Your browser is old and dusty. Try Google Chrome!

Details for slr0943

ORF slr0943
Accession NP_441723.1
Symbol fda
Category Glycolysis
Definition fructose-bisphosphate aldolase, class I
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -358 -372 12.8809 0.0441
NP_440795.1_7 Forward -365 -358 14.6904 0.0123
NP_440795.1_7 Reverse -358 -365 14.6904 0.0123
NP_441418.1_6 Forward -366 -347 -22.125 0.169
NP_442291.1_5 Forward -367 -351 -1.51476 0.199
NP_442291.1_7 Reverse -365 -379 20.1574 0.142
NP_442291.1_7 Forward -376 -362 19.5675 0.154
NP_441453.1_4 Reverse -357 -365 16.539 0.00633
NP_441453.1_4 Forward -366 -358 16.539 0.00633
NP_441453.1_7 Forward -378 -371 12.9205 0.23
NP_442151.1_6 Reverse -357 -371 9.73436 0.141
NP_441818.1_1 Reverse -358 -369 15.4961 0.0264
NP_440226.1_1 Forward -366 -347 10.8159 0.0588
NP_440150.1_6 Reverse -354 -373 1.86774 0.283
NP_440150.1_6 Forward -369 -350 1.17943 0.295
NP_442173.1_1 Forward -365 -357 15.4574 0.00633
NP_442173.1_1 Reverse -358 -366 15.4574 0.00633
NP_442752.1_4 Forward -366 -359 13.8055 0.0199
NP_442752.1_4 Reverse -357 -364 13.8055 0.0199
NP_443027.1_4 Forward -368 -358 11.0914 0.107
NP_441812.1_3 Reverse -177 -191 11.406 0.21
NP_440784.1_7 Forward -365 -358 15.9687 0.0123
NP_440784.1_7 Reverse -358 -365 15.9687 0.0123
NP_440061.1_9 Forward -368 -354 21.5334 0.00189
NP_440061.1_9 Reverse -355 -369 10.717 0.123
NP_440061.1_9 Reverse -73 -87 8.45543 0.174
NP_440878.1_9 Forward -376 -357 -2.36049 0.26
NP_442062.1_8 Forward -366 -356 17.6796 0.00193
NP_442062.1_8 Reverse -357 -367 17.3846 0.00193
NP_442062.1_8 Forward -301 -291 4.20827 0.228
NP_440304.1_4 Reverse -355 -365 9.91146 0.051
NP_440304.1_4 Reverse -134 -144 2.7333 0.299
NP_440304.1_4 Forward -368 -358 1.84832 0.299
NP_442242.1_4 Forward -365 -358 14.3954 0.0124
NP_442242.1_4 Reverse -358 -365 14.3954 0.0124
NP_441781.1_7 Reverse -357 -376 6.09597 0.186
NP_441723.1_1 Forward -316 -299 28.1615 0.000421
NP_441594.1_6 Forward -184 -165 0.884433 0.279
NP_441109.1_4 Reverse -75 -94 13.6675 0.283
NP_442110.1_7 Reverse -357 -371 1.76955 0.222
NP_440856.1_4 Reverse -350 -369 -5.50708 0.293
NP_441083.1_5 Reverse -357 -367 20.3345 0.00053
NP_441083.1_5 Forward -366 -356 19.3512 0.000718
NP_442827.1_8 Forward -374 -355 0.785326 0.196
NP_441978.1_1 Forward -255 -237 16.0471 0.298
NP_441434.1_7 Forward -364 -350 3.8345 0.225
NP_441738.1_2 Forward -364 -357 15.28 0.0102
NP_441738.1_2 Reverse -359 -366 15.28 0.0102
NP_441738.1_2 Reverse -294 -301 6.52862 0.261
NP_441558.1_5 Reverse -355 -374 11.3075 0.0828
NP_441558.1_5 Forward -368 -349 5.50599 0.247
NP_440209.1_1 Reverse -357 -365 18.1123 0.00295
NP_440209.1_1 Forward -366 -358 18.1123 0.00295
NP_442889.1_8 Reverse -354 -368 3.53891 0.275
NP_440178.1_7 Reverse -356 -375 -20.3551 0.188
NP_441716.1_1 Forward -366 -352 8.65272 0.137
NP_441716.1_1 Reverse -357 -371 3.8345 0.259
NP_442111.1_4 Forward -367 -353 20.7474 0.00264
NP_442111.1_4 Reverse -356 -370 10.9143 0.0518
NP_441624.1_7 Forward -378 -364 12.8809 0.191
NP_440906.1_5 Forward -365 -358 15.8704 0.0124
NP_440906.1_5 Reverse -358 -365 15.8704 0.0124
NP_440747.1_10 Reverse -354 -366 17.1486 0.000663
NP_440747.1_10 Forward -369 -357 16.7552 0.0019
NP_441130.1_10 Forward -368 -354 7.27608 0.164
NP_441130.1_10 Reverse -355 -369 6.6861 0.181
NP_441854.1_10 Forward -264 -245 9.53756 0.139
NP_442973.1_5 Forward -381 -362 9.83255 0.292
NP_441486.1_1 Forward -369 -355 -2.55701 0.175
NP_442634.1_4 Forward -368 -354 -1.37704 0.149
NP_442634.1_4 Reverse -355 -369 -3.147 0.161
NP_441265.1_3 Reverse -351 -365 14.2576 0.059
NP_441014.1_5 Reverse -359 -377 9.36059 0.276
NP_442848.1_1 Forward -372 -358 -1.5737 0.263
NP_442848.1_9 Forward -372 -353 -0.000545616 0.278
NP_442848.1_9 Reverse -262 -281 -1.18052 0.288
NP_443018.1_3 Forward -365 -358 14.8871 0.0123
NP_443018.1_3 Reverse -358 -365 14.8871 0.0123
NP_443018.1_3 Forward -153 -146 4.07068 0.299
NP_441634.1_8 Forward -303 -289 -0.197071 0.25
NP_441634.1_8 Forward -368 -354 -3.24533 0.295
NP_441634.1_9 Reverse -81 -100 7.96345 0.294
NP_440376.1_1 Forward -366 -357 19.4693 0.000692
NP_440376.1_1 Reverse -357 -366 19.4693 0.000692
NP_440376.1_1 Reverse -75 -84 1.47469 0.251
NP_441588.1_4 Reverse -359 -369 6.46988 0.193
NP_442730.1_8 Reverse -6 -25 12.585 0.15
