Your browser is old and dusty. Try Google Chrome!

Details for slr0946

ORF slr0946
Accession NP_441727.1
Symbol arsC
Category Drug and analog sensitivity
Definition arsenate reductase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -136 -122 7.66941 0.1
NP_441418.1_6 Forward -137 -118 -28.7132 0.208
NP_441418.1_6 Forward -204 -185 -29.5982 0.23
NP_440897.1_6 Reverse -203 -222 -3.83621 0.257
NP_441453.1_4 Forward -137 -129 14.8674 0.00947
NP_441453.1_4 Reverse -128 -136 6.80426 0.121
NP_441818.1_1 Forward -136 -125 12.2512 0.135
NP_441098.1_3 Reverse -28 -47 -3.72644 0.28
NP_442655.1_10 Forward -204 -185 -10.7186 0.221
NP_442173.1_1 Reverse -129 -137 13.8841 0.0225
NP_442173.1_1 Forward -136 -128 12.0158 0.0316
NP_442752.1_4 Reverse -128 -135 13.8055 0.0199
NP_442752.1_4 Forward -372 -365 7.6106 0.151
NP_442975.1_10 Forward -78 -64 4.32555 0.245
NP_440784.1_7 Reverse -129 -136 6.23397 0.241
NP_440784.1_7 Forward -136 -129 6.13563 0.241
NP_440784.1_8 Reverse -358 -377 17.0107 0.272
NP_440061.1_9 Reverse -193 -207 8.16044 0.18
NP_442062.1_8 Forward -137 -127 5.09324 0.184
NP_441859.1_3 Forward -68 -49 3.24359 0.246
NP_439918.1_2 Reverse -377 -396 -4.42544 0.277
NP_439918.1_3 Forward -204 -185 3.6377 0.266
NP_441352.1_2 Forward -202 -183 0.392778 0.268
NP_440856.1_7 Forward -207 -188 1.67108 0.161
NP_440856.1_7 Reverse -363 -382 -2.36049 0.191
NP_441083.1_5 Forward -137 -127 9.81313 0.0224
NP_441083.1_5 Reverse -128 -138 -1.10161 0.295
NP_441434.1_3 Reverse -79 -98 10.1275 0.16
NP_441571.1_9 Forward -356 -337 19.4681 0.193
NP_441738.1_2 Forward -135 -128 15.28 0.0102
NP_441942.1_6 Forward -202 -183 23.0341 0.0363
NP_440209.1_1 Reverse -128 -136 8.57422 0.0425
NP_442889.1_8 Forward -140 -126 3.04726 0.291
NP_441713.1_1 Forward -273 -254 -11.4069 0.226
NP_442570.1_3 Reverse -374 -393 -1.37718 0.212
NP_442461.1_2 Reverse -63 -82 17.404 0.216
NP_442111.1_4 Forward -138 -124 6.09611 0.138
NP_440906.1_5 Reverse -129 -136 6.23397 0.234
NP_440906.1_5 Forward -136 -129 6.13563 0.241
NP_440747.1_10 Reverse -125 -137 -12.1541 0.227
NP_441486.1_1 Reverse -125 -139 -2.36035 0.175
NP_441486.1_1 Reverse -89 -103 -3.24533 0.177
NP_441014.1_2 Reverse -98 -117 15.5357 0.245
NP_442848.1_1 Reverse -122 -136 -1.77037 0.263
NP_442848.1_9 Reverse -148 -167 2.65439 0.248
NP_441012.1_4 Forward -390 -377 8.47575 0.272
NP_443018.1_3 Forward -136 -129 11.7405 0.0655
NP_443018.1_3 Reverse -129 -136 5.44732 0.193
NP_440376.1_1 Reverse -128 -137 5.89959 0.116
