667 0.294
NP_440868.1_4 Reverse -119 -131 8.39711 0.0602
NP_440868.1_4 Forward -136 -124 5.84051 0.0879
NP_440868.1_4 Reverse -316 -328 3.57889 0.134
NP_441582.1_5 Forward -101 -82 4.62021 0.223
NP_441582.1_5 Forward -134 -115 2.85027 0.281
NP_440812.1_4 Forward -104 -85 16.4832 0.198
NP_442402.1_2 Reverse -197 -211 12.192 0.271
NP_442402.1_4 Reverse -94 -113 -0.492971 0.189
NP_442402.1_10 Reverse -304 -314 11.8776 0.231
NP_441084.1_6 Forward -53 -39 10.0228 0.255
NP_442039.1_4 Forward -131 -124 15.1821 0.0124
NP_442039.1_4 Reverse -124 -131 15.1821 0.0124
NP_442039.1_4 Reverse -321 -328 11.6422 0.0747
NP_440825.1_7 Reverse -124 -134 12.9096 0.152
NP_440825.1_7 Forward -131 -121 12.4217 0.155
NP_440825.1_7 Forward -328 -318 10.9578 0.278
NP_442837.1_3 Forward -131 -124 15.7721 0.0124
NP_442837.1_3 Reverse -124 -131 15.7721 0.0124
NP_442837.1_3 Reverse -302 -309 6.43063 0.212
NP_442837.1_3 Forward -328 -321 6.0373 0.25
NP_442837.1_3 Reverse -321 -328 6.0373 0.25
NP_442053.1_1 Forward -132 -123 18.3876 0.0007
NP_442053.1_1 Reverse -123 -132 18.3876 0.0007
NP_442053.1_1 Forward -329 -320 14.4544 0.0114
NP_442053.1_1 Reverse -320 -329 7.86621 0.0863
NP_440505.1_3 Forward -134 -124 9.22315 0.122
NP_440505.1_3 Reverse -318 -328 7.64985 0.151
NP_440505.1_3 Reverse -121 -131 6.76487 0.169
NP_441959.1_5 Reverse -48 -67 5.99764 0.271
NP_440013.1_2 Forward -139 -125 13.5693 0.294
NP_442532.1_7 Forward -132 -118 3.63784 0.192
NP_440914.1_1 Reverse -123 -133 17.5935 0.000537
NP_440914.1_1 Forward -329 -319 13.1043 0.0386
NP_440914.1_1 Forward -132 -122 8.6151 0.186
NP_441011.1_8 Forward -131 -122 16.9127 0.00602
NP_441011.1_8 Reverse -321 -330 11.7994 0.0629
NP_441011.1_8 Forward -359 -350 9.14451 0.135
NP_441011.1_8 Reverse -124 -133 8.25953 0.144
NP_442533.1_6 Forward -132 -123 17.2076 0.00137
NP_442533.1_6 Reverse -123 -132 17.2076 0.00137
NP_442533.1_6 Forward -329 -320 4.42462 0.179
NP_440661.1_6 Reverse -328 -347 9.14423 0.143
NP_442322.1_4 Forward -276 -259 -7.23831 0.279
NP_442229.1_1 Forward -134 -120 8.84875 0.184
NP_441219.1_6 Reverse -253 -271 9.55725 0.274
NP_441482.1_7 Forward -138 -124 -1.18038 0.0637
NP_441482.1_7 Reverse -117 -131 -3.04867 0.106
NP_441482.1_7 Reverse -314 -328 -8.75187 0.193
NP_439944.1_9 Reverse -124 -134 10.5014 0.0887
NP_440116.1_5 Reverse -317 -334 8.39697 0.155
NP_440116.1_8 Reverse -124 -143 10.5209 0.0295
NP_440116.1_8 Forward -328 -309 -9.83364 0.29
NP_440115.1_6 Forward -27 -17 11.0914 0.115
NP_440115.1_6 Reverse -317 -327 9.32148 0.115
NP_443045.1_5 Reverse -290 -303 13.9463 0.275
NP_441170.1_4 Forward -141 -123 3.55906 0.275