NP_442687.1_7 Reverse -356 -366 18.5646 0.0028
NP_442687.1_7 Forward -367 -357 8.92815 0.0994
NP_442687.1_7 Reverse -165 -175 3.71661 0.292
NP_442191.1_4 Forward -94 -80 10.7022 0.288
NP_441388.1_10 Reverse -245 -262 12.7232 0.293
NP_441422.1_7 Reverse -355 -372 -2.22277 0.21
NP_442658.1_1 Reverse -355 -365 16.0075 0.00966
NP_442658.1_1 Reverse -290 -300 11.091 0.0944
NP_442658.1_1 Forward -368 -358 7.94438 0.199
NP_442782.1_2 Forward -366 -352 1.76955 0.281
NP_441414.1_9 Reverse -357 -376 -9.53865 0.262
NP_441414.1_9 Forward -154 -135 -10.3253 0.28
NP_440184.1_5 Forward -376 -357 5.89931 0.241
NP_442937.1_5 Forward -371 -352 10.5209 0.158
NP_441958.1_5 Reverse -356 -366 20.5312 0.000966
NP_441958.1_5 Forward -367 -357 12.2714 0.00183
NP_441127.1_1 Forward -17 -3 9.5377 0.272
NP_442836.1_10 Reverse -260 -270 9.61647 0.274
NP_440950.1_10 Reverse -19 -38 15.6917 0.128
NP_439905.1_1 Reverse -358 -371 8.67241 0.232
NP_440984.1_7 Reverse -352 -366 9.43936 0.127
NP_439990.1_5 Forward -371 -358 13.589 0.0935
NP_442690.1_1 Reverse -30 -49 -14.5535 0.273
NP_442911.1_2 Reverse -347 -366 5.60432 0.0325
NP_442911.1_2 Forward -376 -357 -3.54046 0.114
NP_442911.1_2 Forward -155 -136 -9.73531 0.262
NP_440153.1_5 Reverse -358 -372 1.67122 0.245
NP_442064.1_4 Reverse -141 -160 13.7649 0.147
NP_443055.1_6 Forward -102 -84 4.34495 0.182
NP_443055.1_6 Reverse -254 -272 -2.53818 0.296
NP_440827.1_3 Forward -377 -358 11.0125 0.275
NP_441348.1_2 Reverse -261 -280 14.9458 0.299
NP_441099.1_5 Forward -376 -357 8.45592 0.0373
NP_442002.1_9 Reverse -356 -363 14.1004 0.074
NP_442002.1_9 Reverse -135 -142 11.3472 0.185
NP_441294.1_7 Reverse -353 -367 11.7463 0.129
NP_441646.1_1 Forward -373 -354 4.62101 0.191
NP_441646.1_1 Reverse -350 -369 1.96607 0.224
NP_442438.1_10 Forward -180 -166 7.47274 0.0933
NP_442438.1_10 Reverse -352 -366 4.71948 0.142
NP_442438.1_10 Forward -371 -357 1.08123 0.206
NP_441000.1_6 Reverse -356 -370 -2.95034 0.221
NP_441000.1_6 Forward -367 -353 -3.54032 0.224
NP_442771.1_1 Reverse -355 -373 2.67408 0.0677
NP_442771.1_1 Forward -368 -350 -2.53746 0.161
NP_440147.1_4 Reverse -355 -368 18.2105 0.00465
NP_440147.1_4 Forward -368 -355 16.6372 0.00999
NP_441175.1_7 Forward -366 -347 6.09597 0.264
NP_441550.1_8 Reverse -355 -365 18.1707 0.00754
NP_441550.1_8 Forward -368 -358 15.1225 0.0132
NP_441916.1_7 Forward -366 -356 16.893 0.00407
NP_441916.1_7 Reverse -357 -367 10.3048 0.0261
NP_441041.1_4 Reverse -230 -249 -8.16202 0.197
NP_441041.1_7 Reverse -354 -366 16.941 0.0119
NP_441041.1_7 Forward -87 -75 6.34865 0.211
NP_441041.1_8 Forward -344 -325 15.899 0.277
NP_442004.1_6 Reverse -357 -371 2.65453 0.26
NP_440703.1_9 Reverse -248 -261 5.42692 0.293
NP_441725.1_4 Forward -371 -357 11.4053 0.0851
NP_441725.1_5 Forward -365 -355 11.7798 0.0247
NP_441725.1_5 Reverse -146 -156 6.66654 0.112
NP_441725.1_5 Reverse -358 -368 2.04498 0.115
NP_439966.1_7 Forward -368 -358 15.3192 0.0152
NP_439966.1_7 Reverse -355 -365 8.63269 0.132
NP_439966.1_7 Reverse -290 -300 8.53436 0.135
NP_442941.1_3 Reverse -358 -368 19.2529 0.00262
NP_442941.1_3 Forward -365 -355 10.6981 0.0116
NP_440289.1_2 Reverse -354 -367 12.409 0.015
NP_440289.1_2 Forward -369 -356 5.91914 0.0605
NP_440289.1_2 Forward -157 -144 -0.964025 0.218
NP_440983.1_5 Reverse -357 -376 -1.67217 0.228
NP_442281.1_1 Reverse -352 -366 11.9953 0.0418
NP_442281.1_1 Forward -371 -357 6.48882 0.124
NP_441334.1_7 Forward -368 -349 -14.1602 0.249
NP_440177.1_9 Forward -374 -355 13.2741 0.228
NP_440177.1_9 Forward -366 -347 11.7008 0.253
NP_442256.1_2 Forward -368 -350 -7.06068 0.214
NP_442256.1_2 Reverse -361 -379 -9.22396 0.254
NP_440437.1_1 Reverse -351 -370 -1.37718 0.201
NP_440437.1_1 Forward -138 -119 -4.32711 0.256
NP_441087.1_6 Reverse -162 -180 -3.71814 0.296
NP_440498.1_1 Reverse -348 -366 -1.16082 0.222
NP_442982.1_5 Reverse -347 -366 5.80098 0.156
NP_441644.1_6 Reverse -357 -367 17.3841 0.00127
NP_441644.1_6 Forward -366 -356 15.7125 0.0048
NP_442215.1_1 Reverse -353 -372 7.57094 0.197
NP_442215.1_2 Forward -368 -352 6.15506 0.0738
NP_442029.1_6 Forward -371 -352 15.5357 0.0999
NP_442029.1_6 Reverse -148 -167 9.43923 0.188
NP_440929.1_8 Forward -366 -357 19.2726 0.000701
NP_440929.1_8 Reverse -357 -366 19.2726 0.000701
NP_442933.1_10 Forward -366 -357 17.601 0.00325