NP_440376.1_1 Reverse -347 -356 4.91628 0.147
NP_440376.1_1 Forward -137 -128 -0.0986038 0.285
NP_441588.1_4 Forward -135 -125 6.37155 0.2
NP_441588.1_4 Forward -99 -89 6.37155 0.2
NP_442687.1_7 Reverse -127 -137 5.68323 0.189
NP_441077.1_6 Forward -120 -104 9.45394 0.172
NP_441846.1_10 Forward -213 -194 -22.715 0.264
NP_440533.1_9 Reverse -366 -385 9.63589 0.147
NP_441763.1_10 Forward -78 -59 8.35677 0.218
NP_440360.1_10 Reverse -188 -202 4.03116 0.227
NP_441414.1_9 Reverse -128 -147 -8.94866 0.249
NP_441256.1_1 Forward -330 -311 -6.09707 0.239
NP_439959.1_4 Forward -372 -353 16.7157 0.283
NP_441958.1_5 Reverse -127 -137 8.73149 0.0255
NP_441958.1_5 Forward -138 -128 1.65166 0.0872
NP_442486.1_6 Forward -342 -323 -2.85214 0.266
NP_442836.1_5 Forward -362 -343 15.4374 0.0586
NP_442690.1_1 Reverse -36 -55 -9.53865 0.201
NP_440138.1_6 Forward -136 -117 5.01354 0.23
NP_440138.1_6 Forward -225 -206 2.75194 0.261
NP_442002.1_1 Reverse -374 -392 -9.22396 0.274
NP_440809.1_9 Forward -146 -128 1.29745 0.128
NP_441294.1_7 Reverse -254 -268 11.0744 0.157
NP_442431.1_10 Reverse -321 -339 5.72234 0.197
NP_440147.1_4 Forward -139 -126 1.00259 0.242
NP_441550.1_8 Reverse -126 -136 11.091 0.0555
NP_441550.1_8 Forward -139 -129 9.51767 0.0926
NP_441916.1_7 Reverse -128 -138 7.15819 0.0745
NP_441916.1_7 Forward -137 -127 1.35667 0.286
NP_441041.1_7 Forward -359 -347 7.12607 0.176
NP_441547.1_2 Reverse -117 -135 16.9321 0.0911
NP_440703.1_9 Forward -114 -101 5.32859 0.293
NP_441725.1_5 Forward -136 -126 1.455 0.135
NP_439966.1_7 Reverse -126 -136 6.0761 0.195
NP_442941.1_3 Forward -136 -126 10.1081 0.024
NP_442941.1_3 Reverse -129 -139 -1.19994 0.288
NP_440674.1_3 Reverse -378 -397 3.73603 0.26
NP_442281.1_1 Forward -142 -128 7.86545 0.0907
NP_440437.1_1 Reverse -357 -376 -4.52377 0.261
NP_440437.1_1 Forward -395 -376 -5.11376 0.274
NP_441644.1_6 Forward -137 -127 14.7292 0.0105
NP_442215.1_2 Forward -335 -319 2.02515 0.123
NP_442215.1_2 Forward -110 -94 -4.66135 0.237
NP_440253.1_2 Forward -137 -119 2.18243 0.142
NP_440929.1_8 Forward -137 -128 7.17789 0.0713
NP_442933.1_10 Forward -137 -128 8.06287 0.0885
NP_442933.1_10 Reverse -128 -137 7.96454 0.0937
NP_442554.1_8 Forward -136 -126 6.07655 0.126
NP_442554.1_8 Reverse -129 -139 4.40493 0.188
NP_441586.1_3 Forward -203 -184 11.0125 0.172
NP_442142.1_4 Forward -237 -224 5.91857 0.178
NP_442292.1_1 Forward -136 -127 8.65285 0.0335
NP_441711.1_4 Reverse -200 -219 6.29264 0.154
NP_443009.1_5 Forward -228 -217 3.79477 0.278