NP_441972.1_5 Forward -340 -321 -2.85214 0.192
NP_441972.1_5 Reverse -124 -143 -7.37537 0.248
NP_441106.1_1 Reverse -122 -131 18.191 0.0028
NP_441106.1_1 Forward -133 -124 9.63616 0.0311
NP_442588.1_6 Forward -326 -307 13.1758 0.127
NP_441286.1_1 Forward -133 -121 6.03717 0.0258
NP_441286.1_1 Reverse -122 -134 3.38223 0.0467
NP_441286.1_1 Reverse -319 -331 -4.38592 0.156
NP_440670.1_8 Forward -132 -123 18.3876 0.000699
NP_440670.1_8 Reverse -123 -132 18.3876 0.000699
NP_440670.1_8 Reverse -320 -329 8.75118 0.0606
NP_440670.1_8 Forward -329 -320 6.19458 0.124
NP_440886.1_7 Reverse -122 -132 17.7774 0.0011
NP_440886.1_7 Forward -330 -320 16.4991 0.0104
NP_440886.1_7 Forward -133 -123 7.94438 0.0805
NP_442382.1_7 Reverse -307 -326 16.0274 0.0705
NP_442717.1_2 Forward -84 -65 2.45773 0.18
NP_441399.1_6 Reverse -276 -295 12.4867 0.211
NP_442072.1_9 Forward -133 -115 -23.482 0.297
NP_440907.2_8 Forward -131 -121 14.2375 0.0312
NP_440907.2_8 Reverse -124 -134 7.64939 0.117
NP_440907.2_8 Forward -328 -318 5.87944 0.184
NP_440841.1_4 Reverse -121 -140 -6.58872 0.215
NP_441463.1_3 Forward -142 -123 0.786102 0.13
NP_441463.1_3 Forward -370 -351 -1.7705 0.146
NP_441463.1_3 Reverse -113 -132 -5.21209 0.222
NP_441463.1_3 Reverse -322 -341 -10.0303 0.288
NP_441626.1_2 Forward -131 -124 15.7721 0.0124
NP_441626.1_2 Reverse -124 -131 15.7721 0.0124
NP_441626.1_2 Reverse -321 -328 12.2322 0.0511
NP_441626.1_2 Forward -328 -321 5.93897 0.231
NP_441901.1_1 Forward -294 -275 2.65439 0.218
NP_442794.1_1 Reverse -316 -328 12.232 0.0721
NP_442794.1_1 Forward -136 -124 9.38042 0.0795
NP_442794.1_1 Reverse -250 -262 6.52882 0.172
NP_442615.1_1 Forward -141 -123 7.19731 0.0324
NP_442615.1_1 Reverse -114 -132 6.90232 0.0335
NP_441962.1_1 Forward -391 -372 -0.983855 0.198
NP_441962.1_4 Forward -137 -118 -6.78538 0.181
NP_440387.1_1 Forward -132 -116 6.35172 0.0282
NP_440387.1_1 Reverse -123 -139 4.0901 0.0471
NP_441431.1_2 Forward -332 -318 13.8636 0.0784
NP_441431.1_2 Reverse -120 -134 8.16044 0.222
NP_441488.1_8 Reverse -315 -329 21.1401 0.0068
NP_441836.1_2 Forward -112 -93 1.57275 0.191
NP_441993.1_1 Reverse -264 -283 5.45515 0.201
NP_441993.1_1 Forward -138 -119 2.43397 0.259
NP_442224.1_1 Reverse -373 -392 -4.72043 0.236
NP_440358.1_8 Reverse -142 -161 -0.983855 0.274
NP_440114.1_10 Forward -132 -118 11.406 0.115
NP_440114.1_10 Reverse -123 -137 7.9644 0.219
NP_442437.1_3 Forward -327 -308 9.24175 0.295
NP_440293.1_9 Forward -290 -276 16.8524 0.137
NP_440766.1_4 Reverse -316 -330 12.8809 0.0431
NP_441237.1_9 Reverse -124 -134 14.828 0.0242