NP_442933.1_10 Reverse -357 -366 17.601 0.00325
NP_441751.2_8 Forward -365 -351 6.48943 0.0354
NP_441751.2_8 Reverse -358 -372 5.50613 0.0423
NP_442554.1_8 Reverse -358 -368 16.2046 0.0065
NP_442554.1_8 Forward -365 -355 15.123 0.00944
NP_442554.1_8 Forward -153 -143 2.04498 0.285
NP_441762.1_7 Reverse -356 -368 1.80894 0.0735
NP_441762.1_7 Forward -367 -355 -6.84419 0.284
NP_442142.1_4 Reverse -354 -367 13.195 0.0381
NP_442292.1_1 Reverse -358 -367 18.486 0.00229
NP_442292.1_1 Forward -365 -356 9.53783 0.0183
NP_442476.1_6 Forward -365 -351 8.16106 0.105
NP_442476.1_6 Reverse -358 -372 1.37622 0.219
NP_442381.1_8 Forward -369 -350 -5.01543 0.14
NP_442381.1_8 Reverse -354 -373 -7.4737 0.188
NP_443009.1_5 Forward -367 -356 15.7911 0.0107
NP_443009.1_5 Reverse -356 -367 11.1696 0.066
NP_440807.1_6 Forward -371 -352 15.5357 0.267
NP_441715.1_4 Reverse -358 -368 17.3846 0.0106
NP_441715.1_4 Forward -365 -355 9.81313 0.097
NP_440015.1_9 Reverse -357 -375 -0.275845 0.256
NP_441448.1_1 Forward -156 -137 9.3409 0.198
NP_440183.1_9 Forward -92 -73 -19.4701 0.279
NP_440379.1_5 Reverse -334 -353 -2.36049 0.198
NP_441468.1_1 Forward -365 -358 15.8704 0.0124
NP_441468.1_1 Reverse -358 -365 15.8704 0.0124
NP_441468.1_1 Forward -153 -146 10.9539 0.0726
NP_441020.2_6 Forward -368 -351 7.41366 0.232
NP_441015.1_10 Forward -371 -352 -2.26216 0.178
NP_441015.1_10 Reverse -358 -377 -9.53865 0.282
NP_441673.1_1 Forward -366 -357 20.8459 0.000698
NP_441673.1_1 Reverse -357 -366 20.8459 0.000698
NP_441731.1_3 Forward -374 -355 4.22769 0.159
NP_441731.1_3 Forward -96 -77 -5.40875 0.284
NP_441956.1_9 Forward -373 -354 13.1758 0.166
NP_441876.1_9 Forward -382 -372 11.2876 0.278
NP_441826.1_2 Reverse -351 -365 4.42448 0.103
NP_441826.1_2 Forward -372 -358 -1.5737 0.25
NP_441826.1_2 Forward -235 -221 -2.26202 0.269
NP_441330.1_1 Reverse -352 -371 -2.65548 0.0791
NP_442745.1_6 Forward -242 -223 22.8122 0.0687
NP_442868.1_6 Forward -368 -358 19.2529 0.00563
NP_442868.1_6 Reverse -355 -365 18.5646 0.0104
NP_442868.1_6 Forward -86 -76 2.92996 0.205
NP_441056.1_1 Reverse -357 -376 -5.31042 0.257
NP_441612.1_2 Reverse -357 -367 8.54929 0.21
NP_442808.1_1 Reverse -356 -366 8.73102 0.0481
NP_442808.1_1 Forward -367 -357 8.63269 0.0481
NP_440145.1_3 Reverse -347 -366 -6.09707 0.288
NP_442820.1_3 Forward -277 -267 12.2709 0.293
NP_442718.1_2 Reverse -117 -136 -4.32711 0.292
NP_442542.1_2 Reverse -355 -368 17.2272 0.0472
NP_442542.1_2 Forward -368 -355 7.59077 0.176
NP_442542.1_2 Forward -86 -73 5.32916 0.272
NP_442050.1_5 Forward -368 -358 14.3359 0.0206
NP_442050.1_5 Reverse -355 -365 13.6475 0.0295
NP_440558.1_2 Reverse -348 -367 -2.16383 0.223
NP_441048.1_4 Forward -256 -237 13.0775 0.245
NP_442789.1_4 Forward -256 -237 -7.17871 0.292
NP_441878.1_1 Forward -178 -159 18.2141 0.23
NP_441878.1_6 Reverse -356 -366 20.2362 0.0046
NP_441878.1_6 Forward -367 -357 10.4031 0.0176
NP_441878.1_6 Forward -373 -363 1.55333 0.0937
NP_441878.1_6 Reverse -246 -256 0.275027 0.146
NP_441878.1_6 Forward -257 -247 -7.98478 0.285
NP_441036.1_8 Reverse -356 -366 8.4365 0.174
NP_441036.1_8 Forward -367 -357 8.33817 0.174
NP_441557.1_5 Forward -366 -357 19.9609 0.000699
NP_441557.1_5 Reverse -357 -366 19.9609 0.000699
NP_442066.2_9 Forward -370 -357 10.5407 0.154
NP_441433.1_8 Reverse -364 -383 9.83255 0.147
NP_440101.1_3 Reverse -352 -371 15.2408 0.0613
NP_441458.1_10 Reverse -142 -161 1.17943 0.297
NP_442183.1_1 Reverse -357 -371 7.76774 0.131
NP_442397.1_9 Reverse -357 -376 10.2259 0.246
NP_441549.1_9 Forward -370 -352 4.83737 0.0925
NP_442347.1_2 Reverse -358 -367 12.4878 0.056
NP_442347.1_2 Forward -365 -356 3.34298 0.284
NP_442645.1_2 Forward -374 -355 -14.6519 0.177
NP_442645.1_2 Reverse -349 -368 -21.9284 0.29
NP_442888.1_8 Forward -377 -358 18.289 0.0857
NP_441037.1_4 Reverse -355 -365 9.55921 0.21
NP_442047.1_2 Reverse -236 -250 11.7993 0.297
NP_441633.1_3 Forward -368 -355 12.9006 0.0192
NP_441633.1_3 Reverse -355 -368 -3.71729 0.177
NP_440136.1_2 Forward -365 -358 15.9687 0.0123
NP_440136.1_2 Reverse -358 -365 15.9687 0.0123
NP_440136.1_2 Forward -300 -293 11.1505 0.0519
NP_442590.1_10 Reverse -350 -369 5.60432 0.258
NP_442590.1_10 Reverse -357 -376 3.83436 0.283
NP_442998.1_10 Forward -364 -357 15.5754 0.0102