NP_443009.1_5 Reverse -127 -138 3.69644 0.282
NP_442408.2_1 Forward -326 -307 -4.22878 0.256
NP_441715.1_4 Forward -136 -126 4.99491 0.24
NP_441448.1_2 Reverse -297 -316 8.84842 0.131
NP_441758.1_4 Forward -315 -296 17.3057 0.221
NP_441468.1_1 Reverse -129 -136 6.13563 0.209
NP_441468.1_1 Forward -136 -129 6.0373 0.223
NP_441015.1_10 Forward -203 -184 -0.688862 0.169
NP_441673.1_1 Forward -137 -128 1.27803 0.155
NP_441673.1_1 Reverse -128 -137 1.27803 0.155
NP_441731.1_3 Reverse -120 -139 -6.39206 0.29
NP_441731.1_7 Reverse -149 -168 10.5209 0.147
NP_441826.1_2 Forward -137 -123 0.589577 0.18
NP_442490.1_9 Reverse -116 -135 -2.75381 0.217
NP_441764.1_8 Forward -121 -111 13.8947 0.284
NP_442868.1_6 Reverse -126 -136 0.176696 0.247
NP_441251.1_2 Reverse -29 -47 9.65558 0.262
NP_441612.1_2 Reverse -79 -89 14.9389 0.21
NP_442227.1_2 Reverse -188 -207 5.40766 0.202
NP_442361.1_3 Reverse -122 -135 8.86907 0.285
NP_442427.1_8 Forward -146 -127 8.65258 0.196
NP_442427.1_8 Reverse -49 -68 6.98095 0.224
NP_442808.1_1 Reverse -362 -372 2.92952 0.252
NP_440145.1_3 Reverse -337 -356 -5.31042 0.264
NP_442050.1_5 Reverse -126 -136 6.76441 0.282
NP_440558.1_2 Forward -270 -251 -6.1954 0.272
NP_441878.1_6 Forward -205 -195 -7.19813 0.21
NP_441036.1_8 Forward -138 -128 6.07655 0.242
NP_441557.1_5 Reverse -128 -137 8.94785 0.0289
NP_441557.1_5 Forward -137 -128 0.688044 0.128
NP_442066.2_9 Forward -360 -347 11.524 0.154
NP_442183.1_1 Forward -137 -123 7.47274 0.141
NP_442347.1_2 Forward -136 -127 10.3245 0.058
NP_442645.1_2 Reverse -339 -358 -21.83 0.29
NP_442594.1_8 Forward -149 -130 5.50599 0.247
NP_441633.1_3 Forward -69 -56 -5.58558 0.236
NP_440136.1_1 Forward -98 -82 10.9726 0.238
NP_440136.1_2 Reverse -129 -136 6.23397 0.171
NP_440136.1_2 Forward -136 -129 6.13563 0.193
NP_442590.1_10 Reverse -370 -389 13.6675 0.134
NP_442590.1_10 Reverse -251 -270 8.06259 0.215
NP_442998.1_10 Forward -135 -128 15.5754 0.0102
NP_440299.1_1 Reverse -124 -137 13.2934 0.0319
NP_441799.1_1 Forward -141 -127 12.2903 0.0441
NP_440640.1_6 Forward -107 -88 0.491109 0.272
NP_441007.1_10 Forward -200 -187 0.805932 0.216
NP_440256.1_1 Forward -140 -121 -7.57203 0.24
NP_440256.1_1 Reverse -125 -144 -9.34199 0.278
NP_440915.1_6 Reverse -124 -138 3.14618 0.107
NP_440915.1_6 Forward -271 -257 0.88457 0.151
NP_441464.1_2 Reverse -362 -372 15.713 0.247
NP_442993.1_1 Reverse -92 -108 -8.2996 0.161
NP_442993.1_1 Forward -304 -288 -9.5779 0.188
NP_442993.1_1 Reverse -347 -363 -10.8562 0.229