NP_441246.1_1 Forward -213 -194 0.491109 0.202
NP_439910.1_2 Reverse -115 -132 -13.4325 0.162
NP_440457.1_1 Reverse -316 -328 1.80894 0.223
NP_440798.1_6 Forward -131 -118 4.54251 0.145
NP_441801.1_4 Forward -300 -290 12.4681 0.201
NP_440801.1_8 Reverse -122 -141 5.60432 0.192
NP_440473.1_3 Forward -296 -277 15.8307 0.248
NP_442509.1_9 Forward -132 -122 16.2041 0.00739
NP_442509.1_9 Reverse -320 -330 11.9759 0.107
NP_442509.1_9 Reverse -59 -69 8.3377 0.192
NP_442509.1_9 Reverse -123 -133 8.14104 0.192
NP_442509.1_9 Forward -304 -294 7.45273 0.219
NP_442587.1_9 Reverse -142 -155 12.2123 0.232
NP_440734.1_9 Forward -279 -260 10.0292 0.282
NP_440554.1_4 Forward -131 -121 7.35486 0.103
NP_441885.1_5 Reverse -123 -133 20.9245 0.000538
NP_441885.1_5 Forward -132 -122 11.4848 0.00668
NP_441885.1_5 Forward -329 -319 1.25834 0.11
NP_441885.1_5 Reverse -320 -330 0.0783647 0.183
NP_440478.1_10 Reverse -121 -135 8.75105 0.257
NP_440898.1_5 Forward -147 -128 8.55425 0.279
NP_442341.1_7 Forward -133 -119 9.34103 0.0751
NP_442341.1_7 Reverse -122 -136 7.66941 0.0994
NP_442341.1_7 Forward -330 -316 6.29277 0.13
NP_442341.1_9 Forward -331 -317 14.2569 0.0695
NP_442341.1_9 Reverse -121 -135 8.65209 0.166
NP_443000.1_3 Forward -56 -37 12.589 0.248
NP_443000.1_7 Forward -134 -124 10.3048 0.0345
NP_443000.1_7 Reverse -121 -131 1.94665 0.226
NP_443000.1_7 Reverse -318 -328 0.57002 0.294
NP_440507.2_3 Forward -141 -122 10.815 0.2
NP_440275.1_3 Reverse -121 -131 8.33817 0.0602
NP_440275.1_3 Forward -134 -124 8.04317 0.0602
NP_440275.1_3 Reverse -318 -328 5.48657 0.145
NP_442932.1_9 Forward -112 -93 5.80098 0.266
NP_440091.1_1 Reverse -119 -131 1.41561 0.197
NP_440091.1_1 Forward -136 -124 -0.452677 0.273
NP_441902.1_3 Forward -237 -227 15.0224 0.205
NP_440679.1_10 Reverse -374 -393 -15.9302 0.25
NP_440149.1_8 Reverse -123 -142 8.06259 0.0618
NP_441105.1_3 Reverse -112 -131 -5.11376 0.213
NP_441105.1_3 Reverse -243 -262 -6.39206 0.234
NP_441105.1_3 Forward -143 -124 -8.94866 0.281
NP_440216.1_1 Forward -132 -118 5.40779 0.0209
NP_440216.1_1 Reverse -123 -137 -2.75368 0.0574
NP_440216.1_1 Reverse -320 -334 -11.2101 0.169
NP_440216.1_9 Forward -261 -252 7.17789 0.286
NP_440172.1_1 Reverse -123 -133 15.0247 0.00945
NP_440172.1_1 Forward -132 -122 8.73149 0.0586
NP_440172.1_1 Forward -329 -319 2.24165 0.279
NP_442015.1_10 Forward -333 -320 3.26421 0.184
NP_442015.1_10 Reverse -119 -132 1.78924 0.204
NP_442015.1_10 Forward -136 -123 1.49425 0.204
NP_442015.1_10 Reverse -297 -310 1.10092 0.213
NP_442015.1_10 Reverse -316 -329 0.60927 0.221
NP_441226.1_7 Forward -131 -124 14.4934 0.0123
NP_441226.1_7 Reverse -124 -131 14.4934 0.0123
NP_441226.1_7 Reverse -321 -328 12.7234 0.0312
NP_441226.1_7 Forward -328 -321 11.5435 0.0757
NP_441226.1_7 Reverse -60 -67 5.64364 0.286
NP_441111.1_7 Forward -131 -123 18.7023 0.00294
NP_441111.1_7 Reverse -124 -132 18.7023 0.00294
NP_441111.1_7 Forward -328 -320 8.86921 0.0589
NP_441766.1_2 Forward -132 -123 17.5026 0.00297
NP_441766.1_2 Reverse -123 -132 17.5026 0.00297
NP_441766.1_2 Forward -329 -320 14.7494 0.00772
NP_442417.1_5 Forward -132 -118 10.6193 0.11
NP_442179.1_3 Forward -303 -284 12.0942 0.163
NP_440416.1_9 Forward -139 -120 -17.2085 0.234
NP_440416.1_9 Reverse -247 -266 -17.6018 0.243
NP_440416.1_9 Reverse -313 -332 -18.1918 0.253
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATTAATTGCCGCCATGCCAGTGAAGGACACCATCAAAATAGTTAACGCTGATGGTTGGATCACTGACACCCCCGATCGCCAAGGATTGTGGGGAGCCCAAACGCCCCAGGGTTTTGACGTGGCCCTGCTCAAAGCCTGCCATGACAAAGGTAAACAGGAAGGTTGGGAAGTAACGGATGATGCGGCCCTGCTGGAAAAATGTGGGCAACCCGTGAAAATAGTGCCAGGGGAAGATACTAACTTGAAAATTACCACCCCCGTAGATTTGGCGATCGCCGAATTTATTTTGGGGCAGAGGTCGGCAAAATCCGCCTGAAAATAGGCAAATTTCGGGGTTCGGAAAGATCAAGCTAGGATGGAAGGGACTTTGAGCCTAGCAATCCAAGGAGACTTTTATCC

CDS

ATGACCGTTAGTGAGATTCATATTCCTAACTCTTTACTAGACCGGGATTGCACCACCCTTTCACGCCACGTACTCCAACAACTGAATAGCTTTGGGGCCGATGCCCAGGATTTGAGTGCCATCATGAACCGCATTGCCCTAGCGGGAAAACTGATTGCCCGTCGCCTGAGTCGAGCTGGGTTAATGGCCGATGTGTTGGGCTTCACTGGGGAAACCAACGTCCAGGGGGAATCGGTGAAAAAAATGGACGTATTTGCCAATGATGTTTTTATTTCTGTCTTTAAGCAAAGTGGCTTGGTTTGTCGTCTGGCTTCGGAGGAGATGGAAAAACCCTACTATATTCCTGAAAATTGCCCCATTGGTCGCTATACTTTGCTGTACGACCCCATTGATGGTTCCTCCAACGTGGACATTAACCTCAACGTGGGTTCCATTTTTGCCATTCGGCAACAGGAAGGGGACGATCTAGACGGCAGTGCGTCAGATTTATTGGCTAACGGAGACAAGCAAATTGCTGCTGGTTATATCCTCTACGGCCCCTCCACCATCCTGGTTTATTCCCTCGGCTCCGGAGTGCATAGCTTTATCCTCGATCCCAGTTTGGGGGAATTTATTTTAGCCCAGGAAAATATCCGCATTCCCAACCACGGCCCCATTTACAGCACCAATGAAGGTAACTTTTGGCAATGGGATGAAGCCCTGAGGGATTACACCCGTTACGTCCATCGCCACGAAGGTTACACTGCCCGTTATAGCGGTGCTCTGGTGGGGGATATTCACCGGATTTTGATGCAAGGGGGAGTGTTTCTTTATCCTGGTACGGAAAAAAATCCCGACGGCAAATTGCGTTTGCTCTATGAAACTGCGCCGCTGGCCTTTTTGGTGGAACAGGCTGGGGGAAGGGCTAGTGACGGCCAAAAACGTTTACTGGACTTAATTCCTTCTAAATTACATCAGCGTACCCCCGCCATTATTGGCAGCGCAGAAGATGTGAAATTGGTGGAATCTTTCATCAGCGACCACAAACAACGGCAGGGTAATTAG

Protein

MTVSEIHIPNSLLDRDCTTLSRHVLQQLNSFGADAQDLSAIMNRIALAGKLIARRLSRAGLMADVLGFTGETNVQGESVKKMDVFANDVFISVFKQSGLVCRLASEEMEKPYYIPENCPIGRYTLLYDPIDGSSNVDINLNVGSIFAIRQQEGDDLDGSASDLLANGDKQIAAGYILYGPSTILVYSLGSGVHSFILDPSLGEFILAQENIRIPNHGPIYSTNEGNFWQWDEALRDYTRYVHRHEGYTARYSGALVGDIHRILMQGGVFLYPGTEKNPDGKLRLLYETAPLAFLVEQAGGRASDGQKRLLDLIPSKLHQRTPAIIGSAEDVKLVESFISDHKQRQGN