NP_442998.1_10 Reverse -359 -366 15.5754 0.0102
NP_440899.1_2 Reverse -346 -365 8.84842 0.187
NP_440299.1_1 Forward -370 -357 20.6681 0.00128
NP_440299.1_1 Reverse -353 -366 13.2934 0.0319
NP_441799.1_1 Reverse -353 -367 15.4369 0.0182
NP_441007.1_10 Forward -371 -358 1.00259 0.209
NP_441007.1_10 Reverse -352 -365 -0.275709 0.273
NP_440256.1_1 Reverse -354 -373 -6.1954 0.205
NP_440256.1_1 Forward -369 -350 -6.88371 0.223
NP_441512.1_4 Reverse -353 -372 6.98095 0.293
NP_441559.1_8 Reverse -81 -95 2.85119 0.143
NP_441559.1_8 Reverse -352 -366 0.786239 0.161
NP_441559.1_8 Forward -89 -75 -4.4253 0.223
NP_441559.1_8 Forward -371 -357 -5.80194 0.27
NP_441559.1_8 Reverse -225 -239 -7.2769 0.289
NP_440915.1_6 Forward -370 -356 18.0925 0.0123
NP_440915.1_6 Reverse -353 -367 9.73436 0.039
NP_441704.1_9 Reverse -286 -300 17.9942 0.186
NP_442069.1_10 Reverse -358 -376 14.1788 0.124
NP_440026.1_7 Reverse -352 -367 19.7444 0.0824
NP_441939.1_3 Reverse -358 -377 9.14423 0.153
NP_441939.1_3 Forward -365 -346 7.7676 0.19
NP_442993.1_1 Reverse -357 -373 -8.20127 0.157
NP_442386.1_9 Forward -367 -358 13.8639 0.0289
NP_442386.1_9 Reverse -291 -300 7.96411 0.213
NP_442386.1_9 Reverse -356 -365 6.39082 0.219
NP_442386.1_9 Reverse -144 -153 4.7192 0.289
NP_440570.1_5 Forward -376 -357 11.5042 0.135
NP_441340.1_5 Forward -365 -358 15.6737 0.0124
NP_441340.1_5 Reverse -358 -365 15.6737 0.0124
NP_442186.1_9 Reverse -355 -374 5.01433 0.255
NP_442484.1_2 Forward -377 -358 7.96426 0.144
NP_442240.1_2 Reverse -344 -363 -18.8801 0.295
NP_442240.1_2 Forward -365 -346 -19.7651 0.295
NP_440161.1_3 Forward -147 -128 17.994 0.0611
NP_440586.1_8 Forward -365 -358 13.2151 0.026
NP_440586.1_8 Reverse -358 -365 13.2151 0.026
NP_442251.1_6 Forward -365 -358 15.2804 0.0124
NP_442251.1_6 Reverse -358 -365 15.2804 0.0124
NP_442959.1_5 Reverse -17 -36 5.80098 0.268
NP_440684.1_9 Forward -372 -358 8.55439 0.226
NP_441262.1_3 Reverse -357 -364 14.7888 0.0223
NP_441262.1_3 Forward -366 -359 14.7888 0.0223
NP_440027.1_3 Forward -94 -76 1.88669 0.295
NP_443051.1_1 Reverse -356 -365 18.0926 0.00402
NP_443051.1_1 Forward -367 -358 10.4228 0.00754
NP_439937.1_9 Forward -281 -264 -11.0732 0.241
NP_441595.1_5 Forward -373 -355 7.98396 0.222
NP_440439.1_1 Forward -369 -356 3.85419 0.109
NP_440439.1_1 Reverse -354 -367 2.08423 0.138
NP_440439.1_1 Reverse -350 -363 0.510939 0.188
NP_439943.1_7 Forward -371 -352 15.8307 0.0929
NP_440372.1_2 Forward -365 -358 16.3621 0.0124
NP_440372.1_2 Reverse -358 -365 16.3621 0.0124
NP_440316.1_10 Forward -373 -363 18.2696 0.153
NP_441803.1_2 Reverse -358 -377 -0.590531 0.282
NP_439977.1_5 Reverse -286 -305 1.47442 0.192
NP_440139.1_1 Reverse -351 -370 4.62021 0.177
NP_441572.1_7 Forward -372 -353 1.37609 0.151
NP_441572.1_7 Reverse -351 -370 -0.197208 0.179
NP_440267.1_2 Reverse -352 -366 17.3052 0.042
NP_442384.1_10 Reverse -357 -370 21.1604 0.00194
NP_442384.1_10 Forward -366 -353 20.4721 0.00265
NP_442114.1_4 Forward -301 -290 7.43349 0.277
NP_441604.1_4 Forward -380 -361 -4.91709 0.247
NP_441018.1_7 Forward -370 -351 10.0292 0.218
NP_442790.1_4 Forward -375 -356 2.85105 0.0729
NP_442262.1_10 Forward -365 -358 14.1988 0.0123
NP_442262.1_10 Reverse -358 -365 14.1988 0.0123
NP_442262.1_10 Forward -153 -146 9.47889 0.187
NP_441689.1_5 Forward -368 -358 5.78111 0.197
NP_440344.1_10 Forward -246 -229 -12.8425 0.267
NP_440282.1_10 Reverse -359 -378 -8.06369 0.259
NP_441060.1_3 Forward -259 -240 10.1275 0.218
NP_441640.1_8 Forward -300 -281 -3.73712 0.259
NP_440297.1_9 Forward -365 -355 9.61647 0.0917
NP_440297.1_9 Reverse -146 -156 1.06167 0.282
NP_440297.1_9 Reverse -358 -368 -0.118297 0.282
NP_441592.1_4 Reverse -357 -376 19.5673 0.0469
NP_441896.1_3 Reverse -283 -302 3.73603 0.164
NP_441103.1_9 Forward -382 -372 13.6614 0.243
NP_440990.1_3 Forward -367 -348 17.994 0.243
NP_442129.1_6 Reverse -20 -39 13.1708 0.29
NP_440999.1_2 Forward -250 -231 15.0441 0.163
NP_440999.1_9 Reverse -353 -367 0.687908 0.177
NP_440999.1_9 Forward -370 -356 -0.000409212 0.195
NP_440999.1_9 Reverse -288 -302 -1.08205 0.226
NP_440888.1_2 Reverse -357 -371 18.6818 0.00204
NP_440888.1_2 Reverse -230 -244 8.84875 0.145
NP_440888.1_2 Forward -366 -352 8.25877 0.167
NP_440491.1_1 Reverse -354 -373 6.62464 0.293
NP_439969.1_3 Forward -371 -352 3.34271 0.237