NP_440677.1_6 Reverse -119 -138 7.37428 0.298
NP_441750.1_1 Forward -204 -185 -11.0136 0.3
NP_441340.1_5 Reverse -129 -136 13.5105 0.0314
NP_441340.1_5 Forward -136 -129 5.84064 0.208
NP_440168.1_9 Forward -206 -187 -0.295539 0.273
NP_440586.1_8 Forward -136 -129 9.47853 0.146
NP_440586.1_8 Reverse -129 -136 5.74197 0.283
NP_440192.1_5 Forward -322 -303 4.71934 0.247
NP_441262.1_3 Reverse -128 -135 14.7888 0.0223
NP_443051.1_1 Reverse -127 -136 7.47288 0.0571
NP_443051.1_1 Forward -138 -129 0.393051 0.169
NP_439996.1_6 Reverse -317 -336 12.5778 0.172
NP_442294.1_3 Forward -94 -80 14.8469 0.215
NP_440439.1_1 Reverse -125 -138 -1.849 0.285
NP_442239.1_8 Reverse -371 -390 6.19431 0.266
NP_440372.1_2 Reverse -129 -136 13.8055 0.0214
NP_440372.1_2 Forward -136 -129 6.52896 0.188
NP_440271.1_2 Forward -371 -352 8.16093 0.23
NP_441789.1_7 Forward -289 -270 -0.29631 0.251
NP_441789.1_7 Forward -235 -216 -4.52452 0.283
NP_440819.1_5 Reverse -79 -87 7.59091 0.272
NP_440316.1_10 Reverse -382 -392 5.87989 0.277
NP_442384.1_10 Forward -137 -124 14.0806 0.0169
NP_442384.1_10 Reverse -99 -112 1.10092 0.268
NP_440948.1_7 Forward -382 -363 14.4541 0.286
NP_442790.1_4 Reverse -119 -138 -6.78538 0.146
NP_442262.1_10 Forward -136 -129 13.2155 0.0213
NP_441689.1_5 Reverse -126 -136 12.7626 0.113
NP_441689.1_5 Forward -139 -129 8.3377 0.132
NP_440163.1_10 Reverse -125 -135 10.4031 0.201
NP_441965.1_10 Reverse -380 -396 5.56507 0.203
NP_441640.1_8 Forward -136 -117 2.3594 0.158
NP_440297.1_9 Forward -136 -126 -0.511621 0.289
NP_440999.1_5 Reverse -226 -245 5.01354 0.291
NP_440999.1_9 Reverse -353 -367 -3.34366 0.291
NP_440888.1_2 Forward -137 -123 14.6503 0.0162
NP_440600.1_4 Forward -145 -127 -0.0791831 0.146
NP_441543.1_2 Forward -136 -127 7.07956 0.131
NP_442845.1_2 Reverse -122 -136 6.19444 0.215
NP_442845.1_2 Reverse -377 -391 5.1128 0.243
NP_440089.1_1 Forward -205 -187 12.4089 0.3
NP_441304.1_10 Reverse -215 -224 12.8811 0.276
NP_441319.1_8 Reverse -122 -140 6.41066 0.27
NP_442315.1_1 Reverse -322 -340 15.2604 0.095
NP_442315.1_2 Reverse -277 -289 13.707 0.291
NP_442578.1_7 Reverse -129 -136 6.0373 0.18
NP_441462.1_2 Reverse -128 -138 17.4829 0.00406
NP_443062.1_1 Reverse -128 -146 7.76586 0.168
NP_442204.1_1 Reverse -124 -135 0.255333 0.282
NP_440516.1_8 Reverse -128 -137 9.4395 0.0183
NP_440516.1_8 Forward -137 -128 5.11294 0.118
NP_442428.1_5 Reverse -129 -136 6.13563 0.209
NP_442428.1_5 Forward -136 -129 6.0373 0.212
NP_441664.1_1 Reverse -178 -197 13.9616 0.124
NP_440673.1_3 Forward -135 -128 12.4288 0.0426
NP_441052.1_2 Forward -333 -323 2.7333 0.193
NP_441052.1_2 Forward -137 -127 1.65166 0.233
NP_442219.1_9 Forward -136 -127 7.96454 0.0696
NP_440436.1_4 Forward -136 -127 7.57079 0.124
NP_440436.1_4 Forward -290 -281 4.81753 0.239
NP_441884.1_9 Forward -388 -369 -19.8634 0.161
NP_442412.1_5 Forward -168 -149 2.75272 0.294
NP_442864.1_3 Forward -218 -199 13.1758 0.166
NP_442414.1_8 Forward -397 -378 6.98095 0.293
NP_440041.1_2 Reverse -376 -395 9.14423 0.0623
NP_441719.1_4 Reverse -129 -136 6.82395 0.0855
NP_441719.1_4 Forward -136 -129 6.52896 0.188
NP_442366.1_3 Reverse -91 -109 0.412472 0.172
NP_442366.1_3 Forward -138 -120 -3.12744 0.242
NP_442366.1_3 Forward -274 -256 -5.19239 0.284
NP_440129.1_10 Reverse -121 -135 7.17775 0.177
NP_440296.1_4 Forward -100 -81 18.1666 0.183
NP_442206.1_10 Reverse -128 -143 10.5013 0.125
NP_441851.1_9 Forward -207 -188 8.55425 0.263
NP_441851.1_10 Reverse -216 -226 11.2881 0.0765
NP_441851.1_10 Reverse -127 -137 7.35486 0.142
NP_442011.1_1 Reverse -127 -146 2.0644 0.256
NP_442515.1_1 Forward -336 -322 1.76955 0.149
NP_442515.1_1 Reverse -346 -360 0.589577 0.187
NP_441396.1_5 Reverse -210 -219 7.47288 0.252
NP_440593.1_3 Forward -278 -259 -6.58872 0.278
NP_440355.1_1 Forward -289 -270 14.9449 0.203
NP_442944.1_1 Reverse -55 -74 13.0775 0.17
NP_440933.1_5 Forward -395 -377 21.4545 0.146
NP_440195.1_4 Forward -113 -94 13.5691 0.127
NP_442006.1_2 Reverse -383 -400 -15.8908 0.23
NP_442006.1_2 Forward -267 -250 -15.9891 0.235
NP_442006.1_2 Forward -381 -364 -16.1858 0.243
NP_441078.1_4 Reverse -128 -137 0.0980582 0.205
NP_441078.1_4 Forward -137 -128 0.0980582 0.205
NP_441078.1_4 Forward -356 -347 -1.6719 0.266
NP_442729.1_5 Forward -157 -147 8.1415 0.248
NP_440707.1_9 Forward -206 -187 11.1109 0.198
NP_442443.1_1 Forward -203 -184 -2.75381 0.262
NP_441432.1_8 Reverse -127 -136 14.0611 0.0258
NP_441432.1_8 Forward -268 -259 3.34298 0.248
NP_442320.1_8 Reverse -122 -136 2.16287 0.079
NP_441131.1_9 Reverse -369 -388 8.25926 0.269
NP_440199.1_10 Reverse -125 -135 7.64985 0.231
NP_441945.1_10 Forward -163 -144 6.68596 0.297
NP_440913.1_1 Reverse -316 -334 7.29564 0.206
NP_442489.1_7 Forward -137 -128 0.786375 0.152
NP_442489.1_7 Reverse -128 -137 0.589713 0.17
NP_442489.1_7 Forward -356 -347 -1.6719 0.235
NP_440559.1_1 Forward -136 -127 7.76787 0.0918
NP_440559.1_1 Reverse -129 -138 5.99792 0.135
NP_441659.2_8 Forward -137 -127 12.7631 0.0147
NP_441659.2_8 Reverse -128 -138 1.74999 0.227