NP_442033.1_10 Reverse -355 -374 -8.35868 0.196
NP_442033.1_10 Forward -368 -349 -10.4236 0.236
NP_441543.1_2 Reverse -358 -367 16.9127 0.00359
NP_441543.1_2 Forward -365 -356 9.34117 0.0818
NP_442845.1_2 Forward -372 -358 9.93102 0.163
NP_442845.1_3 Forward -213 -194 22.2223 0.0898
NP_441469.1_8 Reverse -291 -300 13.7661 0.0719
NP_441469.1_8 Reverse -356 -365 13.3727 0.073
NP_441469.1_8 Forward -155 -146 9.63616 0.227
NP_441469.1_8 Forward -85 -76 8.84951 0.227
NP_441469.1_8 Forward -367 -358 6.48957 0.227
NP_443064.1_6 Forward -366 -356 13.8273 0.0796
NP_443064.1_6 Reverse -357 -367 12.5669 0.0796
NP_442578.1_7 Forward -365 -358 14.5921 0.026
NP_442578.1_7 Reverse -358 -365 14.5921 0.026
NP_440710.1_1 Reverse -349 -367 -0.0791831 0.163
NP_440710.1_1 Forward -374 -356 -9.0273 0.292
NP_441462.1_2 Forward -366 -356 20.1379 0.000967
NP_441462.1_2 Reverse -357 -367 11.5831 0.00406
NP_443062.1_1 Reverse -48 -66 5.03566 0.242
NP_441410.1_3 Reverse -348 -367 5.89931 0.23
NP_442204.1_1 Forward -370 -359 2.12362 0.266
NP_442204.1_1 Reverse -353 -364 1.92696 0.266
NP_441560.1_10 Reverse -349 -368 8.55425 0.243
NP_441351.1_8 Forward -354 -335 0.294447 0.289
NP_440516.1_8 Forward -366 -357 16.9127 0.00442
NP_440516.1_8 Reverse -357 -366 16.9127 0.00442
NP_442428.1_5 Forward -365 -358 15.8704 0.0124
NP_442428.1_5 Reverse -358 -365 15.8704 0.0124
NP_442428.1_5 Forward -153 -146 4.66067 0.244
NP_440818.1_1 Reverse -244 -263 6.78429 0.054
NP_441835.1_1 Forward -60 -46 18.7808 0.153
NP_440673.1_3 Forward -364 -357 12.4288 0.0426
NP_440673.1_3 Reverse -359 -366 12.4288 0.0426
NP_440673.1_7 Forward -377 -358 7.37428 0.145
NP_441052.1_2 Reverse -357 -367 19.9412 0.00106
NP_441052.1_2 Forward -366 -356 10.4031 0.0285
NP_442219.1_9 Reverse -358 -367 17.7976 0.00718
NP_442219.1_9 Forward -365 -356 8.25953 0.0681
NP_440436.1_4 Reverse -358 -367 17.2072 0.00233
NP_440436.1_4 Forward -365 -356 15.9289 0.00508
NP_441884.1_9 Reverse -266 -285 -22.715 0.284
NP_440314.1_9 Reverse -358 -377 0.392778 0.0952
NP_442907.1_9 Reverse -352 -371 0.491109 0.207
NP_441719.1_4 Forward -365 -358 16.3621 0.0124
NP_441719.1_4 Reverse -358 -365 16.3621 0.0124
NP_441733.1_10 Forward -369 -356 5.32916 0.218
NP_441004.1_1 Forward -255 -236 -8.35868 0.2
NP_441004.1_1 Reverse -338 -357 -11.4069 0.238
NP_441004.1_1 Forward -372 -353 -12.9802 0.251
NP_442366.1_3 Reverse -356 -374 3.06741 0.117
NP_442694.1_3 Reverse -353 -371 -3.81576 0.265
NP_441851.1_10 Reverse -356 -366 17.4829 0.0027
NP_441851.1_10 Forward -367 -357 15.8113 0.00552
NP_442011.1_1 Forward -367 -348 -0.590531 0.268
NP_442856.1_7 Forward -375 -356 6.29264 0.123
NP_442856.1_7 Reverse -348 -367 -1.67217 0.231
NP_442515.1_1 Reverse -356 -370 11.3077 0.0416
NP_442515.1_1 Forward -367 -353 4.91614 0.107
NP_440593.1_3 Forward -357 -338 -3.14714 0.233
NP_440463.1_8 Forward -272 -253 7.69352 0.264
NP_441349.1_10 Forward -376 -357 -1.67217 0.106
NP_440389.1_2 Reverse -357 -376 13.9625 0.262
NP_440432.1_9 Forward -365 -350 -1.88839 0.167
NP_442843.1_1 Forward -153 -134 -2.75381 0.212
NP_440474.1_8 Reverse -293 -307 4.91554 0.263
NP_440396.1_10 Reverse -137 -153 11.7592 0.186
NP_442450.1_5 Reverse -355 -365 10.0098 0.115
NP_440588.1_2 Forward -375 -356 17.404 0.0108
NP_440588.1_2 Reverse -340 -359 -5.31042 0.247
NP_440588.1_2 Reverse -354 -373 -6.39206 0.28
NP_440943.1_6 Reverse -162 -181 16.6174 0.202
NP_442006.1_2 Reverse -369 -386 -16.5791 0.256
NP_442006.1_2 Forward -288 -271 -17.9557 0.285
NP_442006.1_2 Reverse -247 -264 -17.9557 0.285
NP_441003.1_9 Forward -381 -362 7.86593 0.227
NP_441570.1_1 Reverse -357 -375 -16.6971 0.252
NP_441570.1_1 Forward -372 -354 -16.8938 0.257
NP_441570.1_2 Reverse -236 -254 3.16574 0.275
NP_441078.1_4 Forward -366 -357 19.6659 0.0007
NP_441078.1_4 Reverse -357 -366 19.6659 0.0007
NP_442729.1_8 Forward -370 -357 9.36073 0.125
NP_442388.1_3 Reverse -73 -92 6.88262 0.282
NP_442348.1_2 Reverse -135 -144 6.5879 0.299
NP_442443.1_4 Forward -151 -141 15.3192 0.179
NP_440526.1_3 Forward -365 -354 8.71129 0.116
NP_440526.1_3 Reverse -358 -369 1.04151 0.267
NP_441432.1_8 Forward -367 -358 16.8143 0.00595
NP_441432.1_8 Reverse -356 -365 8.35786 0.0755
NP_442320.1_8 Forward -372 -358 6.29277 0.029
NP_441732.1_2 Reverse -353 -369 -16.1661 0.165
NP_440497.1_2 Reverse -161 -180 5.40766 0.287
NP_440760.1_1 Reverse -357 -376 13.1758 0.00888
NP_440760.1_1 Forward -366 -347 -18.8801 0.217
NP_442797.1_7 Reverse -350 -368 3.26407 0.234
NP_442797.1_7 Reverse -356 -374 2.96908 0.236
NP_442353.1_4 Forward -372 -353 -0.591301 0.29
NP_440913.1_1 Forward -368 -350 8.67227 0.183
NP_440713.1_4 Forward -376 -357 4.32602 0.231
NP_442489.1_7 Forward -366 -357 20.1576 0.000695
NP_442489.1_7 Reverse -357 -366 20.1576 0.000695
NP_441830.1_2 Reverse -77 -96 4.62101 0.224
NP_440559.1_1 Reverse -358 -367 17.4043 0.00658
NP_440559.1_1 Forward -365 -356 17.306 0.00658
NP_441659.2_8 Forward -366 -356 19.3512 0.000966
NP_441659.2_8 Reverse -357 -367 18.1713 0.00133
NP_440426.1_7 Reverse -347 -366 1.76941 0.221
NP_441022.1_1 Reverse -56 -65 11.2584 0.284
NP_442913.1_9 Forward -372 -353 13.8641 0.136
NP_442913.1_10 Reverse -348 -367 8.65258 0.0464
NP_441040.1_2 Forward -374 -355 -15.9302 0.289
NP_441040.1_5 Reverse -352 -371 17.109 0.111
NP_442008.1_2 Reverse -354 -373 6.58763 0.219
NP_440708.1_4 Forward -377 -358 5.70265 0.259
NP_440708.1_7 Forward -237 -218 3.73603 0.281
NP_440442.1_10 Reverse -222 -239 12.3302 0.277
NP_442346.1_5 Reverse -356 -366 17.9746 0.00128
NP_442346.1_5 Forward -367 -357 16.6963 0.00248
NP_442346.1_5 Reverse -225 -235 4.60159 0.281
NP_440545.1_3 Forward -370 -353 3.77542 0.079
NP_440545.1_3 Reverse -353 -370 0.137172 0.144
NP_440831.1_3 Forward -375 -356 15.4153 0.106
NP_440486.1_6 Forward -161 -142 6.58763 0.283
NP_442934.1_1 Reverse -36 -55 12.9791 0.257
NP_440459.1_2 Reverse -238 -255 11.1502 0.181
NP_440010.1_4 Reverse -110 -129 4.91521 0.215
NP_442603.1_7 Reverse -357 -371 11.7003 0.113
NP_442603.1_7 Forward -366 -352 8.45543 0.174
NP_441888.1_7 Forward -371 -357 3.14618 0.225
NP_440449.1_6 Forward -374 -356 5.33794 0.279
NP_441948.1_4 Reverse -350 -368 5.42735 0.0773
NP_441833.1_4 Forward -365 -358 15.9687 0.0124
NP_441833.1_4 Reverse -358 -365 15.9687 0.0124
NP_442699.1_8 Reverse -245 -264 -2.65548 0.217
NP_442162.1_9 Forward -365 -358 16.2637 0.0124
NP_442162.1_9 Reverse -358 -365 16.2637 0.0124
NP_442140.1_3 Forward -365 -355 11.5831 0.0743
NP_442140.1_3 Reverse -358 -368 10.3048 0.0902
NP_440875.1_9 Forward -364 -354 8.27469 0.233
NP_441813.1_5 Reverse -355 -365 18.3679 0.00743
NP_441813.1_5 Forward -368 -358 18.1713 0.00743
NP_440590.1_4 Reverse -358 -371 19.4888 0.00651
NP_440590.1_4 Forward -300 -287 2.87088 0.0788
NP_440590.1_4 Forward -365 -352 -5.38892 0.277
NP_440567.1_1 Forward -365 -351 10.0294 0.0402
NP_440567.1_1 Reverse -358 -372 5.70279 0.0984
NP_442497.1_10 Forward -365 -356 19.8626 0.00532
NP_442497.1_10 Reverse -358 -367 10.4228 0.0087
NP_440821.1_4 Reverse -355 -365 10.9931 0.0146
NP_440821.1_4 Forward -368 -358 9.41981 0.0286
NP_441239.1_9 Reverse -355 -367 12.6253 0.0446
NP_441239.1_9 Forward -368 -356 8.79043 0.122
NP_441239.1_9 Reverse -83 -95 3.87389 0.272
NP_441951.1_9 Forward -361 -342 -1.7705 0.299
NP_440665.1_1 Forward -172 -153 -15.9302 0.275
NP_440604.1_6 Forward -160 -141 -6.09707 0.289
NP_442270.1_9 Forward -377 -358 10.0292 0.0824
NP_441017.1_6 Forward -370 -356 14.1586 0.157
NP_440833.1_6 Forward -147 -133 15.6336 0.14
NP_440546.1_4 Forward -366 -356 12.8578 0.0572
NP_440546.1_4 Reverse -357 -367 10.046 0.109
NP_440546.1_6 Forward -185 -166 6.4893 0.3
NP_442041.1_2 Forward -379 -361 11.0322 0.283
NP_441230.1_10 Forward -351 -332 15.5357 0.293
NP_440675.1_1 Forward -369 -350 4.12936 0.244
NP_440462.1_6 Reverse -355 -365 9.7148 0.0429
NP_440462.1_6 Forward -368 -358 9.61647 0.0429
NP_442611.1_1 Forward -366 -347 6.68596 0.155
NP_440868.1_4 Reverse -353 -365 8.39711 0.0602
NP_440868.1_4 Forward -370 -358 0.923956 0.196
NP_441084.1_6 Reverse -355 -369 11.0893 0.218
NP_440696.1_3 Reverse -226 -244 2.28076 0.216
NP_442039.1_4 Forward -365 -358 15.1821 0.0124
NP_442039.1_4 Reverse -358 -365 15.1821 0.0124
NP_442039.1_7 Forward -152 -142 9.51814 0.257
NP_441811.1_8 Forward -372 -358 7.47274 0.243
NP_442679.1_1 Forward -252 -233 -3.73712 0.262
NP_442829.1_2 Forward -203 -187 8.23773 0.287
NP_441926.1_3 Reverse -357 -373 4.97508 0.175
NP_442837.1_3 Forward -365 -358 15.7721 0.0124
NP_442837.1_3 Reverse -358 -365 15.7721 0.0124
NP_440160.1_9 Forward -250 -231 8.45592 0.264
NP_442053.1_1 Forward -366 -357 18.3876 0.0007
NP_442053.1_1 Reverse -357 -366 18.3876 0.0007
NP_440505.1_3 Forward -368 -358 18.3679 0.00213
NP_440505.1_3 Reverse -355 -365 9.61647 0.122
NP_441203.1_1 Forward -365 -346 -1.08219 0.0636
NP_442532.1_2 Forward -45 -26 3.96249 0.218
NP_442532.1_4 Reverse -19 -37 19.1151 0.0663
NP_441408.2_7 Reverse -355 -374 2.94938 0.199
NP_440914.1_1 Reverse -357 -367 17.5935 0.000537
NP_440914.1_1 Forward -366 -356 8.51751 0.186
NP_441011.1_8 Forward -365 -356 14.356 0.0249
NP_441011.1_8 Reverse -154 -163 8.35786 0.144
NP_441011.1_8 Reverse -358 -367 8.25953 0.144
NP_442931.1_10 Forward -43 -24 10.52 0.119
NP_442533.1_6 Forward -366 -357 17.2076 0.00137
NP_442533.1_6 Reverse -357 -366 17.2076 0.00137
NP_442533.1_6 Forward -256 -247 4.52295 0.179
NP_442533.1_6 Forward -84 -75 3.24465 0.219
NP_441482.1_7 Forward -372 -358 6.98109 0.0257
NP_441482.1_7 Reverse -351 -365 -0.983719 0.0612
NP_439944.1_9 Reverse -358 -368 10.5014 0.0887
NP_439944.1_9 Forward -365 -355 8.82982 0.101
NP_439944.1_9 Reverse -1 -11 6.46988 0.179
NP_440816.1_2 Forward -158 -139 10.7915 0.202
NP_441028.1_6 Forward -382 -372 3.42118 0.296
NP_440116.1_8 Reverse -358 -377 0.982764 0.0929
NP_440116.1_8 Forward -365 -346 -2.45882 0.134
NP_440115.1_6 Reverse -354 -364 16.303 0.0325
NP_440115.1_6 Forward -369 -359 6.76487 0.167
NP_440007.1_9 Reverse -353 -367 7.76774 0.2
NP_440007.1_9 Forward -66 -52 0.491246 0.297
NP_441602.1_3 Forward -371 -352 3.34271 0.175
NP_441972.1_5 Reverse -358 -377 -10.227 0.3
NP_441106.1_1 Reverse -356 -365 9.73449 0.0311
NP_441106.1_1 Forward -367 -358 9.63616 0.0311
NP_441420.1_1 Forward -367 -348 -4.32711 0.292
NP_439903.1_6 Reverse -354 -373 3.44025 0.21
NP_442588.1_6 Forward -273 -254 -2.75381 0.296
NP_442306.1_10 Reverse -352 -371 -19.9617 0.201
NP_441286.1_1 Forward -367 -355 15.4769 0.00418
NP_441286.1_1 Reverse -356 -368 3.48056 0.0467
NP_441286.1_1 Reverse -144 -156 -5.95921 0.235
NP_442674.1_3 Forward -380 -361 20.8447 0.125
NP_440670.1_8 Forward -366 -357 18.3876 0.000699
NP_440670.1_8 Reverse -357 -366 18.3876 0.000699
NP_440886.1_7 Reverse -356 -366 8.04271 0.0805
NP_440886.1_7 Forward -367 -357 7.94438 0.0805
NP_440886.1_7 Reverse -144 -154 4.50281 0.232
NP_442614.1_2 Forward -366 -352 17.4042 0.0588
NP_442072.1_9 Reverse -356 -374 -21.8103 0.212
NP_441753.1_10 Reverse -348 -367 4.52268 0.198
NP_440907.2_8 Forward -365 -355 9.91099 0.103
NP_441021.1_1 Reverse -358 -377 19.5673 0.0142
NP_440841.1_4 Reverse -355 -374 -3.83545 0.185
NP_442459.1_8 Forward -159 -140 10.0292 0.204
NP_441626.1_2 Forward -365 -358 15.7721 0.0124
NP_441626.1_2 Reverse -358 -365 15.7721 0.0124
NP_442365.1_7 Reverse -353 -372 -2.75381 0.204
NP_442365.1_7 Forward -370 -351 -4.52377 0.245
NP_440107.1_2 Forward -371 -352 11.4058 0.299
NP_442794.1_1 Forward -370 -358 17.1486 0.0232
NP_441401.1_5 Forward -32 -13 14.2756 0.297
NP_442615.1_1 Reverse -348 -366 -0.570838 0.118
NP_442615.1_1 Forward -375 -357 -2.24246 0.141
NP_442467.1_4 Forward -270 -251 19.764 0.0848
NP_441962.1_9 Forward -268 -249 14.5524 0.161
NP_440387.1_1 Reverse -357 -373 16.2831 0.0047
NP_440387.1_1 Forward -366 -350 -1.12144 0.142
NP_440387.1_1 Forward -181 -165 -3.38305 0.158
NP_440387.1_1 Reverse -166 -182 -5.64466 0.243
NP_440855.1_5 Reverse -355 -374 7.07848 0.285
NP_441431.1_2 Reverse -354 -368 8.55376 0.211
NP_441488.1_7 Forward -297 -278 2.94938 0.242
NP_441488.1_7 Forward -372 -353 0.294447 0.298
NP_441488.1_8 Forward -371 -357 7.17714 0.268
NP_441836.1_2 Reverse -351 -370 -2.45882 0.23
NP_441836.1_2 Forward -372 -353 -5.01543 0.269
NP_441993.1_1 Forward -372 -353 14.8111 0.0768
NP_440467.1_3 Reverse -346 -365 10.6703 0.298
NP_440114.1_10 Forward -366 -352 7.66941 0.229
NP_442357.1_5 Forward -110 -96 16.4209 0.284
NP_440293.1_3 Forward -258 -239 5.50599 0.192
NP_439988.1_3 Forward -261 -247 6.58777 0.278
NP_441979.1_9 Reverse -160 -179 4.62101 0.297
NP_442743.1_4 Forward -365 -346 -3.14714 0.224
NP_440457.1_1 Reverse -353 -365 20.0002 0.0344
NP_440457.1_1 Forward -370 -358 6.33216 0.123
NP_440798.1_6 Forward -365 -352 12.114 0.0516
NP_440801.1_8 Reverse -356 -375 1.86774 0.236
NP_441984.1_1 Forward -372 -354 7.00065 0.283
NP_441889.1_4 Reverse -348 -367 11.0125 0.0842
NP_442509.1_9 Forward -366 -356 17.3841 0.00128
NP_442509.1_9 Reverse -357 -367 8.14104 0.192
NP_440554.1_4 Reverse -358 -368 8.92815 0.0646
NP_440554.1_4 Forward -365 -355 8.82982 0.0646
NP_441845.1_6 Forward -378 -360 4.24738 0.211
NP_442737.1_5 Forward -230 -211 11.2307 0.294
NP_441885.1_5 Reverse -357 -367 20.9245 0.000538
NP_441885.1_5 Forward -366 -356 11.3864 0.00668
NP_441885.1_5 Forward -84 -74 -1.19994 0.255
NP_440478.1_4 Forward -370 -351 11.1109 0.261
NP_440478.1_10 Reverse -355 -369 6.6861 0.288
NP_442341.1_7 Reverse -356 -370 8.25939 0.0898
NP_442341.1_9 Forward -361 -347 8.75042 0.166
NP_442341.1_9 Forward -368 -354 4.8172 0.291
NP_441756.1_5 Reverse -353 -372 -0.000545616 0.242
NP_441756.1_5 Forward -370 -351 -0.197208 0.242
NP_442395.2_4 Reverse -356 -375 11.11 0.092
NP_440423.1_3 Reverse -209 -228 15.7324 0.201
NP_443000.1_7 Forward -368 -358 19.9412 0.00223
NP_443000.1_7 Reverse -355 -365 11.6814 0.0344
NP_440507.2_3 Forward -375 -356 9.83173 0.216
NP_440275.1_3 Reverse -355 -365 16.9913 0.0133
NP_440275.1_3 Forward -368 -358 15.123 0.0182
NP_442275.1_1 Forward -280 -261 11.3075 0.222
NP_442275.1_1 Reverse -76 -95 4.62101 0.274
NP_440679.1_10 Reverse -159 -178 -14.9469 0.25
NP_441359.1_5 Reverse -354 -373 1.47442 0.29
NP_442451.1_2 Forward -374 -355 -1.86883 0.179
NP_439962.1_4 Forward -374 -355 -5.80207 0.28
NP_440175.1_7 Reverse -49 -67 9.16793 0.28
NP_442234.1_1 Forward -303 -284 9.24257 0.265
NP_440149.1_8 Reverse -357 -376 0.58944 0.134
NP_441105.1_3 Forward -377 -358 10.0292 0.043
NP_441105.1_3 Forward -261 -242 -0.39387 0.136
NP_440216.1_1 Forward -366 -352 26.549 0.000481
NP_440216.1_1 Reverse -357 -371 -0.885388 0.0286
NP_440216.1_1 Reverse -346 -360 -11.6035 0.203
NP_440172.1_1 Forward -366 -356 16.303 0.00854
NP_440172.1_1 Reverse -357 -367 15.0247 0.00945
NP_442015.1_10 Forward -370 -357 12.5073 0.0368
NP_442015.1_10 Reverse -353 -366 12.3107 0.0372
NP_442015.1_10 Reverse -237 -250 0.117615 0.241
NP_441226.1_7 Forward -365 -358 14.4934 0.0123
NP_441226.1_7 Reverse -358 -365 14.4934 0.0123
NP_441757.1_3 Forward -367 -348 1.86774 0.159
NP_441111.1_7 Forward -365 -357 18.7023 0.00294
NP_441111.1_7 Reverse -358 -366 18.7023 0.00294
NP_441766.1_2 Forward -366 -357 17.5026 0.00297
NP_441766.1_2 Reverse -357 -366 17.5026 0.00297
NP_440416.1_9 Forward -373 -354 2.0644 0.0413
NP_440416.1_9 Reverse -350 -369 -6.09707 0.0854
NP_440416.1_9 Reverse -7 -26 -17.7001 0.245
NP_440416.1_9 Forward -257 -238 -18.0934 0.251
NP_443052.1_8 Forward -185 -166 -10.7186 0.214
NP_442116.1_6 Forward -37 -20 7.69149 0.254
NP_440591.1_9 Forward -373 -355 17.4237 0.0619
NP_440261.1_5 Forward -365 -352 16.4406 0.0106
NP_440261.1_5 Reverse -358 -371 -11.9771 0.268
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATTTTACTAACAGCCTATTCTCCCCTGGGCTCTGGCGATCGCCCGGCGGCCTTCCAACAAGCAGCAGAACCGAAATTACTAACTGATCCAGTGATTAATGGGATTGCAGCTGAACAAGGGTGCAGTGCGGCCCAAGTCCTTTTGGCCTGGGCCATTCAACGGGGAACCGTGACCATTCCGAAGTCGGTTAATCCTGAACGACTAGAACAAAATTTGAGGGCGGCAGATATCACCCTCACGGATAGCGAGATGGCGAAAATTGCCCTATTAGACCGTCATTACCGCTACGTGTCGGGAGACTTTTGGACCATGCCGGGCAGTCCCTATACGTTACAAAACCTATGGGATGAAATTTAAACCTTAAGATATTACAGAAACTTATCGCAGAGGGAAGAAAGC

CDS

GTGATGACTCTCGAACCAAACCAGGAACAACTGAAAAAAATGAAATCCCATCCTGGTTTCATTGCCGCCCTAGACCAAAGCGGTGGTAGTACTCCAGGGGCGTTGGCCGATTATGGAATCGAACCCAATACCTATTCTGGTGACGACCAAATGTTCGCACTGGTGCATCAAATGCGGACCAGGATCATGACCAGTCCCGGCTTCACTGGCGATCGGATTTTGGCCGCAATCCTGTTCGAGGACACCATGAACCGGGAGGTTGATGGGGAGCCCACGGCCAACTACCTTTGGCAAAACAAACAAATCGTACCGATTTTGAAGGTAGACAAAGGACTGGCCCAAGAGAAGGATGGGAGCCAATTGATGAAGCCCATTCCCCAGCTTGACAGTCTGCTAATGAAGGCCAAGAAAAAAGGCATCTTCGGTACCAAAATGCGGTCATTTATCAAACATGCCAATCCCGCCGGTATCGAGGCGATCGTGGACCAGCAATTCGAGCTAGCCCAGCAAATTATTGCCGCTGGCCTGGTGCCGATTATTGAGCCCGAAGTAGATATTCACTGCTCGGAGAAAGCTCAGGCGGAAGCGTTACTCAAACAAGCCATGCTGAAACATCTCAACCAATTACCCAAAGGACAGTGGGTGATGCTCAAACTCACTCTGCCGGAGCAAGACAACCTTTATAGCAATTGCATCGAACATGCCAATGTCTTGAGAGTGGTTGCTTTGTCGGGGGGCTACTCCCAAGCGGAAGCTAATGAGCGTCTAAGCAGGAATCACGGTGTCATAGCAAGCTTTTCACGAGCTTTGACTGAGGGACTAACGGCCCAACAAACTGATGCTGAGTTCAACACCATGTTGGACGAATCCATTGAAAAAATCTATCAGGCATCGATTACGTAG

Protein

MMTLEPNQEQLKKMKSHPGFIAALDQSGGSTPGALADYGIEPNTYSGDDQMFALVHQMRTRIMTSPGFTGDRILAAILFEDTMNREVDGEPTANYLWQNKQIVPILKVDKGLAQEKDGSQLMKPIPQLDSLLMKAKKKGIFGTKMRSFIKHANPAGIEAIVDQQFELAQQIIAAGLVPIIEPEVDIHCSEKAQAEALLKQAMLKHLNQLPKGQWVMLKLTLPEQDNLYSNCIEHANVLRVVALSGGYSQAEANERLSRNHGVIASFSRALTEGLTAQQTDAEFNTMLDESIEKIYQASIT