NP_440860.1_8 Reverse -56 -75 14.1591 0.296
NP_442913.1_10 Reverse -338 -357 -4.13045 0.227
NP_442346.1_5 Reverse -127 -137 7.05986 0.183
NP_442346.1_5 Forward -138 -128 4.3066 0.291
NP_441856.1_3 Reverse -268 -287 1.67108 0.212
NP_441629.1_3 Forward -247 -228 -0.886293 0.25
NP_440010.1_4 Reverse -199 -218 -3.04956 0.294
NP_440010.1_10 Reverse -315 -334 3.83436 0.25
NP_442603.1_7 Forward -137 -123 11.4053 0.117
NP_442603.1_7 Reverse -203 -217 7.3738 0.208
NP_441833.1_4 Forward -136 -129 6.52896 0.0924
NP_441833.1_4 Reverse -129 -136 6.23397 0.163
NP_442162.1_9 Forward -136 -129 12.9205 0.0282
NP_442162.1_9 Reverse -129 -136 12.9205 0.0282
NP_440671.1_4 Forward -107 -93 5.1128 0.292
NP_442045.1_5 Forward -286 -267 -2.85214 0.294
NP_442199.1_5 Forward -400 -381 -3.44213 0.206
NP_442140.1_3 Forward -100 -90 11.3864 0.0767
NP_442140.1_3 Forward -130 -120 5.19158 0.221
NP_441813.1_5 Reverse -126 -136 6.17489 0.1
NP_441813.1_5 Forward -139 -129 4.69992 0.148
NP_440590.1_4 Forward -136 -123 -5.88057 0.293
NP_440567.1_1 Reverse -129 -143 1.96621 0.188
NP_440567.1_1 Forward -136 -122 0.392915 0.246
NP_442497.1_10 Reverse -129 -138 5.99792 0.095
NP_442497.1_10 Forward -136 -127 0.589713 0.153
NP_440821.1_4 Reverse -126 -136 8.53483 0.0468
NP_440227.1_4 Reverse -19 -36 11.0512 0.28
NP_441239.1_9 Forward -139 -127 8.29878 0.137
NP_441239.1_9 Forward -394 -382 4.5622 0.251
NP_441239.1_9 Reverse -381 -393 3.87389 0.272
NP_441727.1_1 Forward -374 -355 18.879 0.104
NP_441727.1_2 Forward -203 -185 23.5203 0.0296
NP_441727.1_3 Forward -144 -125 18.6823 0.107
NP_441727.1_10 Forward -302 -283 26.8429 0.00158
NP_441017.1_6 Forward -105 -91 10.8154 0.298
NP_440949.1_7 Forward -226 -207 12.0933 0.214
NP_440546.1_4 Reverse -128 -138 16.1543 0.0459
NP_440546.1_4 Forward -101 -91 9.07643 0.156
NP_440546.1_4 Reverse -383 -393 8.20381 0.199
NP_440546.1_4 Forward -137 -127 8.20381 0.199
NP_440546.1_4 Reverse -370 -380 6.94336 0.269
NP_440462.1_6 Forward -139 -129 6.8632 0.0967
NP_441249.1_8 Forward -204 -185 2.55606 0.284
NP_440374.1_3 Forward -40 -22 13.3709 0.272
NP_442402.1_4 Reverse -141 -160 -8.26108 0.278
NP_442402.1_9 Forward -366 -347 8.94757 0.278
NP_441084.1_6 Forward -116 -102 13.5133 0.128
NP_442039.1_4 Reverse -129 -136 11.6422 0.0747
NP_442837.1_3 Forward -136 -129 6.0373 0.25
NP_442837.1_3 Reverse -129 -136 6.0373 0.25
NP_439994.1_3 Reverse -78 -97 12.9259 0.139
NP_442053.1_1 Forward -137 -128 7.17789 0.104
NP_440505.1_3 Reverse -126 -136 14.7297 0.0176
NP_440505.1_3 Forward -358 -348 7.15819 0.163
NP_441701.1_3 Reverse -374 -391 8.59364 0.247
NP_441408.2_7 Forward -122 -103 -4.81876 0.286
NP_440914.1_1 Forward -137 -127 14.373 0.0158
NP_440914.1_7 Reverse -29 -48 14.2756 0.18
NP_441011.1_8 Reverse -129 -138 14.356 0.0249
NP_441011.1_8 Forward -266 -257 5.21127 0.278
NP_442533.1_1 Forward -207 -188 -5.70374 0.155
NP_442533.1_6 Reverse -128 -137 5.40793 0.14
NP_442533.1_6 Forward -356 -347 4.62128 0.179
NP_442533.1_6 Forward -137 -128 4.52295 0.179
NP_440263.1_3 Reverse -265 -284 10.4225 0.22
NP_442322.1_1 Reverse -335 -354 25.023 0.00596
NP_442322.1_4 Forward -395 -378 -6.15667 0.275
NP_441482.1_7 Reverse -122 -136 -3.44199 0.124
NP_439944.1_9 Forward -136 -126 9.22315 0.1
NP_441028.1_6 Forward -223 -213 5.78111 0.243
NP_441028.1_6 Reverse -151 -161 5.48612 0.255
NP_440116.1_8 Reverse -129 -148 -8.16202 0.247
NP_441602.1_4 Forward -215 -196 9.24257 0.279
NP_442673.1_7 Forward -305 -286 12.1748 0.264
NP_441106.1_1 Forward -138 -129 7.96454 0.0647
NP_439903.1_6 Forward -140 -121 4.03023 0.203
NP_441286.1_1 Forward -138 -126 -7.04085 0.3
NP_440670.1_8 Reverse -128 -137 8.65285 0.0627
NP_440670.1_8 Forward -137 -128 6.29291 0.124
NP_440886.1_7 Reverse -194 -204 6.56775 0.118
NP_440886.1_7 Forward -219 -209 4.99446 0.205
NP_440828.1_4 Forward -337 -318 2.75194 0.152
NP_441021.1_1 Forward -136 -117 -12.6852 0.293
NP_440841.1_4 Reverse -126 -145 -8.55534 0.25
NP_441463.1_3 Reverse -118 -137 -10.0303 0.288
NP_442842.1_4 Reverse -99 -118 0.884433 0.299
NP_441626.1_2 Reverse -129 -136 12.2322 0.0511
NP_441626.1_2 Forward -136 -129 5.93897 0.231
NP_442794.1_1 Reverse -118 -130 13.707 0.0721
NP_442794.1_1 Reverse -124 -136 7.11881 0.148
NP_442794.1_1 Forward -246 -234 5.05386 0.236
NP_442615.1_1 Forward -146 -128 5.23069 0.0398
NP_441962.1_4 Reverse -342 -361 -15.1435 0.299
NP_440387.1_1 Forward -137 -121 -4.56302 0.19
NP_442020.1_1 Forward -187 -168 5.30853 0.236
NP_441836.1_1 Reverse -117 -136 20.0706 0.0206
NP_441836.1_2 Reverse -377 -396 2.26107 0.175
NP_441993.1_1 Reverse -265 -284 3.506 0.233
NP_440114.1_10 Reverse -128 -142 11.3077 0.118
NP_440766.1_4 Reverse -205 -219 8.94771 0.0871
NP_440766.1_4 Reverse -124 -138 3.63784 0.144
NP_441421.1_6 Forward -190 -173 10.4608 0.279
NP_442930.1_1 Forward -179 -169 11.9759 0.242
NP_442867.1_8 Forward -400 -381 3.83436 0.297
NP_440457.1_1 Reverse -124 -136 9.28209 0.0929
NP_442509.1_9 Reverse -346 -356 7.94438 0.195
NP_442587.1_9 Forward -152 -139 11.3273 0.297
NP_442514.1_5 Reverse -145 -164 -9.63771 0.297
NP_440554.1_4 Forward -136 -126 4.10993 0.201
NP_441885.1_5 Reverse -128 -138 7.84651 0.0419
NP_441885.1_5 Forward -137 -127 1.35667 0.11
NP_441885.1_5 Forward -356 -346 -0.609952 0.215
NP_440478.1_10 Forward -275 -261 7.07942 0.274
NP_442310.1_1 Reverse -97 -116 14.7491 0.153
NP_442341.1_7 Reverse -362 -376 7.37441 0.107
NP_442341.1_7 Reverse -346 -360 3.93283 0.208
NP_441756.1_5 Forward -207 -188 -4.42544 0.294
NP_443000.1_7 Reverse -126 -136 7.35486 0.0859
NP_441842.1_10 Reverse -121 -135 14.4542 0.0586
NP_440275.1_3 Reverse -126 -136 5.5849 0.14
NP_442932.1_9 Forward -192 -173 5.50599 0.266
NP_440679.1_10 Forward -202 -183 -14.4552 0.234
NP_442451.1_2 Reverse -368 -387 -8.65367 0.252
NP_442451.1_2 Forward -75 -56 -11.5053 0.296
NP_439962.1_4 Forward -400 -381 -4.81876 0.272
NP_440149.1_8 Forward -137 -118 -6.78538 0.261
NP_442373.1_2 Forward -207 -188 -4.91709 0.213
NP_440216.1_9 Reverse -334 -343 9.63616 0.286
NP_440172.1_1 Reverse -128 -138 10.1081 0.0551
NP_440172.1_1 Forward -137 -127 2.33998 0.279
NP_441226.1_7 Reverse -129 -136 12.7234 0.0312
NP_441226.1_7 Forward -136 -129 11.5435 0.0757
NP_441111.1_7 Forward -136 -128 8.86921 0.0589
NP_441766.1_2 Reverse -128 -137 8.1612 0.0645
NP_441766.1_2 Forward -137 -128 5.89959 0.103
NP_442417.1_5 Forward -137 -123 11.5043 0.0983
NP_440416.1_9 Reverse -121 -140 -17.7985 0.247
NP_443052.1_9 Reverse -188 -207 -3.54046 0.25
NP_443052.1_9 Reverse -146 -165 -4.52377 0.258
NP_440072.1_5 Forward -381 -363 -3.81576 0.285
NP_442154.1_1 Forward -206 -188 -6.07737 0.129
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCGTCCCACCCAGGGCCGCACCCTAGCGGTGATGCAGGTTAGTGGCGGTTCCCAATCTTTCAATGCCGTCAACACCATGCGCATTCTTGGTCGTTGGATGCGGATGTTTACCATTCCCAACCAATCATCCGTGGCTAAGGCGTATCAGGAATTCCATGAAGACGGCACCATGAAGGATTCCCCCTATCGAGACCGGGTGGTGGACGTGATGGAAGAACTATACAAATTCACCCTGCTACTGCGGGACAAGGTGGATTATTTAACCGATCGCCATAGTGAAAGAAAAGCTAAGGTCAACACCGATGGTTGATGTTTTTCCCACTGAAACTAACTCCAATCACTCCAATTTATTCCATCAATTAATTAATCAAACTAATTAATCTAAGCGAGGCTAAAACT

CDS

GTGAAAAAGGTAATGTTCGTTTGCAAACGTAATTCCTGTCGCTCCCAAATGGCAGAGGGCTTTGCCAAAACTTTAGGGGCCGGCAAAATTGCTGTTACCAGTTGTGGACTGGAATCTTCCCGGGTCCATCCCACCGCCATTGCCATGATGGAAGAAGTAGGCATAGACATCAGCGGCCAGACCTCCGACCCCATCGAAAACTTTAACGCCGACGATTACGACGTGGTAATTTCCCTTTGTGGCTGTGGGGTTAATCTGCCGCCGGAATGGGTAACCCAGGAAATTTTTGAAGACTGGCAACTGGAAGATCCCGATGGTCAATCATTGGAAGTTTTTCGCACCGTGCGGGGCCAGGTTAAGGAACGGGTGGAAAACCTGATCGCCAAAATTAGCTGA

Protein

MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS