Your browser is old and dusty. Try Google Chrome!

Details for slr0937

ORF slr0937
Accession NP_441716.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -225 -211 12.0943 0.0481
NP_441061.1_2 Forward -315 -301 3.04785 0.168
NP_441061.1_2 Forward -43 -29 2.35953 0.177
NP_441061.1_2 Forward -366 -352 0.786239 0.199
NP_441061.1_2 Reverse -218 -232 -0.0987402 0.221
NP_440557.1_1 Reverse -218 -237 1.37609 0.256
NP_440795.1_7 Forward -366 -359 14.6904 0.0123
NP_440795.1_7 Reverse -359 -366 14.6904 0.0123
NP_440795.1_7 Forward -225 -218 14.6904 0.0123
NP_440795.1_7 Reverse -218 -225 14.6904 0.0123
NP_441418.1_6 Forward -367 -348 -1.7705 0.0154
NP_441418.1_6 Reverse -217 -236 -19.6667 0.093
NP_441418.1_6 Reverse -301 -320 -29.1065 0.216
NP_441418.1_6 Forward -226 -207 -29.2048 0.219
NP_441418.1_6 Forward -220 -201 -29.4998 0.228
NP_441418.1_6 Reverse -175 -194 -29.4998 0.228
NP_441418.1_6 Reverse -307 -326 -29.9915 0.249
NP_440815.1_5 Forward -367 -348 9.73422 0.228
NP_441480.1_5 Reverse -176 -195 15.2408 0.132
NP_442291.1_5 Forward -227 -211 11.4649 0.0391
NP_442291.1_5 Reverse -357 -373 3.50012 0.109
NP_441453.1_1 Reverse -351 -369 3.8533 0.263
NP_441453.1_4 Reverse -358 -366 16.539 0.00633
NP_441453.1_4 Reverse -217 -225 16.539 0.00633
NP_441453.1_4 Forward -367 -359 16.539 0.00633
NP_441453.1_4 Forward -226 -218 16.539 0.00633
NP_441453.1_7 Forward -169 -162 11.9372 0.298
NP_441960.1_3 Forward -252 -233 13.7008 0.258
NP_442151.1_6 Reverse -358 -372 15.7325 0.0214
NP_442151.1_6 Forward -367 -353 9.73436 0.141
NP_442151.1_6 Reverse -217 -231 7.9644 0.184
NP_442151.1_6 Forward -226 -212 5.60446 0.27
NP_442838.1_7 Forward -372 -353 -11.2103 0.272
NP_441818.1_1 Forward -225 -214 18.0527 0.00639
NP_441818.1_1 Forward -366 -355 15.6928 0.0257
NP_441818.1_1 Reverse -218 -229 9.69459 0.232
NP_441818.1_1 Forward -183 -172 8.71129 0.28
NP_441818.1_9 Reverse -307 -326 0.0977854 0.191
NP_441818.1_9 Reverse -235 -254 -7.96535 0.274
NP_441818.1_9 Reverse -175 -194 -8.65367 0.279
NP_440226.1_1 Reverse -358 -377 21.9273 0.00612
NP_440226.1_1 Forward -367 -348 15.5357 0.0245
NP_440226.1_1 Reverse -217 -236 13.2741 0.0374
NP_440226.1_1 Forward -226 -207 3.93269 0.209
NP_441630.1_3 Reverse -209 -228 17.699 0.0318
NP_441630.1_3 Reverse -350 -369 -0.787193 0.29
NP_440120.1_4 Forward -354 -340 13.3726 0.29
NP_442623.1_3 Forward -366 -347 -18.2901 0.263
NP_440150.1_2 Reverse -25 -44 4.81688 0.281
NP_440150.1_6 Forward -229 -210 4.32602 0.245
NP_440150.1_6 Forward -370 -351 2.0644 0.279
NP_442287.1_3 Forward -184 -167 20.9825 0.0278
NP_442655.1_10 Reverse -238 -257 -14.1602 0.266
NP_442173.1_1 Forward -366 -358 15.4574 0.00633
NP_442173.1_1 Forward -225 -217 15.4574 0.00633
NP_442173.1_1 Reverse -359 -367 15.4574 0.00633
NP_442173.1_1 Reverse -218 -226 15.4574 0.00633
NP_442752.1_4 Forward -367 -360 13.8055 0.0199
NP_442752.1_4 Reverse -358 -365 13.8055 0.0199
NP_442752.1_4 Forward -226 -219 13.8055 0.0199
NP_442752.1_4 Reverse -217 -224 13.8055 0.0199
NP_442752.1_4 Reverse -175 -182 10.5605 0.1
NP_443027.1_4 Forward -369 -359 15.3197 0.0437
NP_443027.1_4 Forward -228 -218 14.828 0.0437
NP_443027.1_4 Reverse -356 -366 13.1564 0.0521
NP_443027.1_4 Reverse -215 -225 11.0914 0.107
NP_441812.1_3 Reverse -216 -230 17.3058 0.0613
NP_441812.1_3 Reverse -357 -371 16.8142 0.0639
NP_442975.1_10 Forward -371 -357 19.6651 0.00325
NP_442975.1_10 Forward -230 -216 13.7653 0.0459
NP_442975.1_10 Reverse -354 -368 3.04726 0.263
NP_441225.1_4 Forward -314 -295 -11.0136 0.284
NP_440784.1_7 Forward -366 -359 15.9687 0.0123
NP_440784.1_7 Reverse -359 -366 15.9687 0.0123
NP_440784.1_7 Forward -225 -218 15.9687 0.0123
NP_440784.1_7 Reverse -218 -225 15.9687 0.0123
NP_440784.1_7 Forward -219 -212 6.43063 0.218
NP_442909.1_7 Forward -225 -211 13.5686 0.12
NP_440061.1_9 Forward -228 -214 20.6484 0.00331
NP_440061.1_9 Forward -369 -355 12.782 0.0922
NP_440061.1_9 Reverse -356 -370 5.80051 0.272
NP_440061.1_9 Reverse -33 -47 5.50552 0.283
NP_441054.1_4 Forward -236 -218 11.0322 0.0619
NP_441054.1_4 Reverse -348 -366 0.510803 0.174
NP_441145.1_1 Forward -45 -26 8.16093 0.254
NP_442062.1_8 Reverse -217 -227 19.4496 0.000558
NP_442062.1_8 Forward -367 -357 17.3846 0.00193
NP_442062.1_8 Forward -226 -216 17.3846 0.00193
NP_442062.1_8 Reverse -358 -368 10.3048 0.0493
NP_442062.1_8 Forward -310 -300 4.89658 0.193
NP_442062.1_8 Forward -38 -28 3.12662 0.285
NP_441859.1_3 Forward -368 -349 4.03023 0.228
NP_440304.1_4 Forward -369 -359 18.9579 0.00406
NP_440304.1_4 Forward -228 -218 10.8948 0.051
NP_440304.1_4 Reverse -356 -366 9.91146 0.051
NP_440304.1_4 Reverse -27 -37 5.28991 0.218
NP_440304.1_4 Reverse -215 -225 1.84832 0.299
NP_440304.1_10 Forward -252 -234 13.2938 0.233
NP_442242.1_4 Forward -366 -359 14.3954 0.0124
NP_442242.1_4 Reverse -359 -366 14.3954 0.0124
NP_442242.1_4 Forward -225 -218 14.3954 0.0124
NP_442242.1_4 Reverse -218 -225 14.3954 0.0124
NP_440044.1_8 Reverse -359 -378 8.45592 0.0748
NP_441781.1_7 Forward -226 -207 -1.37718 0.272
NP_441781.1_7 Forward -367 -348 -1.7705 0.279
NP_441208.1_9 Reverse -355 -369 17.6992 0.0647
NP_441208.1_9 Forward -370 -356 8.94771 0.219
NP_441208.1_9 Forward -40 -26 6.48943 0.244
NP_441208.1_9 Reverse -214 -228 5.1128 0.278
NP_440370.1_10 Reverse -349 -368 6.98095 0.271
NP_442742.1_9 Forward -192 -173 -5.31042 0.221
NP_442276.1_2 Forward -56 -37 3.04771 0.299
NP_441109.1_3 Forward -317 -298 13.5683 0.154
NP_442110.1_7 Reverse -358 -372 9.14437 0.0755
NP_442110.1_7 Reverse -217 -231 1.96621 0.222
NP_442110.1_7 Forward -226 -212 -0.393733 0.287
NP_441925.1_4 Forward -191 -172 2.85027 0.155
NP_441925.1_4 Forward -194 -175 -17.0125 0.287
NP_440856.1_7 Reverse -340 -359 -4.13045 0.211
NP_441083.1_3 Forward -245 -235 14.4342 0.175
NP_441083.1_3 Reverse -300 -310 12.0743 0.287
NP_441083.1_5 Forward -367 -357 20.3345 0.00053
NP_441083.1_5 Forward -226 -216 20.3345 0.00053
NP_441083.1_5 Reverse -217 -227 11.3864 0.0159
NP_441083.1_5 Reverse -358 -368 11.2881 0.0159
NP_441083.1_5 Forward -184 -174 4.40493 0.146
NP_441083.1_5 Forward -274 -264 3.32329 0.173
NP_442827.1_8 Reverse -350 -369 15.8299 0.032
NP_442827.1_8 Reverse -209 -228 9.53674 0.07
NP_442827.1_8 Forward -375 -356 -1.47628 0.247
NP_441434.1_1 Reverse -112 -126 7.74647 0.267
NP_441434.1_7 Forward -182 -168 10.521 0.163
NP_441738.1_2 Forward -365 -358 15.28 0.0102
NP_441738.1_2 Reverse -360 -367 15.28 0.0102
NP_441738.1_2 Forward -224 -217 15.28 0.0102
NP_441738.1_2 Reverse -219 -226 15.28 0.0102
NP_441558.1_5 Forward -369 -350 21.7306 0.00259
NP_441558.1_5 Reverse -215 -234 10.6192 0.0955
NP_441558.1_5 Forward -318 -299 8.45592 0.15
NP_441558.1_5 Reverse -356 -375 5.70265 0.242
NP_440209.1_1 Reverse -358 -366 18.1123 0.00295
NP_440209.1_1 Reverse -217 -225 18.1123 0.00295
NP_440209.1_1 Forward -367 -359 18.1123 0.00295
NP_440209.1_1 Forward -226 -218 18.1123 0.00295
NP_442889.1_8 Forward -229 -215 13.5686 0.0588
NP_440447.1_6 Reverse -350 -368 1.59244 0.263
NP_440056.1_6 Reverse -170 -189 20.1517 0.149
NP_441713.1_1 Reverse -352 -371 -4.91709 0.113
NP_441713.1_1 Forward -232 -213 -14.4552 0.259
NP_441713.1_5 Forward -319 -300 5.80098 0.271
NP_442675.1_4 Forward -228 -210 -3.81576 0.257
NP_442675.1_4 Reverse -209 -227 -4.60241 0.257
NP_441770.1_4 Reverse -308 -327 -9.93197 0.263
NP_440178.1_7 Reverse -357 -376 6.4893 0.0145
NP_440178.1_7 Forward -227 -208 -12.7836 0.124
NP_440178.1_7 Reverse -216 -235 -13.7669 0.143
NP_440178.1_7 Forward -368 -349 -20.945 0.204
NP_440178.1_7 Forward -38 -19 -22.125 0.255
NP_440659.1_9 Reverse -158 -177 8.25926 0.297
NP_442570.1_3 Reverse -271 -290 -2.65548 0.212
NP_441025.1_5 Forward -309 -295 15.7325 0.257
NP_441792.1_5 Forward -321 -305 9.98996 0.234
NP_441716.1_1 Forward -367 -353 23.1074 0.00274
NP_441716.1_1 Reverse -211 -225 9.93102 0.103
NP_441716.1_1 Forward -44 -30 5.80112 0.216
NP_441716.1_1 Forward -226 -212 5.01447 0.243
NP_441716.1_1 Forward -38 -24 4.52282 0.255
NP_441716.1_5 Forward -184 -171 20.4715 0.133
NP_441716.1_6 Forward -217 -198 22.7139 0.0603
NP_441716.1_7 Forward -41 -22 22.3206 0.0646
NP_442111.1_4 Reverse -357 -371 10.521 0.0535
NP_442111.1_4 Forward -368 -354 7.17775 0.103
NP_442111.1_4 Reverse -34 -48 2.06454 0.291
NP_441495.1_1 Reverse -21 -40 14.0608 0.193
NP_440851.1_6 Forward -61 -44 1.51381 0.288
NP_440906.1_4 Forward -266 -247 13.2741 0.299
NP_440906.1_5 Forward -366 -359 15.8704 0.0124
NP_440906.1_5 Reverse -359 -366 15.8704 0.0124
NP_440906.1_5 Forward -225 -218 15.8704 0.0124
NP_440906.1_5 Reverse -218 -225 15.8704 0.0124
NP_440747.1_10 Reverse -214 -226 16.8536 0.00143
NP_440747.1_10 Reverse -355 -367 7.51213 0.00286
NP_440747.1_10 Forward -370 -358 -1.92764 0.0192
NP_440747.1_10 Forward -229 -217 -2.02597 0.0196
NP_440747.1_10 Forward -313 -301 -11.9574 0.178
NP_440747.1_10 Forward -47 -35 -12.2524 0.254
NP_440747.1_10 Forward -41 -29 -12.2524 0.254
NP_441130.1_10 Forward -228 -214 20.3541 0.00768
NP_441130.1_10 Reverse -356 -370 15.5359 0.0312
NP_441130.1_10 Forward -369 -355 10.226 0.117
NP_441130.1_10 Reverse -215 -229 6.58777 0.183
NP_441486.1_1 Forward -229 -215 13.2743 0.00871
NP_441486.1_1 Reverse -214 -228 11.2093 0.0168
NP_441486.1_1 Reverse -355 -369 -2.55701 0.175
NP_441486.1_1 Forward -370 -356 -3.147 0.176
NP_440944.1_2 Forward -238 -219 0.294447 0.256
NP_442634.1_4 Reverse -356 -370 4.52282 0.0764
NP_442634.1_4 Forward -369 -355 4.22782 0.0819
NP_442634.1_4 Reverse -215 -229 -2.06536 0.149
NP_441265.1_3 Reverse -352 -366 5.99778 0.181
NP_440403.1_4 Reverse -208 -227 -9.93197 0.288
NP_440403.1_10 Forward -325 -306 7.37428 0.208
NP_441695.1_4 Forward -224 -206 14.9655 0.17
NP_441014.1_8 Forward -51 -32 -3.24547 0.242
NP_441014.1_10 Reverse -216 -235 4.03023 0.205
NP_441014.1_10 Forward -311 -292 -3.34455 0.298
NP_442848.1_1 Reverse -352 -366 5.80112 0.0803
NP_442848.1_1 Forward -373 -359 -1.67204 0.263
NP_442848.1_1 Reverse -211 -225 -1.77037 0.263
NP_441012.1_4 Forward -314 -301 6.90245 0.276
NP_441012.1_4 Forward -42 -29 6.90245 0.276
NP_443018.1_3 Forward -366 -359 14.8871 0.0123
NP_443018.1_3 Reverse -359 -366 14.8871 0.0123
NP_443018.1_3 Forward -225 -218 14.8871 0.0123
NP_443018.1_3 Reverse -218 -225 14.8871 0.0123
NP_443018.1_3 Reverse -36 -43 10.2655 0.107
NP_441316.1_7 Forward -228 -213 -3.36336 0.273
NP_441634.1_8 Reverse -215 -229 14.7492 0.0248
NP_441634.1_8 Reverse -356 -370 5.89945 0.114
NP_441634.1_8 Forward -369 -355 -3.44199 0.295
NP_441634.1_8 Forward -327 -313 -3.54032 0.295
NP_441634.1_9 Forward -221 -202 10.6184 0.252
NP_440376.1_1 Forward -367 -358 19.4693 0.000692
NP_440376.1_1 Reverse -358 -367 19.4693 0.000692
NP_440376.1_1 Forward -226 -217 19.4693 0.000692
NP_440376.1_1 Reverse -217 -226 19.4693 0.000692
NP_440376.1_1 Forward -310 -301 3.93297 0.188
NP_440376.1_1 Reverse -273 -282 -0.000272808 0.285
NP_441588.1_4 Reverse -219 -229 6.96153 0.178
NP_442687.1_7 Forward -227 -217 15.8113 0.0125
NP_442687.1_7 Forward -368 -358 9.02648 0.0994
NP_442687.1_7 Reverse -357 -367 8.92815 0.0994
NP_442687.1_7 Reverse -216 -226 8.92815 0.0994
NP_442191.1_4 Reverse -5 -19 10.5083 0.298
NP_441797.1_7 Forward -55 -37 10.7372 0.286
NP_442485.1_3 Forward -222 -203 -2.16383 0.262
NP_441846.1_10 Reverse -166 -185 -1.37718 0.115
NP_441846.1_10 Reverse -301 -320 -23.4033 0.285
NP_442958.1_3 Forward -237 -218 -0.295539 0.267
NP_442958.1_3 Reverse -206 -225 -1.47551 0.277
NP_440642.1_10 Forward -33 -19 3.34225 0.275
NP_441013.1_2 Reverse -206 -224 2.77242 0.236
NP_441013.1_2 Forward -49 -31 2.47742 0.241
NP_440042.1_2 Forward -194 -175 1.67108 0.201
NP_441682.1_2 Forward -366 -347 2.55606 0.241
NP_441422.1_7 Forward -228 -211 3.87375 0.109
NP_441422.1_7 Reverse -356 -373 -5.76269 0.247
NP_442296.1_9 Forward -243 -224 -5.60541 0.288
NP_441763.1_10 Forward -237 -218 20.9431 0.035
NP_442658.1_1 Forward -369 -359 15.9091 0.00966
NP_442658.1_1 Forward -228 -218 15.9091 0.00966
NP_442658.1_1 Reverse -356 -366 9.616 0.147
NP_442658.1_1 Reverse -27 -37 9.02601 0.169
NP_442658.1_1 Reverse -215 -225 7.94438 0.199
NP_440141.1_4 Reverse -298 -317 6.68596 0.169
NP_440141.1_4 Reverse -304 -323 -11.2103 0.298
NP_440141.1_4 Reverse -32 -51 -11.8986 0.298
NP_440141.1_8 Reverse -20 -39 4.32602 0.291
NP_442782.1_2 Reverse -274 -288 5.70279 0.239
NP_442496.1_5 Reverse -21 -39 9.55725 0.218
NP_442205.1_9 Forward -373 -357 14.8082 0.0342
NP_442205.1_9 Forward -400 -384 -0.236458 0.264
NP_442205.1_9 Reverse -211 -227 -0.531451 0.264
NP_442205.1_9 Reverse -352 -368 -1.41643 0.264
NP_441414.1_9 Reverse -217 -236 6.19431 0.0416
NP_441414.1_9 Forward -367 -348 -4.03212 0.145
NP_441414.1_9 Forward -226 -207 -10.6203 0.29
NP_441487.1_9 Reverse -357 -376 -2.45882 0.293
NP_441256.1_1 Forward -223 -204 -7.08038 0.239
NP_442937.1_5 Reverse -302 -321 13.0775 0.095
NP_442321.1_4 Forward -47 -28 -5.99873 0.284
NP_441958.1_5 Forward -368 -358 21.2195 0.000805
NP_441958.1_5 Reverse -357 -367 12.2714 0.00183
NP_441958.1_5 Forward -227 -217 12.2714 0.00183
NP_441958.1_5 Reverse -216 -226 12.2714 0.00183
NP_442836.1_5 Reverse -211 -230 15.0441 0.0586
NP_440203.1_5 Forward -364 -354 9.02601 0.275
NP_439905.1_1 Forward -225 -212 20.8655 0.00648
NP_439905.1_1 Reverse -359 -372 9.85238 0.216
NP_439905.1_1 Forward -366 -353 8.57408 0.232
NP_440984.1_7 Forward -372 -358 19.2725 0.00863
NP_440984.1_7 Reverse -212 -226 11.6026 0.122
NP_440984.1_7 Forward -231 -217 11.3077 0.122
NP_440984.1_7 Reverse -65 -79 4.62115 0.296
NP_439990.1_5 Forward -43 -30 14.6706 0.0789
NP_439990.1_5 Forward -71 -58 5.91914 0.267
NP_442911.1_2 Reverse -348 -367 9.24257 0.018
NP_442911.1_2 Forward -377 -358 3.83436 0.0414
NP_442911.1_2 Forward -236 -217 3.53937 0.0428
NP_441580.1_6 Forward -237 -218 10.6192 0.0559
NP_440153.1_5 Reverse -359 -373 23.4024 0.00965
NP_440153.1_5 Forward -225 -211 3.24451 0.217
NP_440153.1_5 Forward -366 -352 2.94952 0.219
NP_440153.1_8 Forward -367 -354 5.03416 0.18
NP_441591.1_10 Forward -369 -350 7.66927 0.275
NP_443055.1_6 Forward -252 -234 2.08335 0.22
NP_443055.1_6 Forward -226 -208 -2.14486 0.29
NP_443055.1_6 Forward -324 -306 -2.53818 0.296
NP_440993.1_2 Forward -372 -356 20.2164 0.0237
NP_440993.1_2 Reverse -353 -369 3.10679 0.262
NP_440993.1_3 Reverse -348 -367 -0.00131823 0.26
NP_440993.1_4 Forward -238 -221 3.0871 0.294
NP_440934.1_1 Reverse -203 -222 8.55425 0.233
NP_440934.1_3 Reverse -167 -186 15.5357 0.0373
NP_440827.1_1 Reverse -11 -30 17.0107 0.202
NP_440602.1_8 Reverse -217 -231 9.5377 0.298
NP_441099.1_5 Reverse -348 -367 6.09597 0.0469
NP_441099.1_5 Reverse -207 -226 5.01433 0.0474
NP_441099.1_5 Forward -236 -217 -9.047 0.212
NP_441099.1_5 Forward -320 -301 -11.4069 0.28
NP_441099.1_5 Forward -194 -175 -11.4069 0.28
NP_442002.1_9 Forward -227 -220 10.7572 0.185
NP_441654.1_7 Forward -120 -101 10.8874 0.299
NP_440809.1_9 Reverse -349 -367 -7.35568 0.225
NP_441294.1_7 Forward -371 -357 16.0658 0.0176
NP_441294.1_7 Reverse -354 -368 14.0501 0.049
NP_441294.1_7 Forward -230 -216 9.4426 0.244
NP_441646.1_1 Reverse -351 -370 3.6377 0.206
NP_441646.1_1 Forward -51 -32 -0.885524 0.273
NP_441646.1_1 Forward -374 -355 -1.47551 0.287
NP_441646.1_7 Forward -192 -178 15.1426 0.247
NP_442438.1_10 Reverse -353 -367 12.291 0.0412
NP_442438.1_10 Forward -231 -217 9.83269 0.0602
NP_442438.1_10 Forward -372 -358 3.73617 0.157
NP_442438.1_10 Reverse -212 -226 2.65453 0.17
NP_442431.1_10 Reverse -304 -322 12.9988 0.0791
NP_442431.1_10 Reverse -172 -190 1.39578 0.254
NP_442431.1_10 Reverse -169 -187 0.412472 0.275
NP_441000.1_6 Forward -227 -213 4.22782 0.0964
NP_441000.1_6 Forward -185 -171 0.196253 0.197
NP_441000.1_6 Reverse -216 -230 -3.44199 0.221
NP_441000.1_6 Forward -368 -354 -5.01529 0.257
NP_441000.1_6 Reverse -357 -371 -5.50694 0.279
NP_442771.1_1 Reverse -27 -45 -10.1089 0.242
NP_441674.1_2 Forward -308 -289 3.73603 0.299
NP_441674.1_6 Forward -366 -347 9.73422 0.177
NP_440147.1_4 Forward -369 -356 13.0973 0.0326
NP_440147.1_4 Forward -228 -215 11.0324 0.0341
NP_440147.1_4 Reverse -356 -369 10.934 0.0346
NP_440147.1_4 Reverse -215 -228 7.39411 0.0695
NP_440147.1_4 Reverse -51 -64 -0.472371 0.287
NP_441550.1_8 Forward -369 -359 17.4824 0.00754
NP_441550.1_8 Reverse -356 -366 16.7941 0.00906
NP_441550.1_8 Reverse -215 -225 15.1225 0.0132
NP_441550.1_8 Forward -228 -218 6.0761 0.214
NP_441550.1_8 Reverse -173 -183 4.60114 0.299
NP_441916.1_7 Reverse -358 -368 18.9579 0.00144
NP_441916.1_7 Reverse -217 -227 18.4663 0.00144
NP_441916.1_7 Forward -367 -357 10.3048 0.0261
NP_441916.1_7 Forward -226 -216 10.3048 0.0261
NP_441916.1_7 Forward -62 -52 3.51995 0.213
NP_440206.1_4 Forward -320 -301 1.76863 0.289
NP_441041.1_4 Reverse -217 -236 8.55425 0.0331
NP_441041.1_4 Reverse -301 -320 6.88262 0.0415
NP_441041.1_4 Reverse -29 -48 -11.8003 0.252
NP_441041.1_4 Forward -367 -348 -12.0953 0.258
NP_441041.1_7 Forward -229 -217 10.916 0.0864
NP_441041.1_7 Forward -370 -358 8.97244 0.125
NP_442396.1_5 Forward -230 -217 6.90245 0.215
NP_443063.1_7 Reverse -300 -316 9.59664 0.224
NP_442004.1_6 Forward -226 -212 10.9143 0.134
NP_442004.1_6 Forward -367 -353 8.65272 0.14
NP_441725.1_5 Reverse -218 -228 11.2881 0.0247
NP_441725.1_5 Forward -366 -356 9.02648 0.0553
NP_441725.1_5 Reverse -359 -369 8.92815 0.0553
NP_441725.1_5 Forward -37 -27 7.05986 0.106
NP_441725.1_5 Forward -225 -215 2.04498 0.115
NP_439966.1_7 Forward -228 -218 18.4657 0.00473
NP_439966.1_7 Reverse -215 -225 15.3192 0.0152
NP_439966.1_7 Reverse -356 -366 14.8275 0.0177
NP_439966.1_7 Forward -369 -359 13.8442 0.0234
NP_439966.1_7 Forward -20 -10 8.04271 0.142
NP_439966.1_7 Forward -186 -176 4.01116 0.295
NP_439966.1_9 Forward -369 -360 0.983037 0.253
NP_439966.1_9 Forward -228 -219 0.983037 0.253
NP_439966.1_9 Reverse -356 -365 0.884706 0.253
NP_442941.1_3 Forward -225 -215 19.2529 0.00262
NP_442941.1_3 Reverse -218 -228 11.4848 0.0116
NP_442941.1_3 Forward -366 -356 10.9931 0.0116
NP_442941.1_3 Reverse -359 -369 10.9931 0.0116
NP_440289.1_2 Forward -229 -216 21.3571 0.00262
NP_440289.1_2 Forward -370 -357 2.2809 0.1
NP_440289.1_2 Reverse -214 -227 -3.52063 0.267
NP_440289.1_2 Reverse -355 -368 -4.60227 0.29
NP_440983.1_5 Forward -322 -303 -8.06369 0.294
NP_440983.1_9 Reverse -208 -227 11.0125 0.202
NP_440260.1_8 Forward -60 -42 -2.73412 0.245
NP_442281.1_1 Forward -231 -217 19.0751 0.00329
NP_442281.1_1 Forward -242 -228 8.84875 0.075
NP_442281.1_1 Reverse -30 -44 7.76712 0.0927
NP_442281.1_1 Forward -372 -358 6.68548 0.118
NP_442281.1_1 Reverse -212 -226 5.99717 0.139
NP_442281.1_1 Forward -49 -35 5.01387 0.172
NP_442281.1_1 Forward -42 -28 2.45727 0.266
NP_441334.1_7 Forward -369 -350 -1.37718 0.0599
NP_441334.1_7 Reverse -356 -375 -12.2919 0.146
NP_442256.1_2 Reverse -356 -374 0.21581 0.126
NP_442256.1_2 Reverse -215 -233 -7.45401 0.214
NP_440437.1_1 Forward -232 -213 2.94938 0.127
NP_442012.1_1 Reverse -352 -371 1.86774 0.21
NP_442012.1_5 Reverse -300 -319 -0.688862 0.288
NP_441087.1_6 Forward -185 -167 -2.63651 0.296
NP_441457.1_7 Reverse -356 -375 2.75272 0.255
NP_441457.1_7 Forward -369 -350 -0.295539 0.288
NP_441457.1_7 Forward -67 -48 -0.39387 0.291
NP_441556.1_6 Forward -134 -116 14.011 0.296
NP_441556.1_10 Reverse -212 -226 17.4247 0.0841
NP_440498.1_1 Forward -235 -217 12.4089 0.062
NP_440498.1_1 Forward -211 -193 -1.84914 0.232
NP_440498.1_1 Forward -376 -358 -2.63579 0.244
NP_442982.1_5 Forward -377 -358 5.99764 0.156
NP_443030.1_4 Reverse -294 -313 -7.08038 0.294
NP_441644.1_6 Reverse -358 -368 19.0557 0.000803
NP_441644.1_6 Forward -367 -357 17.3841 0.00127
NP_441644.1_6 Forward -226 -216 17.3841 0.00127
NP_441644.1_6 Reverse -217 -227 10.1076 0.0628
NP_441644.1_6 Forward -184 -174 7.74772 0.117
NP_441644.1_6 Reverse -307 -317 7.55106 0.123
NP_441644.1_6 Forward -38 -28 5.68278 0.18
NP_441644.1_6 Forward -44 -34 4.99446 0.216
NP_441644.1_6 Reverse -301 -311 3.71617 0.267
NP_440867.1_10 Forward -53 -34 9.14423 0.25
NP_442215.1_2 Reverse -215 -231 4.68009 0.0831
NP_442215.1_2 Reverse -26 -42 2.71347 0.111
NP_442215.1_2 Forward -53 -37 -5.64466 0.254
NP_442215.1_2 Forward -47 -31 -7.0213 0.284
NP_440253.1_2 Reverse -358 -376 -1.45582 0.242
NP_440929.1_8 Forward -367 -358 19.2726 0.000701
NP_440929.1_8 Reverse -358 -367 19.2726 0.000701
NP_440929.1_8 Forward -226 -217 19.2726 0.000701
NP_440929.1_8 Reverse -217 -226 19.2726 0.000701
NP_440780.1_1 Forward -131 -112 10.8379 0.254
NP_442933.1_10 Forward -367 -358 17.601 0.00325
NP_442933.1_10 Reverse -358 -367 17.601 0.00325
NP_442933.1_10 Forward -226 -217 17.601 0.00325
NP_442933.1_10 Reverse -217 -226 17.601 0.00325
NP_441751.2_8 Forward -225 -211 12.586 0.0191
NP_441751.2_8 Forward -366 -352 4.91614 0.0453
NP_441751.2_8 Reverse -218 -232 -4.03198 0.158
NP_441751.2_8 Forward -43 -29 -6.39192 0.265
NP_442554.1_8 Reverse -359 -369 19.1546 0.00369
NP_442554.1_8 Forward -366 -356 18.0729 0.00543
NP_442554.1_8 Forward -225 -215 16.2046 0.0065
NP_442554.1_8 Reverse -218 -228 13.8447 0.0145
NP_442554.1_8 Forward -315 -305 6.17489 0.125
NP_442554.1_8 Forward -43 -33 3.91327 0.203
NP_442554.1_8 Reverse -36 -46 3.51995 0.222
NP_442075.1_10 Reverse -217 -236 11.5042 0.282
NP_441762.1_7 Reverse -216 -228 2.89058 0.0676
NP_441762.1_7 Forward -368 -356 2.79224 0.0676
NP_441762.1_7 Reverse -357 -369 2.59558 0.0676
NP_441762.1_7 Forward -227 -215 2.39892 0.0676
NP_441762.1_7 Reverse -174 -186 -6.2542 0.284
NP_442142.1_4 Forward -229 -216 15.85 0.0264
NP_442142.1_4 Forward -319 -306 14.375 0.0311
NP_442142.1_4 Reverse -214 -227 6.90188 0.153
NP_442142.1_4 Forward -223 -210 6.11523 0.173
NP_442142.1_4 Forward -313 -300 5.13193 0.201
NP_442142.1_4 Reverse -355 -368 4.93527 0.206
NP_442142.1_4 Forward -370 -357 3.7553 0.246
NP_442142.1_4 Forward -47 -34 3.16532 0.265
NP_442292.1_1 Forward -366 -357 18.486 0.00229
NP_442292.1_1 Forward -225 -216 18.486 0.00229
NP_442292.1_1 Reverse -359 -368 17.5026 0.00435
NP_442292.1_1 Reverse -218 -227 9.63616 0.0183
NP_442292.1_5 Reverse -213 -232 0.491109 0.257
NP_440919.1_1 Reverse -44 -63 -6.88371 0.266
NP_442476.1_6 Forward -225 -211 12.1926 0.0509
NP_442476.1_6 Reverse -218 -232 7.37441 0.114
NP_442476.1_6 Reverse -359 -373 4.71948 0.142
NP_442476.1_6 Forward -366 -352 3.63784 0.155
NP_440895.1_6 Reverse -211 -224 9.55739 0.22
NP_442381.1_8 Forward -229 -210 -14.2585 0.28
NP_443009.1_2 Forward -42 -23 2.94938 0.216
NP_443009.1_5 Reverse -216 -227 18.3477 0.00265
NP_443009.1_5 Reverse -357 -368 14.5128 0.02
NP_443009.1_5 Forward -368 -357 10.1862 0.0792
NP_443009.1_10 Reverse -327 -345 12.5072 0.107
NP_442301.1_2 Forward -194 -175 11.5033 0.159
NP_442301.1_8 Reverse -10 -29 12.3892 0.21
NP_441715.1_4 Forward -225 -215 17.3846 0.0106
NP_441715.1_4 Reverse -218 -228 16.303 0.0117
NP_441715.1_4 Forward -366 -356 7.84651 0.107
NP_441715.1_4 Reverse -359 -369 7.25653 0.108
NP_441715.1_4 Forward -219 -209 7.05986 0.118
NP_440357.1_3 Forward -369 -350 3.93269 0.242
NP_440357.1_3 Forward -228 -209 0.294447 0.285
NP_440357.1_3 Forward -195 -176 -0.39387 0.295
NP_440015.1_9 Forward -226 -208 -1.75081 0.292
NP_441448.1_1 Reverse -299 -318 3.73603 0.292
NP_442076.1_8 Forward -378 -359 10.9142 0.203
NP_441198.1_8 Forward -369 -359 15.4199 0.0427
NP_440379.1_5 Forward -325 -306 -5.31042 0.222
NP_440379.1_5 Forward -367 -348 -8.65367 0.253
NP_440379.1_5 Reverse -202 -221 -11.2103 0.291
NP_441468.1_1 Forward -366 -359 15.8704 0.0124
NP_441468.1_1 Reverse -359 -366 15.8704 0.0124
NP_441468.1_1 Forward -225 -218 15.8704 0.0124
NP_441468.1_1 Reverse -218 -225 15.8704 0.0124
NP_441015.1_10 Forward -372 -353 -0.295539 0.169
NP_441015.1_10 Reverse -212 -231 -3.04881 0.184
NP_441015.1_10 Reverse -302 -321 -6.58872 0.252
NP_441673.1_1 Forward -367 -358 20.8459 0.000698
NP_441673.1_1 Reverse -358 -367 20.8459 0.000698
NP_441673.1_1 Forward -226 -217 20.8459 0.000698
NP_441673.1_1 Reverse -217 -226 20.8459 0.000698
NP_441673.1_1 Reverse -301 -310 -8.06341 0.254
NP_441876.1_9 Forward -22 -12 15.1225 0.267
NP_441826.1_2 Forward -232 -218 4.22782 0.104
NP_441826.1_2 Forward -373 -359 3.73617 0.106
NP_441826.1_2 Reverse -352 -366 3.04785 0.115
NP_441826.1_2 Reverse -29 -43 2.75286 0.12
NP_441826.1_2 Forward -44 -30 2.45787 0.127
NP_441826.1_2 Forward -316 -302 -0.0987402 0.204
NP_441826.1_2 Reverse -50 -64 -1.96703 0.261
NP_441826.1_2 Reverse -301 -315 -3.54032 0.286
NP_441826.1_2 Reverse -211 -225 -4.13031 0.292
NP_442868.1_6 Reverse -215 -225 19.2529 0.00563
NP_442868.1_6 Reverse -356 -366 17.4829 0.012
NP_442868.1_6 Forward -369 -359 8.63316 0.0555
NP_442868.1_6 Forward -228 -218 0.963343 0.205
NP_441056.1_1 Forward -226 -207 -7.86702 0.279
NP_441612.1_2 Forward -367 -357 8.54929 0.21
NP_441612.1_2 Forward -226 -216 8.54929 0.21
NP_442227.1_8 Reverse -319 -337 18.3087 0.281
NP_443058.1_7 Reverse -216 -235 2.45773 0.287
NP_442361.1_3 Reverse -161 -174 7.49244 0.3
NP_442427.1_8 Forward -376 -357 12.4875 0.152
NP_442427.1_8 Forward -235 -216 8.06259 0.203
NP_442808.1_1 Forward -227 -217 18.4657 0.00201
NP_442808.1_1 Forward -368 -358 8.73102 0.0481
NP_442808.1_1 Reverse -357 -367 8.63269 0.0481
NP_442808.1_1 Reverse -216 -226 8.63269 0.0481
NP_442808.1_1 Forward -185 -175 7.35439 0.0814
NP_440145.1_3 Reverse -165 -184 -3.93378 0.214
NP_440145.1_3 Forward -377 -358 -4.72043 0.245
NP_440145.1_4 Forward -183 -173 16.0075 0.17
NP_442542.1_2 Forward -228 -215 9.45906 0.134
NP_442542.1_2 Reverse -299 -312 8.18076 0.16
NP_442542.1_2 Reverse -27 -40 5.91914 0.244
NP_442050.1_5 Forward -369 -359 17.1874 0.00812
NP_442050.1_5 Reverse -356 -366 15.6142 0.01
NP_442050.1_5 Reverse -215 -225 14.3359 0.0206
NP_442050.1_5 Forward -228 -218 9.12434 0.193
NP_440601.1_8 Reverse -207 -226 16.7985 0.175
NP_440558.1_2 Forward -319 -300 17.0107 0.0626
NP_440558.1_2 Forward -247 -228 8.25926 0.113
NP_440558.1_2 Reverse -297 -316 -3.83545 0.239
NP_440558.1_2 Forward -196 -177 -7.4737 0.294
NP_440274.1_2 Forward -18 -4 13.8636 0.236
NP_441518.1_3 Reverse -348 -367 -13.6686 0.264
NP_441878.1_6 Forward -368 -358 10.5014 0.0176
NP_441878.1_6 Reverse -357 -367 10.4031 0.0176
NP_441878.1_6 Forward -227 -217 10.4031 0.0176
NP_441878.1_6 Reverse -216 -226 10.4031 0.0176
NP_441878.1_6 Forward -45 -35 10.4031 0.0176
NP_441878.1_6 Reverse -28 -38 2.33998 0.0405
NP_441878.1_6 Reverse -34 -44 0.668351 0.139
NP_441878.1_6 Reverse -300 -310 -6.60814 0.193
NP_441878.1_6 Reverse -46 -56 -7.78811 0.266
NP_441036.1_8 Forward -227 -217 17.7779 0.000554
NP_441036.1_8 Forward -368 -358 15.713 0.00724
NP_441036.1_8 Reverse -357 -367 8.33817 0.174
NP_441036.1_8 Reverse -216 -226 8.33817 0.174
NP_441557.1_5 Forward -367 -358 19.9609 0.000699
NP_441557.1_5 Reverse -358 -367 19.9609 0.000699
NP_441557.1_5 Forward -226 -217 19.9609 0.000699
NP_441557.1_5 Reverse -217 -226 19.9609 0.000699
NP_441557.1_8 Forward -55 -45 14.6309 0.183
NP_441445.1_1 Reverse -349 -368 6.98095 0.138
NP_441445.1_1 Forward -376 -357 3.53937 0.212
NP_441445.1_1 Reverse -208 -227 0.687771 0.27
NP_442066.2_9 Reverse -213 -226 10.934 0.154
NP_442066.2_9 Forward -230 -217 9.36073 0.175
NP_442777.1_3 Forward -323 -305 9.75313 0.158
NP_441739.1_2 Reverse -371 -387 4.48275 0.245
NP_441308.1_8 Forward -369 -359 12.4681 0.218
NP_441308.1_8 Forward -228 -218 10.1081 0.22
NP_441381.1_6 Reverse -104 -123 13.0775 0.199
NP_440101.1_3 Reverse -212 -231 9.53756 0.134
NP_440101.1_5 Forward -233 -214 1.27776 0.256
NP_440101.1_10 Reverse -301 -320 6.68596 0.195
NP_440101.1_10 Forward -68 -49 1.47442 0.289
NP_442183.1_1 Reverse -217 -231 13.4709 0.0423
NP_442183.1_1 Reverse -358 -372 6.6861 0.164
NP_442183.1_1 Forward -226 -212 6.6861 0.164
NP_442397.1_9 Forward -233 -214 3.14605 0.264
NP_441574.1_1 Reverse -295 -314 -6.29373 0.276
NP_441549.1_9 Reverse -354 -372 8.86894 0.0579
NP_441549.1_9 Reverse -213 -231 5.62401 0.0925
NP_441549.1_9 Forward -371 -353 -7.65067 0.209
NP_442347.1_2 Forward -366 -357 12.4878 0.056
NP_442347.1_2 Forward -225 -216 12.4878 0.056
NP_442347.1_2 Reverse -218 -227 11.1111 0.056
NP_442347.1_2 Forward -273 -264 6.09625 0.191
NP_442347.1_2 Reverse -359 -368 3.34298 0.284
NP_442645.1_2 Reverse -209 -228 -4.72043 0.0608
NP_442645.1_2 Forward -318 -299 -18.6834 0.278
NP_441037.1_4 Forward -369 -359 16.5761 0.0168
NP_441037.1_4 Reverse -356 -366 9.55921 0.21
NP_441037.1_4 Forward -228 -218 7.02532 0.237
NP_442594.1_8 Reverse -166 -185 5.80098 0.239
NP_441633.1_3 Reverse -215 -228 10.7374 0.0286
NP_441633.1_3 Reverse -356 -369 3.65753 0.0699
NP_441633.1_3 Forward -369 -356 -3.4223 0.177
NP_441633.1_3 Forward -228 -215 -3.71729 0.177
NP_440136.1_2 Forward -366 -359 15.9687 0.0123
NP_440136.1_2 Reverse -359 -366 15.9687 0.0123
NP_440136.1_2 Forward -225 -218 15.9687 0.0123
NP_440136.1_2 Reverse -218 -225 15.9687 0.0123
NP_442590.1_10 Reverse -211 -230 4.81767 0.27
NP_442998.1_2 Forward -192 -173 7.07848 0.25
NP_442998.1_5 Forward -122 -112 8.4365 0.263
NP_442998.1_10 Forward -365 -358 15.5754 0.0102
NP_442998.1_10 Reverse -360 -367 15.5754 0.0102
NP_442998.1_10 Forward -224 -217 15.5754 0.0102
NP_442998.1_10 Reverse -219 -226 15.5754 0.0102
NP_440731.1_2 Reverse -301 -320 4.71934 0.293
NP_440731.1_2 Forward -238 -219 4.32602 0.293
NP_440299.1_1 Reverse -354 -367 15.7516 0.0142
NP_440299.1_1 Reverse -213 -226 8.18017 0.0964
NP_440299.1_1 Forward -314 -301 7.98351 0.1
NP_440299.1_1 Forward -42 -29 7.59019 0.109
NP_440299.1_1 Forward -83 -70 2.28034 0.292
NP_440299.1_1 Forward -230 -217 2.18201 0.294
NP_441799.1_1 Reverse -213 -227 19.8618 0.00596
NP_441799.1_1 Reverse -354 -368 16.3219 0.0152
NP_441799.1_1 Forward -371 -357 15.2402 0.0197
NP_441799.1_1 Forward -230 -216 11.012 0.0629
NP_441799.1_1 Reverse -49 -63 5.1122 0.223
NP_440640.1_6 Reverse -301 -320 0.884433 0.266
NP_442802.1_6 Forward -368 -349 -0.39387 0.204
NP_441007.1_10 Forward -372 -359 11.229 0.0646
NP_441007.1_10 Reverse -212 -225 10.8357 0.0646
NP_441007.1_10 Forward -231 -218 3.26421 0.182
NP_441007.1_10 Reverse -353 -366 1.9859 0.202
NP_441007.1_10 Reverse -302 -315 -0.964025 0.296
NP_440256.1_1 Reverse -214 -233 1.57275 0.0733
NP_440256.1_1 Reverse -355 -374 -1.27885 0.102
NP_440256.1_1 Forward -229 -210 -8.752 0.266
NP_440087.1_1 Reverse -208 -227 -1.08219 0.196
NP_441512.1_6 Forward -317 -298 15.7316 0.139
NP_441559.1_8 Reverse -353 -367 0.491246 0.166
NP_441559.1_8 Forward -197 -183 -3.34366 0.201
NP_441559.1_8 Reverse -296 -310 -6.29359 0.276
NP_441559.1_8 Reverse -212 -226 -6.49025 0.279
NP_441559.1_8 Forward -287 -273 -7.47356 0.294
NP_440915.1_6 Reverse -354 -368 11.8976 0.0236
NP_440915.1_6 Reverse -303 -317 2.16287 0.124
NP_440915.1_6 Reverse -44 -58 -2.75368 0.28
NP_440915.1_6 Forward -230 -216 -3.24533 0.292
NP_442855.1_3 Reverse -208 -227 16.6174 0.149
NP_440717.1_3 Forward -23 -9 10.0287 0.241
NP_440717.1_3 Forward -181 -167 9.14375 0.25
NP_442785.1_7 Forward -228 -214 11.2093 0.228
NP_441704.1_8 Reverse -347 -366 14.6499 0.096
NP_441704.1_8 Reverse -206 -225 5.30853 0.297
NP_442069.1_10 Forward -225 -207 16.8337 0.0593
NP_442866.1_4 Forward -37 -18 3.34271 0.291
NP_440748.1_5 Reverse -198 -217 -2.45882 0.274
NP_441464.1_1 Forward -286 -267 7.47261 0.261
NP_441464.1_8 Forward -367 -353 8.55439 0.194
NP_441464.1_10 Reverse -7 -21 16.0275 0.164
NP_440695.1_6 Reverse -340 -354 10.6053 0.265
NP_440188.1_4 Forward -237 -218 9.14423 0.252
NP_441939.1_3 Forward -225 -206 11.8975 0.107
NP_441939.1_3 Reverse -359 -378 6.58763 0.231
NP_441199.1_6 Forward -371 -352 0.687771 0.237
NP_441494.1_6 Forward -372 -359 7.09911 0.267
NP_439985.1_7 Reverse -352 -371 12.0942 0.163
NP_442993.1_1 Reverse -217 -233 0.156866 0.0653
NP_442993.1_1 Forward -226 -210 -10.5612 0.222
NP_440677.1_6 Reverse -6 -25 8.75091 0.276
NP_442386.1_9 Forward -227 -218 15.7322 0.0144
NP_442386.1_9 Reverse -357 -366 13.8639 0.0289
NP_442386.1_9 Reverse -216 -225 13.8639 0.0289
NP_442386.1_9 Forward -368 -359 6.39082 0.219
NP_440570.1_5 Forward -320 -301 2.65439 0.234
NP_440570.1_5 Forward -48 -29 -3.44213 0.289
NP_441750.1_1 Reverse -301 -320 -12.0953 0.3
NP_441750.1_1 Reverse -35 -54 -13.0786 0.3
NP_441340.1_5 Forward -366 -359 15.6737 0.0124
NP_441340.1_5 Reverse -359 -366 15.6737 0.0124
NP_441340.1_5 Forward -225 -218 15.6737 0.0124
NP_441340.1_5 Reverse -218 -225 15.6737 0.0124
NP_442791.1_5 Reverse -209 -228 -7.4737 0.279
NP_440168.1_4 Forward -320 -301 -4.91709 0.255
NP_440168.1_4 Forward -326 -307 -6.98204 0.265
NP_440168.1_8 Forward -322 -303 1.17943 0.3
NP_440327.1_6 Reverse -301 -320 4.42435 0.274
NP_442506.1_2 Forward -237 -218 5.11266 0.269
NP_442240.1_2 Reverse -359 -378 -5.99873 0.11
NP_440586.1_1 Reverse -297 -316 3.93269 0.202
NP_440586.1_1 Reverse -210 -229 -4.32711 0.278
NP_440586.1_1 Reverse -246 -265 -5.21209 0.282
NP_440586.1_8 Forward -366 -359 13.2151 0.026
NP_440586.1_8 Forward -225 -218 13.2151 0.026
NP_440586.1_8 Reverse -359 -366 13.2151 0.026
NP_440586.1_8 Reverse -218 -225 13.2151 0.026
NP_440586.1_8 Reverse -36 -43 9.08521 0.178
NP_440586.1_8 Reverse -308 -315 5.8403 0.283
NP_440586.1_9 Reverse -210 -229 11.2092 0.258
NP_442251.1_6 Forward -366 -359 15.2804 0.0124
NP_442251.1_6 Reverse -359 -366 15.2804 0.0124
NP_442251.1_6 Forward -225 -218 15.2804 0.0124
NP_442251.1_6 Reverse -218 -225 15.2804 0.0124
NP_440192.1_4 Forward -369 -350 14.8307 0.169
NP_440684.1_9 Reverse -313 -327 10.226 0.209
NP_440684.1_9 Reverse -211 -225 9.04604 0.221
NP_441262.1_3 Reverse -358 -365 14.7888 0.0223
NP_441262.1_3 Reverse -217 -224 14.7888 0.0223
NP_441262.1_3 Forward -367 -360 14.7888 0.0223
NP_441262.1_3 Forward -226 -219 14.7888 0.0223
NP_440027.1_3 Forward -316 -298 5.72158 0.237
NP_440027.1_3 Reverse -43 -61 3.75497 0.267
NP_440027.1_3 Forward -226 -208 2.77167 0.286
NP_440027.1_3 Reverse -207 -225 2.47668 0.289
NP_440027.1_8 Forward -41 -22 6.39016 0.271
NP_443051.1_1 Forward -368 -359 19.5676 0.00335
NP_443051.1_1 Reverse -357 -366 10.4228 0.00754
NP_443051.1_1 Reverse -216 -225 10.4228 0.00754
NP_443051.1_1 Forward -227 -218 10.4228 0.00754
NP_441232.1_10 Reverse -347 -366 16.0274 0.045
NP_439937.1_8 Forward -228 -209 -3.24547 0.266
NP_439937.1_9 Forward -368 -351 -4.58339 0.157
NP_439937.1_9 Reverse -357 -374 -14.3181 0.287
NP_439937.1_9 Forward -194 -177 -14.3181 0.287
NP_441595.1_5 Forward -65 -47 5.13236 0.262
NP_440408.1_7 Forward -226 -207 16.9124 0.118
NP_440439.1_1 Forward -370 -357 12.6056 0.0238
NP_440439.1_1 Reverse -214 -227 11.4257 0.033
NP_440439.1_1 Reverse -355 -368 10.5407 0.0365
NP_440439.1_1 Forward -229 -216 1.19926 0.159
NP_442239.1_8 Reverse -207 -226 10.9142 0.239
NP_440372.1_2 Forward -366 -359 16.3621 0.0124
NP_440372.1_2 Reverse -359 -366 16.3621 0.0124
NP_440372.1_2 Forward -225 -218 16.3621 0.0124
NP_440372.1_2 Reverse -218 -225 16.3621 0.0124
NP_440171.1_3 Reverse -180 -199 4.81767 0.284
NP_441789.1_7 Forward -185 -166 9.53674 0.193
NP_441789.1_7 Forward -36 -17 -3.14789 0.268
NP_442722.1_8 Reverse -203 -222 17.5024 0.273
NP_440378.1_7 Reverse -253 -272 14.5524 0.166
NP_440316.1_10 Reverse -10 -20 7.84651 0.245
NP_440316.1_10 Reverse -174 -184 7.45319 0.251
NP_439977.1_5 Reverse -352 -371 -1.37718 0.25
NP_440139.1_1 Reverse -211 -230 4.91521 0.17
NP_441572.1_7 Forward -232 -213 12.9791 0.0366
NP_442887.1_5 Reverse -21 -40 -13.0786 0.281
NP_442384.1_10 Forward -226 -213 20.5705 0.00245
NP_442384.1_10 Forward -367 -354 11.9173 0.0319
NP_442384.1_10 Reverse -217 -230 6.50913 0.0995
NP_442384.1_10 Reverse -29 -42 3.46087 0.19
NP_442384.1_10 Reverse -358 -371 1.9859 0.24
NP_442384.1_10 Reverse -35 -48 1.10092 0.268
NP_441877.1_7 Reverse -206 -225 4.81688 0.218
NP_441631.1_6 Forward -318 -299 17.2074 0.238
NP_441018.1_7 Reverse -213 -232 9.63589 0.22
NP_442790.1_4 Reverse -208 -227 -9.14533 0.18
NP_442262.1_10 Forward -366 -359 14.1988 0.0123
NP_442262.1_10 Reverse -359 -366 14.1988 0.0123
NP_442262.1_10 Forward -225 -218 14.1988 0.0123
NP_442262.1_10 Reverse -218 -225 14.1988 0.0123
NP_442262.1_10 Reverse -36 -43 9.18389 0.211
NP_441689.1_5 Forward -228 -218 8.53436 0.132
NP_441689.1_5 Forward -369 -359 8.43603 0.132
NP_441689.1_5 Reverse -356 -366 5.87944 0.197
NP_441689.1_5 Reverse -215 -225 5.78111 0.197
NP_440163.1_10 Forward -229 -219 15.2213 0.0762
NP_440163.1_10 Reverse -32 -42 13.5497 0.122
NP_440163.1_10 Forward -41 -31 12.9597 0.14
NP_440163.1_10 Forward -313 -303 12.0747 0.169
NP_440344.1_10 Forward -233 -216 3.97208 0.0256
NP_440344.1_10 Reverse -351 -368 -11.6625 0.223
NP_440282.1_10 Reverse -207 -226 -3.24547 0.237
NP_440282.1_10 Reverse -19 -38 -9.047 0.269
NP_440531.1_6 Reverse -209 -228 11.9958 0.0545
NP_440531.1_6 Forward -234 -215 -0.000545616 0.2
NP_440531.1_6 Reverse -55 -74 -4.52377 0.282
NP_441965.1_3 Reverse -207 -226 4.12936 0.177
NP_441965.1_10 Forward -229 -213 16.5781 0.0438
NP_441965.1_10 Reverse -214 -230 5.86006 0.196
NP_441640.1_8 Reverse -30 -49 -1.08219 0.206
NP_442693.1_7 Forward -227 -208 15.0441 0.202
NP_442693.1_8 Forward -194 -175 17.7965 0.167
NP_440297.1_9 Reverse -218 -228 9.32148 0.0917
NP_440297.1_9 Forward -37 -27 6.96153 0.161
NP_440297.1_9 Forward -282 -272 1.25834 0.282
NP_440297.1_9 Forward -225 -215 -0.118297 0.282
NP_440297.1_9 Reverse -36 -46 -0.118297 0.282
NP_440297.1_9 Forward -366 -356 -0.216628 0.282
NP_440297.1_9 Reverse -359 -369 -0.314959 0.282
NP_440297.1_9 Forward -43 -33 -0.511621 0.289
NP_441592.1_4 Forward -226 -207 -0.0988766 0.237
NP_441896.1_3 Reverse -349 -368 0.491109 0.225
NP_440894.1_10 Forward -42 -23 7.66927 0.197
NP_440894.1_10 Reverse -296 -315 2.45773 0.29
NP_440999.1_5 Forward -263 -244 7.37347 0.291
NP_440999.1_9 Forward -230 -216 11.111 0.0474
NP_440999.1_9 Forward -371 -357 2.45787 0.149
NP_440999.1_9 Reverse -52 -66 1.08123 0.171
NP_440999.1_9 Reverse -354 -368 -0.197071 0.201
NP_440999.1_9 Reverse -213 -227 -2.95034 0.281
NP_440888.1_2 Forward -367 -353 19.0751 0.00173
NP_440888.1_2 Reverse -358 -372 17.0102 0.00497
NP_440888.1_2 Reverse -217 -231 16.2235 0.00758
NP_440888.1_2 Forward -226 -212 14.3553 0.0187
NP_440888.1_2 Forward -310 -296 8.75042 0.149
NP_440888.1_2 Reverse -183 -197 5.30886 0.284
NP_440600.1_4 Forward -375 -357 -0.0791831 0.146
NP_440600.1_4 Reverse -209 -227 -4.79907 0.269
NP_440822.1_1 Forward -26 -7 13.5487 0.232
NP_440179.1_6 Forward -366 -347 13.0775 0.128
NP_442277.1_4 Reverse -349 -368 3.73524 0.216
NP_442277.1_4 Forward -376 -357 1.17865 0.286
NP_442033.1_10 Reverse -356 -375 -7.57203 0.186
NP_442033.1_10 Forward -369 -350 -13.6686 0.287
NP_442033.1_10 Forward -228 -209 -14.2585 0.298
NP_441949.1_2 Reverse -348 -367 9.14423 0.261
NP_441917.1_2 Reverse -304 -322 14.9655 0.152
NP_441917.1_2 Reverse -32 -50 7.19731 0.288
NP_441543.1_2 Reverse -218 -227 18.486 0.00236
NP_441543.1_2 Forward -366 -357 16.9127 0.00359
NP_441543.1_2 Forward -225 -216 16.9127 0.00359
NP_441543.1_2 Reverse -359 -368 15.9293 0.00518
NP_442845.1_2 Reverse -211 -225 11.406 0.131
NP_442845.1_2 Reverse -301 -315 6.29277 0.212
NP_442845.1_2 Forward -232 -218 6.09611 0.217
NP_442845.1_2 Reverse -352 -366 5.60446 0.228
NP_442845.1_2 Reverse -29 -43 4.12949 0.267
NP_442845.1_2 Forward -373 -359 3.93283 0.272
NP_441551.1_5 Reverse -354 -370 18.3473 0.0365
NP_441319.1_8 Reverse -352 -370 15.3588 0.0893
NP_442710.1_7 Reverse -110 -129 -7.60718 0.296
NP_441469.1_8 Forward -227 -218 16.126 0.00797
NP_441469.1_8 Reverse -300 -309 10.6195 0.206
NP_441469.1_8 Forward -368 -359 6.5879 0.227
NP_441469.1_8 Reverse -357 -366 6.48957 0.227
NP_441469.1_8 Reverse -216 -225 6.48957 0.227
NP_443064.1_6 Forward -367 -357 12.5669 0.0796
NP_443064.1_6 Forward -226 -216 12.5669 0.0796
NP_443064.1_6 Reverse -358 -368 10.8217 0.13
NP_443064.1_6 Reverse -273 -283 9.75513 0.199
NP_442337.1_8 Reverse -347 -366 3.34271 0.216
NP_442578.1_7 Forward -366 -359 14.5921 0.026
NP_442578.1_7 Forward -225 -218 14.5921 0.026
NP_442578.1_7 Reverse -359 -366 14.5921 0.026
NP_442578.1_7 Reverse -218 -225 14.5921 0.026
NP_440710.1_1 Forward -184 -166 -7.749 0.244
NP_441462.1_2 Reverse -358 -368 20.2362 0.000805
NP_441462.1_2 Forward -367 -357 11.5831 0.00406
NP_441462.1_2 Forward -226 -216 11.5831 0.00406
NP_441462.1_2 Reverse -217 -227 11.5831 0.00406
NP_441621.1_7 Reverse -356 -370 4.52282 0.0934
NP_441621.1_7 Forward -369 -355 -2.85201 0.188
NP_441621.1_7 Reverse -305 -319 -4.81863 0.246
NP_443062.1_1 Reverse -217 -235 17.3216 0.0254
NP_443062.1_6 Reverse -293 -312 7.66927 0.162
NP_443062.1_6 Forward -234 -215 4.32602 0.221
NP_443062.1_6 Reverse -350 -369 3.83436 0.228
NP_442204.1_1 Forward -87 -76 2.91027 0.266
NP_442204.1_1 Reverse -207 -218 1.14031 0.28
NP_442204.1_1 Forward -48 -37 0.746988 0.281
NP_442204.1_1 Forward -371 -360 0.451995 0.281
NP_442204.1_1 Reverse -213 -224 -0.0396598 0.285
NP_441351.1_8 Forward -186 -167 1.37609 0.276
NP_440516.1_2 Forward -232 -214 4.83737 0.137
NP_440516.1_8 Forward -367 -358 16.9127 0.00442
NP_440516.1_8 Reverse -358 -367 16.9127 0.00442
NP_440516.1_8 Forward -226 -217 16.9127 0.00442
NP_440516.1_8 Reverse -217 -226 16.9127 0.00442
NP_440516.1_8 Reverse -167 -176 -0.196935 0.185
NP_440516.1_8 Reverse -175 -184 -0.590259 0.283
NP_442428.1_4 Reverse -28 -47 3.34271 0.242
NP_442428.1_5 Forward -366 -359 15.8704 0.0124
NP_442428.1_5 Reverse -359 -366 15.8704 0.0124
NP_442428.1_5 Forward -225 -218 15.8704 0.0124
NP_442428.1_5 Reverse -218 -225 15.8704 0.0124
NP_441443.1_7 Reverse -304 -323 10.4225 0.11
NP_441267.1_1 Reverse -352 -371 5.01433 0.227
NP_442859.1_2 Forward -61 -42 6.19431 0.199
NP_442120.1_10 Reverse -301 -320 -8.16202 0.23
NP_442120.1_10 Reverse -23 -42 -9.44032 0.242
NP_440673.1_2 Reverse -297 -316 16.9256 0.0543
NP_440673.1_3 Forward -365 -358 12.4288 0.0426
NP_440673.1_3 Forward -224 -217 12.4288 0.0426
NP_440673.1_3 Reverse -360 -367 12.4288 0.0426
NP_440673.1_3 Reverse -219 -226 12.4288 0.0426
NP_441052.1_2 Forward -367 -357 19.9412 0.00106
NP_441052.1_2 Forward -226 -216 19.9412 0.00106
NP_441052.1_2 Reverse -217 -227 10.5014 0.0285
NP_441052.1_2 Reverse -358 -368 10.4031 0.0285
NP_441052.1_2 Forward -316 -306 4.60159 0.154
NP_441052.1_2 Forward -44 -34 3.91327 0.17
NP_441052.1_2 Reverse -35 -45 0.865012 0.256
NP_442219.1_9 Forward -366 -357 17.7976 0.00718
NP_442219.1_9 Forward -225 -216 17.7976 0.00718
NP_442219.1_9 Reverse -218 -227 8.35786 0.0681
NP_442219.1_9 Reverse -359 -368 8.25953 0.0681
NP_440436.1_4 Reverse -218 -227 18.1905 0.00233
NP_440436.1_4 Forward -366 -357 17.2072 0.00233
NP_440436.1_4 Forward -225 -216 17.2072 0.00233
NP_440436.1_4 Reverse -359 -368 9.24241 0.0871
NP_440436.1_4 Forward -37 -28 6.48915 0.157
NP_441884.1_8 Forward -227 -208 -9.63698 0.268
NP_441884.1_8 Reverse -357 -376 -11.9969 0.271
NP_441884.1_9 Forward -370 -351 -1.7705 0.0505
NP_441884.1_9 Forward -229 -210 -4.6221 0.0594
NP_441884.1_9 Reverse -355 -374 -21.83 0.266
NP_442907.1_2 Forward -366 -348 13.9821 0.169
NP_442907.1_7 Forward -317 -298 12.1925 0.287
NP_441719.1_4 Forward -366 -359 16.3621 0.0124
NP_441719.1_4 Reverse -359 -366 16.3621 0.0124
NP_441719.1_4 Forward -225 -218 16.3621 0.0124
NP_441719.1_4 Reverse -218 -225 16.3621 0.0124
NP_441004.1_1 Reverse -301 -320 -0.0988766 0.122
NP_441004.1_1 Reverse -235 -254 -6.78538 0.19
NP_441004.1_1 Reverse -11 -30 -11.4069 0.238
NP_441004.1_1 Reverse -23 -42 -14.9469 0.271
NP_441004.1_1 Reverse -178 -197 -16.0285 0.281
NP_441004.1_2 Reverse -173 -192 -2.95047 0.269
NP_442366.1_3 Forward -80 -62 -2.0458 0.219
NP_442366.1_3 Forward -45 -27 -2.83245 0.234
NP_440129.1_10 Reverse -160 -174 4.52282 0.185
NP_440296.1_10 Reverse -164 -183 -7.08038 0.229
NP_441115.1_4 Forward -368 -350 8.27817 0.254
NP_442206.1_1 Forward -325 -306 -12.7836 0.235
NP_442206.1_4 Reverse -359 -378 14.0608 0.128
NP_440094.1_9 Reverse -216 -235 2.45773 0.173
NP_443054.1_2 Reverse -215 -229 10.521 0.0761
NP_441966.1_6 Reverse -297 -316 2.3594 0.289
NP_441851.1_10 Forward -227 -217 16.008 0.00552
NP_441851.1_10 Reverse -357 -367 15.8113 0.00552
NP_441851.1_10 Reverse -216 -226 15.8113 0.00552
NP_441851.1_10 Forward -368 -358 8.53483 0.114
NP_442622.1_1 Forward -368 -349 -11.1119 0.257
NP_442622.1_8 Forward -226 -208 1.10079 0.0626
NP_441501.1_6 Reverse -306 -325 12.0942 0.299
NP_442856.1_7 Reverse -208 -227 3.53937 0.149
NP_442856.1_7 Reverse -202 -221 -1.18052 0.219
NP_442856.1_7 Forward -53 -34 -5.80207 0.287
NP_442515.1_1 Reverse -357 -371 12.291 0.0339
NP_442515.1_1 Forward -227 -213 9.34103 0.063
NP_442515.1_1 Reverse -216 -230 4.03116 0.109
NP_442515.1_1 Forward -368 -354 2.65453 0.131
NP_442515.1_1 Forward -325 -311 0.392915 0.193
NP_441396.1_5 Reverse -176 -185 8.75118 0.21
NP_442689.1_8 Reverse -82 -99 -5.07437 0.268
NP_441349.1_10 Reverse -207 -226 1.86774 0.0795
NP_441349.1_10 Forward -377 -358 -8.94866 0.28
NP_441409.1_6 Reverse -352 -371 -9.44032 0.184
NP_441409.1_6 Forward -232 -213 -14.4552 0.257
NP_440389.1_5 Forward -374 -355 20.417 0.0937
NP_440389.1_5 Forward -338 -319 16.1751 0.189
NP_440432.1_9 Reverse -359 -374 6.37141 0.0477
NP_440432.1_9 Reverse -218 -233 -4.05167 0.196
NP_439960.1_10 Reverse -204 -222 3.26407 0.163
NP_439960.1_10 Reverse -210 -228 -4.60241 0.293
NP_440474.1_8 Reverse -218 -232 13.372 0.0717
NP_440474.1_8 Forward -366 -352 6.0955 0.233
NP_440474.1_8 Reverse -359 -373 5.99717 0.235
NP_440474.1_8 Forward -64 -50 4.32555 0.284
NP_441124.1_5 Forward -122 -112 13.5811 0.215
NP_442450.1_5 Forward -228 -218 9.32148 0.115
NP_442168.1_5 Forward -191 -172 -0.000545616 0.259
NP_440588.1_2 Reverse -208 -227 7.86593 0.048
NP_440195.1_4 Reverse -23 -42 7.86593 0.234
NP_440195.1_4 Forward -238 -219 7.86593 0.234
NP_442006.1_2 Reverse -307 -324 -15.1041 0.215
NP_442006.1_2 Forward -220 -203 -16.0874 0.238
NP_442006.1_2 Reverse -10 -27 -17.0707 0.269
NP_442006.1_2 Forward -358 -341 -18.7424 0.295
NP_440483.1_1 Reverse -4 -23 -6.58872 0.252
NP_441570.1_1 Forward -226 -208 3.85406 0.0211
NP_441570.1_1 Forward -367 -349 2.77242 0.0236
NP_441570.1_1 Reverse -358 -376 -8.63398 0.117
NP_441570.1_1 Reverse -217 -235 -16.0088 0.237
NP_441570.1_1 Reverse -167 -185 -17.0904 0.264
NP_441078.1_4 Forward -367 -358 19.6659 0.0007
NP_441078.1_4 Reverse -358 -367 19.6659 0.0007
NP_441078.1_4 Forward -226 -217 19.6659 0.0007
NP_441078.1_4 Reverse -217 -226 19.6659 0.0007
NP_441078.1_4 Reverse -301 -310 -1.27858 0.246
NP_441078.1_4 Reverse -29 -38 -1.57357 0.266
NP_441078.1_4 Reverse -35 -44 -1.6719 0.266
NP_441078.1_4 Forward -44 -35 -1.77023 0.266
NP_442729.1_5 Reverse -306 -316 17.6796 0.0748
NP_442729.1_8 Forward -230 -217 9.45906 0.125
NP_440707.1_6 Reverse -209 -228 10.9134 0.274
NP_442443.1_1 Reverse -176 -195 1.96607 0.194
NP_440526.1_3 Forward -366 -355 10.6779 0.0646
NP_440526.1_3 Forward -315 -304 7.43299 0.148
NP_440526.1_3 Reverse -359 -370 2.31981 0.267
NP_440526.1_3 Reverse -218 -229 1.92649 0.267
NP_440526.1_3 Forward -225 -214 0.943182 0.267
NP_441432.1_8 Reverse -357 -366 16.8143 0.00595
NP_441432.1_8 Reverse -216 -225 16.8143 0.00595
NP_441432.1_8 Forward -368 -359 16.8143 0.00595
NP_441432.1_8 Forward -227 -218 8.25953 0.0755
NP_441432.1_8 Forward -66 -57 2.75299 0.287
NP_442320.1_8 Forward -232 -218 14.1593 0.0138
NP_442320.1_8 Forward -373 -359 -3.04867 0.105
NP_441732.1_2 Forward -371 -355 12.8416 0.00384
NP_441732.1_2 Reverse -354 -370 -6.23465 0.0495
NP_441732.1_2 Forward -230 -214 -6.82463 0.0533
NP_440629.1_6 Reverse -352 -371 13.5789 0.228
NP_440760.1_1 Forward -226 -207 4.22769 0.0168
NP_440760.1_1 Reverse -358 -377 -20.7484 0.225
NP_442797.1_1 Forward -194 -175 -2.16383 0.243
NP_440199.1_10 Reverse -32 -42 15.6147 0.0861
NP_440199.1_10 Forward -229 -219 14.533 0.0861
NP_441945.1_10 Reverse -177 -196 7.96426 0.282
NP_441057.1_4 Reverse -306 -324 8.67227 0.141
NP_441057.1_4 Reverse -234 -252 4.24738 0.231
NP_439900.1_4 Forward -281 -267 16.8135 0.165
NP_442353.1_4 Forward -232 -213 -0.591301 0.29
NP_440913.1_1 Reverse -305 -323 6.50899 0.224
NP_441072.1_2 Reverse -213 -232 6.4893 0.28
NP_440713.1_4 Reverse -348 -367 26.1555 0.00111
NP_440713.1_4 Reverse -207 -226 17.6007 0.0472
NP_442489.1_2 Reverse -347 -366 1.17943 0.293
NP_442489.1_7 Forward -367 -358 20.1576 0.000695
NP_442489.1_7 Reverse -358 -367 20.1576 0.000695
NP_442489.1_7 Forward -226 -217 20.1576 0.000695
NP_442489.1_7 Reverse -217 -226 20.1576 0.000695
NP_442489.1_7 Forward -44 -35 5.21127 0.077
NP_442489.1_7 Reverse -301 -310 -1.27858 0.185
NP_442489.1_7 Reverse -29 -38 -1.37691 0.195
NP_442489.1_7 Reverse -35 -44 -1.6719 0.235
NP_442489.1_7 Forward -310 -301 -1.77023 0.247
NP_442489.1_7 Forward -38 -29 -2.06522 0.288
NP_440565.1_7 Reverse -11 -30 2.0644 0.246
NP_442079.1_7 Forward -366 -347 3.14605 0.212
NP_440559.1_1 Forward -366 -357 17.4043 0.00658
NP_440559.1_1 Forward -225 -216 17.4043 0.00658
NP_440559.1_1 Reverse -218 -227 8.75118 0.0586
NP_440559.1_1 Reverse -359 -368 8.65285 0.0586
NP_441659.2_8 Reverse -358 -368 20.9245 0.000805
NP_441659.2_8 Forward -367 -357 18.1713 0.00133
NP_441659.2_8 Forward -226 -216 18.1713 0.00133
NP_441659.2_8 Reverse -217 -227 11.9764 0.0147
NP_441659.2_8 Forward -38 -28 4.10993 0.144
NP_441659.2_8 Forward -79 -69 0.668351 0.26
NP_442913.1_10 Forward -376 -357 18.584 0.0136
NP_442913.1_10 Reverse -349 -368 -0.787193 0.165
NP_442913.1_10 Reverse -61 -80 -6.09707 0.291
NP_442913.1_10 Forward -235 -216 -6.29373 0.3
NP_441040.1_2 Forward -200 -181 -9.73531 0.238
NP_441040.1_2 Forward -53 -34 -13.6686 0.284
NP_442849.1_1 Reverse -16 -30 13.3726 0.201
NP_440708.1_4 Forward -55 -36 7.17762 0.221
NP_440708.1_7 Forward -324 -305 22.5172 0.00788
NP_442346.1_5 Reverse -357 -367 16.6963 0.00248
NP_442346.1_5 Reverse -216 -226 16.6963 0.00248
NP_442346.1_5 Forward -368 -358 16.303 0.00248
NP_442346.1_5 Forward -227 -217 9.02648 0.118
NP_442346.1_5 Forward -45 -35 6.17489 0.212
NP_442346.1_5 Reverse -34 -44 5.5849 0.238
NP_442346.1_5 Forward -39 -29 4.99491 0.267
NP_442346.1_5 Reverse -306 -316 4.89658 0.269
NP_442346.1_5 Reverse -28 -38 4.69992 0.276
NP_440545.1_3 Reverse -354 -371 18.7217 0.00984
NP_440545.1_3 Forward -371 -354 16.8534 0.0111
NP_440545.1_3 Forward -314 -297 -2.41943 0.184
NP_440545.1_3 Reverse -213 -230 -5.07437 0.24
NP_440545.1_3 Reverse -303 -320 -6.15601 0.27
NP_441856.1_3 Reverse -214 -233 8.94757 0.101
NP_440831.1_3 Reverse -208 -227 18.9101 0.0471
NP_441629.1_1 Forward -234 -215 6.29264 0.258
NP_441786.1_10 Reverse -208 -227 12.9791 0.145
NP_441923.1_6 Reverse -308 -322 9.2427 0.278
NP_440459.1_2 Reverse -215 -232 8.59364 0.254
NP_440010.1_4 Forward -320 -301 0.0970122 0.25
NP_440010.1_4 Forward -326 -307 -1.27961 0.267
NP_440010.1_4 Forward -371 -352 -3.24622 0.294
NP_442551.1_4 Forward -312 -297 -2.38005 0.259
NP_442551.1_4 Forward -40 -25 -2.47838 0.265
NP_442551.1_4 Reverse -313 -328 -3.56002 0.292
NP_442603.1_7 Forward -367 -353 11.4053 0.117
NP_442603.1_7 Forward -226 -212 9.6354 0.144
NP_441888.1_7 Reverse -206 -220 6.6861 0.225
NP_441948.1_4 Reverse -351 -369 2.87075 0.121
NP_441948.1_4 Forward -374 -356 -2.53746 0.169
NP_441833.1_4 Forward -366 -359 15.9687 0.0124
NP_441833.1_4 Reverse -359 -366 15.9687 0.0124
NP_441833.1_4 Forward -225 -218 15.9687 0.0124
NP_441833.1_4 Reverse -218 -225 15.9687 0.0124
NP_441895.1_10 Reverse -162 -181 -27.4349 0.282
NP_442162.1_9 Forward -366 -359 16.2637 0.0124
NP_442162.1_9 Reverse -359 -366 16.2637 0.0124
NP_442162.1_9 Forward -225 -218 16.2637 0.0124
NP_442162.1_9 Reverse -218 -225 16.2637 0.0124
NP_440671.1_4 Forward -232 -218 8.16106 0.202
NP_440671.1_4 Reverse -161 -175 5.30946 0.286
NP_440671.1_4 Reverse -29 -43 4.91614 0.3
NP_440671.1_5 Forward -189 -175 14.5519 0.273
NP_440671.1_5 Forward -24 -10 13.4703 0.293
NP_442199.1_5 Forward -375 -356 -5.21209 0.24
NP_442140.1_3 Forward -366 -356 13.5497 0.0542
NP_442140.1_3 Forward -225 -215 10.3048 0.0902
NP_442140.1_3 Reverse -218 -228 8.33817 0.119
NP_442140.1_3 Reverse -359 -369 7.94484 0.124
NP_442140.1_3 Reverse -308 -318 3.42162 0.297
NP_441696.1_6 Forward -225 -206 0.491109 0.294
NP_441671.1_1 Forward -222 -203 10.2259 0.176
NP_440875.1_9 Reverse -360 -370 14.5042 0.0411
NP_440875.1_9 Reverse -219 -229 8.37203 0.233
NP_442547.1_7 Reverse -297 -316 10.709 0.277
NP_441813.1_5 Reverse -215 -225 18.1713 0.00743
NP_441813.1_5 Forward -228 -218 17.188 0.00979
NP_441813.1_5 Reverse -356 -366 8.73149 0.0367
NP_441813.1_5 Forward -369 -359 8.73149 0.0367
NP_440594.1_8 Forward -366 -353 10.6384 0.159
NP_441259.1_8 Forward -196 -177 11.7 0.264
NP_440590.1_4 Forward -366 -353 13.4906 0.013
NP_440590.1_4 Forward -225 -212 11.6223 0.019
NP_440590.1_4 Reverse -218 -231 3.36254 0.0746
NP_440590.1_4 Reverse -359 -372 3.16588 0.0756
NP_440590.1_4 Forward -315 -302 -1.35735 0.218
NP_440567.1_1 Reverse -218 -232 15.4376 0.0176
NP_440567.1_1 Forward -366 -352 12.6843 0.022
NP_440567.1_1 Forward -225 -211 8.06273 0.0621
NP_440567.1_1 Reverse -359 -373 3.63784 0.139
NP_440035.1_6 Forward -253 -234 8.75091 0.283
NP_442497.1_10 Reverse -359 -368 17.601 0.00813
NP_442497.1_10 Forward -366 -357 10.4228 0.0087
NP_442497.1_10 Forward -225 -216 10.4228 0.0087
NP_442497.1_10 Reverse -218 -227 10.4228 0.0087
NP_440821.1_4 Forward -228 -218 19.0562 0.00399
NP_440821.1_4 Reverse -356 -366 17.9746 0.00497
NP_440821.1_4 Forward -369 -359 10.7964 0.0146
NP_440821.1_4 Reverse -215 -225 9.41981 0.0286
NP_440227.1_2 Forward -118 -102 14.0215 0.271
NP_441239.1_9 Forward -369 -357 14.887 0.0247
NP_441239.1_9 Forward -228 -216 13.3137 0.037
NP_441239.1_9 Forward -186 -174 8.88877 0.12
NP_441239.1_9 Reverse -215 -227 7.80712 0.148
NP_441239.1_9 Reverse -356 -368 7.11881 0.169
NP_441239.1_9 Forward -318 -306 5.44718 0.221
NP_441239.1_9 Forward -46 -34 3.38223 0.285
NP_440706.1_1 Reverse -213 -232 -2.75381 0.258
NP_441727.1_3 Forward -374 -355 6.4893 0.244
NP_441892.1_1 Forward -376 -359 8.29864 0.0819
NP_441892.1_1 Reverse -208 -225 -0.256152 0.181
NP_441892.1_1 Reverse -298 -315 -2.51776 0.223
NP_440665.1_1 Forward -223 -204 -3.83545 0.186
NP_440665.1_1 Reverse -202 -221 -14.3569 0.262
NP_442044.1_1 Forward -372 -353 -4.03212 0.176
NP_442193.1_1 Reverse -301 -319 7.78729 0.28
NP_442270.1_9 Reverse -206 -225 -7.96535 0.215
NP_442270.1_10 Reverse -200 -218 19.0954 0.133
NP_441017.1_6 Reverse -31 -45 17.9935 0.0397
NP_440354.1_5 Reverse -355 -374 10.2259 0.174
NP_440354.1_5 Reverse -319 -338 5.80098 0.191
NP_440354.1_7 Reverse -211 -229 11.8189 0.224
NP_442138.1_9 Forward -239 -220 9.53674 0.234
NP_442138.1_10 Forward -44 -25 -4.42544 0.255
NP_440391.1_6 Reverse -285 -304 12.3892 0.143
NP_441782.1_5 Reverse -209 -228 14.3558 0.107
NP_442809.1_6 Reverse -17 -36 5.211 0.256
NP_442809.1_6 Reverse -183 -202 -0.000545616 0.295
NP_440546.1_4 Reverse -358 -368 13.5365 0.0459
NP_440546.1_4 Reverse -217 -227 11.8882 0.0679
NP_440546.1_4 Reverse -307 -317 10.4338 0.109
NP_440546.1_4 Forward -367 -357 10.046 0.109
NP_440546.1_4 Forward -226 -216 10.046 0.109
NP_440546.1_4 Reverse -9 -19 6.8464 0.276
NP_439974.1_4 Reverse -17 -36 9.53756 0.252
NP_442041.1_5 Forward -327 -308 -1.18052 0.278
NP_441230.1_5 Reverse -268 -287 2.85105 0.209
NP_440675.1_3 Reverse -175 -194 11.8975 0.17
NP_440462.1_4 Forward -218 -204 12.4876 0.205
NP_440462.1_6 Forward -369 -359 19.4496 0.00371
NP_440462.1_6 Forward -228 -218 15.418 0.0142
NP_440462.1_6 Reverse -356 -366 10.3048 0.0396
NP_440462.1_6 Reverse -215 -225 9.61647 0.0429
NP_442592.1_2 Forward -367 -348 7.7676 0.212
NP_442592.1_3 Reverse -221 -240 17.0107 0.13
NP_440868.1_4 Reverse -213 -225 19.6068 0.00963
NP_440868.1_4 Reverse -354 -366 17.0502 0.0124
NP_440868.1_4 Forward -371 -359 16.7552 0.0136
NP_440868.1_4 Forward -230 -218 10.7571 0.0364
NP_442499.1_1 Forward -315 -296 5.70265 0.22
NP_442479.1_9 Reverse -110 -129 -10.1286 0.266
NP_440812.1_10 Reverse -177 -190 13.9823 0.259
NP_442402.1_4 Forward -34 -15 -5.70449 0.248
NP_442402.1_10 Forward -24 -14 12.9592 0.204
NP_441848.1_9 Forward -185 -174 11.4645 0.268
NP_441084.1_6 Forward -369 -355 11.4772 0.201
NP_440696.1_3 Forward -226 -208 -4.11075 0.296
NP_442358.1_9 Forward -223 -204 15.7324 0.253
NP_442039.1_4 Forward -366 -359 15.1821 0.0124
NP_442039.1_4 Reverse -359 -366 15.1821 0.0124
NP_442039.1_4 Forward -225 -218 15.1821 0.0124
NP_442039.1_4 Reverse -218 -225 15.1821 0.0124
NP_441811.1_8 Reverse -352 -366 14.0609 0.175
NP_441811.1_8 Reverse -211 -225 10.6193 0.219
NP_442380.1_10 Reverse -297 -315 16.6371 0.16
NP_442696.1_2 Reverse -234 -252 9.26226 0.254
NP_442837.1_3 Forward -366 -359 15.7721 0.0124
NP_442837.1_3 Reverse -359 -366 15.7721 0.0124
NP_442837.1_3 Forward -225 -218 15.7721 0.0124
NP_442837.1_3 Reverse -218 -225 15.7721 0.0124
NP_442053.1_1 Forward -367 -358 18.3876 0.0007
NP_442053.1_1 Reverse -358 -367 18.3876 0.0007
NP_442053.1_1 Forward -226 -217 18.3876 0.0007
NP_442053.1_1 Reverse -217 -226 18.3876 0.0007
NP_442053.1_1 Forward -176 -167 7.47288 0.0996
NP_440505.1_3 Reverse -215 -225 18.3679 0.00213
NP_440505.1_3 Reverse -356 -366 16.598 0.00683
NP_440505.1_3 Forward -369 -359 15.418 0.0114
NP_440505.1_3 Forward -228 -218 13.8447 0.0247
NP_440207.2_8 Reverse -178 -197 13.6675 0.293
NP_440520.1_2 Forward -350 -332 8.37728 0.294
NP_441203.1_1 Reverse -36 -55 -20.0601 0.297
NP_442532.1_7 Reverse -358 -372 4.03116 0.178
NP_442532.1_7 Reverse -175 -189 2.06454 0.254
NP_441408.2_7 Reverse -20 -39 2.0644 0.215
NP_440914.1_1 Forward -367 -357 17.5935 0.000537
NP_440914.1_1 Forward -226 -216 17.5935 0.000537
NP_440914.1_1 Reverse -358 -368 16.3248 0.00196
NP_440914.1_1 Reverse -29 -39 12.9091 0.0435
NP_440914.1_1 Reverse -217 -227 8.6151 0.186
NP_440914.1_1 Forward -89 -79 6.3705 0.283
NP_441011.1_8 Reverse -218 -227 16.9127 0.00602
NP_441011.1_8 Reverse -359 -368 16.6177 0.00602
NP_441011.1_8 Forward -366 -357 8.25953 0.144
NP_441011.1_8 Forward -225 -216 8.25953 0.144
NP_441011.1_8 Reverse -176 -185 5.50626 0.256
NP_442533.1_6 Forward -367 -358 17.2076 0.00137
NP_442533.1_6 Reverse -358 -367 17.2076 0.00137
NP_442533.1_6 Forward -226 -217 17.2076 0.00137
NP_442533.1_6 Reverse -217 -226 17.2076 0.00137
NP_442533.1_6 Forward -44 -35 6.8829 0.101
NP_442533.1_6 Reverse -35 -44 6.78456 0.103
NP_442533.1_6 Reverse -301 -310 5.01461 0.16
NP_442533.1_6 Reverse -316 -325 3.24465 0.219
NP_442533.1_6 Forward -220 -211 2.458 0.255
NP_442533.1_6 Forward -184 -175 2.16301 0.27
NP_442541.1_3 Forward -320 -301 7.27595 0.222
NP_440263.1_5 Forward -386 -372 8.25939 0.294
NP_442232.1_3 Reverse -209 -228 -13.7669 0.283
NP_442232.1_3 Forward -375 -356 -15.9302 0.299
NP_442322.1_4 Forward -184 -167 -8.90993 0.286
NP_442322.1_4 Forward -27 -10 -9.99156 0.297
NP_441482.1_7 Reverse -161 -175 -1.77037 0.0823
NP_441482.1_7 Reverse -211 -225 -10.3252 0.209
NP_441482.1_7 Forward -373 -359 -10.4235 0.209
NP_439944.1_9 Forward -366 -356 19.1546 0.00329
NP_439944.1_9 Reverse -359 -369 17.7779 0.00341
NP_439944.1_9 Forward -225 -215 10.5014 0.0887
NP_439944.1_9 Reverse -218 -228 10.3048 0.0887
NP_441028.1_6 Forward -23 -13 13.5492 0.158
NP_441028.1_6 Forward -201 -191 10.1076 0.21
NP_441028.1_6 Forward -54 -44 4.40448 0.278
NP_441028.1_6 Forward -53 -43 4.10949 0.278
NP_440116.1_8 Forward -366 -347 -3.73712 0.158
NP_440115.1_6 Reverse -355 -365 17.9746 0.0163
NP_440115.1_6 Forward -370 -360 16.008 0.0325
NP_440115.1_6 Reverse -214 -224 15.0247 0.0505
NP_440115.1_6 Reverse -46 -56 5.38824 0.25
NP_440007.1_9 Forward -230 -216 0.786239 0.29
NP_440007.1_9 Forward -286 -272 0.589577 0.294
NP_441602.1_3 Reverse -212 -231 8.65258 0.117
NP_441602.1_3 Reverse -353 -372 0.392778 0.217
NP_441170.1_4 Reverse -349 -367 8.86894 0.194
NP_441972.1_5 Forward -366 -347 0.0977854 0.157
NP_441972.1_5 Reverse -218 -237 -7.08038 0.241
NP_441106.1_1 Forward -368 -359 18.486 0.0028
NP_441106.1_1 Forward -227 -218 18.191 0.0028
NP_441106.1_1 Reverse -357 -366 9.63616 0.0311
NP_441106.1_1 Reverse -216 -225 9.63616 0.0311
NP_439903.1_6 Forward -179 -160 7.96345 0.145
NP_439903.1_6 Forward -229 -210 4.81688 0.189
NP_439903.1_6 Forward -319 -300 0.981987 0.255
NP_439903.1_7 Reverse -208 -227 7.66927 0.256
NP_442306.1_10 Reverse -353 -372 -10.6203 0.11
NP_442306.1_10 Reverse -212 -231 -19.6667 0.199
NP_441286.1_1 Reverse -357 -369 14.6903 0.00418
NP_441286.1_1 Reverse -216 -228 14.4936 0.00418
NP_441286.1_1 Forward -368 -356 12.232 0.00999
NP_441286.1_1 Forward -227 -215 3.38223 0.0467
NP_441286.1_1 Forward -39 -27 1.7106 0.0803
NP_442674.1_2 Forward -161 -142 10.5209 0.208
NP_442674.1_3 Reverse -209 -228 3.04693 0.296
NP_440670.1_8 Forward -367 -358 18.3876 0.000699
NP_440670.1_8 Reverse -358 -367 18.3876 0.000699
NP_440670.1_8 Forward -226 -217 18.3876 0.000699
NP_440670.1_8 Reverse -217 -226 18.3876 0.000699
NP_442881.1_7 Reverse -205 -224 19.2723 0.121
NP_440886.1_7 Forward -227 -217 17.7774 0.0011
NP_440886.1_7 Forward -185 -175 15.6142 0.0243
NP_440886.1_7 Forward -368 -358 8.04271 0.0805
NP_440886.1_7 Reverse -357 -367 7.94438 0.0805
NP_440886.1_7 Reverse -216 -226 7.94438 0.0805
NP_440828.1_4 Forward -317 -298 -3.04956 0.229
NP_440828.1_4 Forward -332 -313 -7.86776 0.294
NP_442614.1_2 Forward -226 -212 15.2409 0.0805
NP_442614.1_2 Forward -367 -353 13.8643 0.112
NP_442614.1_2 Reverse -217 -231 7.07942 0.275
NP_439995.1_5 Forward -236 -217 3.6377 0.295
NP_442072.1_9 Reverse -216 -234 -2.63579 0.0317
NP_442072.1_9 Reverse -357 -375 -12.8622 0.0926
NP_442072.1_9 Forward -368 -350 -20.4337 0.204
NP_441753.1_10 Forward -376 -357 5.211 0.186
NP_441753.1_10 Forward -235 -216 4.71934 0.193
NP_441808.1_8 Reverse -202 -221 15.1424 0.152
NP_440907.2_8 Reverse -359 -369 19.1541 0.00362
NP_440907.2_8 Forward -366 -356 10.8943 0.0969
NP_440907.2_8 Reverse -218 -228 7.84605 0.117
NP_442264.1_2 Reverse -25 -42 14.8868 0.127
NP_442264.1_2 Reverse -297 -314 12.0352 0.173
NP_441021.1_1 Forward -225 -206 -6.49039 0.18
NP_441021.1_1 Reverse -36 -55 -8.26035 0.194
NP_441021.1_1 Forward -366 -347 -11.1119 0.257
NP_441021.1_8 Reverse -212 -230 2.67408 0.241
NP_441463.1_3 Reverse -348 -367 6.88262 0.0575
NP_441463.1_3 Forward -236 -217 0.196116 0.132
NP_441463.1_3 Forward -194 -175 -2.95047 0.164
NP_441463.1_6 Forward -40 -26 12.987 0.21
NP_441463.1_6 Forward -369 -355 7.38227 0.261
NP_442842.1_4 Reverse -218 -237 1.67108 0.283
NP_441626.1_2 Forward -366 -359 15.7721 0.0124
NP_441626.1_2 Reverse -359 -366 15.7721 0.0124
NP_441626.1_2 Forward -225 -218 15.7721 0.0124
NP_441626.1_2 Reverse -218 -225 15.7721 0.0124
NP_442365.1_7 Forward -230 -211 -0.885524 0.187
NP_442365.1_7 Forward -371 -352 -5.11376 0.259
NP_442615.1_1 Reverse -349 -367 -1.55415 0.13
NP_442615.1_1 Forward -376 -358 -2.93078 0.153
NP_442615.1_1 Forward -235 -217 -5.29072 0.209
NP_441962.1_4 Reverse -302 -321 -1.27885 0.122
NP_441962.1_4 Reverse -212 -231 -6.09707 0.175
NP_441962.1_4 Forward -225 -206 -10.817 0.232
NP_440387.1_1 Forward -367 -351 6.25339 0.0282
NP_440387.1_1 Forward -226 -210 4.77842 0.0388
NP_440387.1_1 Reverse -301 -317 0.353528 0.127
NP_440387.1_1 Reverse -358 -374 -1.71142 0.143
NP_440387.1_1 Reverse -217 -233 -2.98973 0.153
NP_440855.1_1 Reverse -346 -365 0.294447 0.244
NP_441431.1_2 Forward -370 -356 12.6836 0.11
NP_441431.1_2 Reverse -355 -369 7.47213 0.241
NP_441431.1_3 Reverse -205 -224 3.6377 0.263
NP_441836.1_2 Reverse -295 -314 0.982764 0.197
NP_441836.1_2 Reverse -211 -230 -3.83545 0.244
NP_441836.1_2 Reverse -352 -371 -4.52377 0.259
NP_441993.1_1 Reverse -301 -320 13.5441 0.0842
NP_441993.1_1 Reverse -177 -196 7.59921 0.16
NP_441993.1_1 Forward -226 -207 6.81956 0.177
NP_441993.1_1 Reverse -358 -377 3.01872 0.244
NP_441993.1_1 Reverse -29 -48 2.92126 0.246
NP_441174.1_2 Reverse -355 -369 15.1426 0.126
NP_441174.1_2 Forward -370 -356 11.6026 0.293
NP_442805.1_5 Forward -118 -99 -6.3928 0.284
NP_440114.1_10 Reverse -358 -372 16.8142 0.0145
NP_440114.1_10 Reverse -217 -231 15.4376 0.0252
NP_440114.1_10 Forward -226 -212 9.83269 0.16
NP_441510.2_2 Forward -371 -352 2.6536 0.272
NP_441720.1_2 Forward -371 -352 5.40686 0.217
NP_441272.1_4 Reverse -298 -317 8.45592 0.189
NP_440293.1_3 Reverse -299 -318 -5.40875 0.276
NP_440766.1_4 Reverse -163 -177 1.27789 0.243
NP_440766.1_5 Reverse -104 -116 10.3296 0.272
NP_441237.1_9 Forward -366 -356 14.9263 0.0242
NP_441531.1_6 Reverse -205 -218 10.7374 0.254
NP_442930.1_1 Reverse -339 -349 10.1076 0.278
NP_439910.1_2 Forward -234 -217 6.52869 0.00908
NP_439910.1_2 Reverse -293 -310 -22.2823 0.22
NP_440457.1_1 Reverse -354 -366 9.77374 0.092
NP_440457.1_1 Reverse -163 -175 1.41561 0.239
NP_440457.1_1 Reverse -213 -225 1.12062 0.245
NP_440457.1_1 Forward -371 -359 0.333971 0.25
NP_440457.1_1 Forward -230 -218 -0.0593532 0.25
NP_440457.1_1 Reverse -171 -183 -0.74767 0.273
NP_442940.1_2 Forward -226 -207 15.0441 0.167
NP_440798.1_6 Reverse -359 -372 19.9805 0.0213
NP_440798.1_6 Forward -366 -353 3.65753 0.15
NP_441332.1_6 Forward -185 -175 15.3256 0.121
NP_442509.1_9 Reverse -217 -227 16.2041 0.00739
NP_442509.1_9 Forward -367 -357 8.14104 0.192
NP_442509.1_9 Forward -226 -216 8.14104 0.192
NP_442509.1_9 Reverse -358 -368 8.04271 0.192
NP_442582.1_3 Forward -137 -123 12.3301 0.289
NP_441253.1_1 Forward -319 -300 4.42435 0.28
YP_003858595.1_1 Forward -257 -238 10.5209 0.13
NP_442514.1_5 Forward -58 -39 -7.86776 0.28
NP_440554.1_4 Reverse -359 -369 15.418 0.0199
NP_440554.1_4 Reverse -218 -228 14.6313 0.02
NP_440554.1_4 Forward -225 -215 8.92815 0.0646
NP_440554.1_4 Forward -366 -356 6.37155 0.123
NP_441885.1_5 Forward -367 -357 20.9245 0.000538
NP_441885.1_5 Forward -226 -216 20.9245 0.000538
NP_441885.1_5 Reverse -217 -227 11.4848 0.00668
NP_441885.1_5 Reverse -358 -368 11.3864 0.00668
NP_440478.1_9 Forward -241 -222 14.9458 0.195
NP_440478.1_10 Forward -228 -214 11.701 0.181
NP_441428.1_8 Reverse -350 -369 7.07928 0.206
NP_442310.1_1 Reverse -209 -228 17.5024 0.135
NP_442341.1_7 Reverse -216 -230 16.0275 0.0189
NP_442341.1_7 Forward -45 -31 7.57108 0.102
NP_442341.1_7 Forward -227 -213 7.07942 0.111
NP_442341.1_7 Reverse -357 -371 2.65453 0.249
NP_442341.1_7 Forward -368 -354 1.76955 0.281
NP_442341.1_9 Forward -228 -214 4.62054 0.296
NP_441173.1_9 Forward -22 -14 10.1471 0.261
NP_440409.1_1 Forward -375 -356 4.12936 0.18
NP_440423.1_6 Reverse -209 -228 -7.4737 0.138
NP_440423.1_6 Reverse -167 -186 -12.7836 0.2
NP_443000.1_7 Reverse -215 -225 19.9412 0.00223
NP_443000.1_7 Forward -369 -359 10.7964 0.0345
NP_443000.1_7 Reverse -356 -366 10.4031 0.0345
NP_443000.1_7 Forward -228 -218 8.73149 0.0437
NP_440507.2_3 Forward -253 -234 11.7983 0.173
NP_441842.1_1 Forward -365 -352 18.5049 0.0163
NP_441842.1_1 Forward -224 -211 16.2433 0.0484
NP_441842.1_10 Forward -374 -360 10.3243 0.165
NP_441842.1_10 Reverse -351 -365 7.86607 0.241
NP_440275.1_3 Forward -369 -359 18.6629 0.0082
NP_440275.1_3 Reverse -356 -366 17.6796 0.0102
NP_440275.1_3 Reverse -215 -225 15.123 0.0182
NP_440275.1_3 Forward -228 -218 8.4365 0.0602
NP_440091.1_1 Reverse -354 -366 17.7386 0.013
NP_440091.1_1 Forward -230 -218 10.7571 0.0429
NP_440091.1_1 Forward -371 -359 8.39711 0.0653
NP_440679.1_10 Reverse -303 -322 -12.7836 0.213
NP_443010.1_10 Forward -370 -353 23.4504 0.00843
NP_443010.1_10 Forward -229 -212 8.08565 0.164
NP_442451.1_2 Reverse -209 -228 0.294447 0.153
NP_442451.1_2 Forward -375 -356 -6.49039 0.232
NP_442451.1_2 Forward -64 -45 -8.85033 0.254
NP_442638.1_3 Forward -143 -124 10.074 0.298
NP_442753.1_6 Forward -319 -300 8.75009 0.231
NP_440175.1_4 Forward -318 -299 -12.9802 0.238
NP_440149.1_8 Forward -226 -207 10.7175 0.0454
NP_440149.1_8 Forward -367 -348 0.0977854 0.141
NP_440149.1_8 Reverse -217 -236 -4.72043 0.213
NP_440149.1_8 Reverse -301 -320 -5.80207 0.235
NP_441105.1_3 Reverse -206 -225 -1.18052 0.147
NP_441105.1_3 Reverse -24 -43 -5.11376 0.213
NP_441105.1_3 Reverse -296 -315 -5.70374 0.223
NP_441730.1_3 Forward -145 -127 17.6607 0.224
NP_440216.1_1 Reverse -358 -372 16.1259 0.00307
NP_440216.1_1 Reverse -217 -231 8.25939 0.0061
NP_440216.1_1 Forward -226 -212 0.392915 0.0284
NP_440216.1_1 Forward -367 -353 -0.197071 0.0284
NP_440216.1_1 Reverse -35 -49 -11.8985 0.228
NP_440172.1_1 Reverse -358 -368 17.5813 0.00421
NP_440172.1_1 Forward -367 -357 15.0247 0.00945
NP_440172.1_1 Forward -226 -216 15.0247 0.00945
NP_440172.1_1 Reverse -217 -227 8.73149 0.0586
NP_442371.1_1 Forward -354 -344 12.1726 0.258
NP_442015.1_10 Reverse -213 -226 11.7207 0.0372
NP_442015.1_10 Reverse -354 -367 2.87088 0.187
NP_442015.1_10 Forward -230 -217 0.805932 0.218
NP_442015.1_10 Forward -48 -35 0.0192843 0.245
NP_441226.1_7 Forward -366 -359 14.4934 0.0123
NP_441226.1_7 Reverse -359 -366 14.4934 0.0123
NP_441226.1_7 Forward -225 -218 14.4934 0.0123
NP_441226.1_7 Reverse -218 -225 14.4934 0.0123
NP_441111.1_7 Forward -366 -358 18.7023 0.00294
NP_441111.1_7 Forward -225 -217 18.7023 0.00294
NP_441111.1_7 Reverse -359 -367 18.7023 0.00294
NP_441111.1_7 Reverse -218 -226 18.7023 0.00294
NP_442379.1_10 Reverse -351 -368 6.62702 0.115
NP_441766.1_2 Forward -367 -358 17.5026 0.00297
NP_441766.1_2 Reverse -358 -367 17.5026 0.00297
NP_441766.1_2 Forward -226 -217 17.5026 0.00297
NP_441766.1_2 Reverse -217 -226 17.5026 0.00297
NP_441766.1_2 Forward -176 -167 1.47469 0.289
NP_441766.1_9 Reverse -209 -228 -1.47551 0.271
NP_442417.1_5 Forward -220 -206 6.29277 0.227
NP_442417.1_5 Forward -361 -347 5.60446 0.255
NP_440416.1_9 Forward -233 -214 -14.1602 0.173
NP_440416.1_9 Forward -317 -298 -17.7985 0.247
NP_443052.1_8 Forward -236 -217 -3.14714 0.0981
NP_443052.1_8 Forward -377 -358 -13.8652 0.299
NP_443052.1_9 Reverse -366 -385 3.44104 0.162
NP_443052.1_9 Reverse -55 -74 -3.3438 0.249
NP_443052.1_9 Forward -194 -175 -4.13045 0.254
NP_443052.1_9 Forward -197 -178 -6.1954 0.279
NP_440072.1_5 Reverse -166 -184 -0.865831 0.252
NP_440591.1_9 Reverse -28 -46 7.09898 0.214
NP_442154.1_1 Reverse -176 -194 -6.07737 0.129
NP_442154.1_1 Reverse -308 -326 -6.96235 0.141
NP_442154.1_1 Reverse -209 -227 -11.9772 0.217
NP_442154.1_1 Reverse -236 -254 -14.9272 0.218
NP_440261.1_5 Reverse -359 -372 6.60746 0.0318
NP_440261.1_5 Forward -225 -212 5.23083 0.045
NP_440261.1_5 Forward -366 -353 4.8375 0.0516
NP_440261.1_5 Reverse -218 -231 -1.06236 0.0655
NP_440261.1_5 Reverse -36 -49 -4.60227 0.158
NP_440988.1_10 Forward -369 -355 10.514 0.187
NP_440988.1_10 Reverse -356 -370 10.4172 0.187
NP_440988.1_10 Forward -228 -214 7.31914 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTGGAAACCAGCAATTTGGAGGAAGTACAGGAGGCGATCGCCACCCAGGTGGAAATTATTATGCTGGATAATATGGGCACCGACACCATGGCCACTGCCGTCAAATTAATCCGCCAAGCTAATCCCCTGATCCGCATTGAAGCTTCCGGCAACGTTACCCTGGCCAATCTAACGGCGATCGCCAGCACCGGGGTGGACTTTATCTCCAGCAGTGCCCCCATCACCCGTTCTCCCTGGTTAGACTTAAGTATGCAAATTGTACGAAATTGAACAAATCTGGCTAAATTTATGCCCAACCTCGGAAACTTAAACCGAAGTCGAGCCATCTTCAATAGGCAGTGACGGCTTGCCCCCGGTCCATGGCCATTGTCCTCTGCTTCCCCCCAGCCCTAAGTTTTT

CDS

ATGAATAACTCTGATTTCCTGTCTTTTTTCCCCGAGTCTGAAAACAATGGCCCAGCGGACGTCAACGCTGAAGAATTGGCCCTATTGTTCAATGGATTGAATGAAGAAGTACAGGAACAGGTAAATTCCTCTGAAAATGAGGATTTCGGTGCCATGTTGGACGGCATCGAAATGTTAGAAGAAATGCTGGTGGAAACGGAGCTAGCAGGGGAAGCGGCTCTGCAGGAAATGACCCCCTTGGAACAGGAAACGTCCGTCATGTTTGAAGGGAATGATTTGCAGTATGAAGAAGTGGATGAAGATAATTTTGCTCCTAGTGTGCTAATTCCGCCCTTTCTCCGGGCCCATGAAGCCTTACAGGAACAGGTTGTTAGCCTAGGACAACGTTTAGCTTCTACGGAACAGGAACTCCTGGGGCACCAGCGTCGGGCTTCCAGTGCTGAGAATTTAATTCAAGACCAGGCGATCGCCCTCACCCAAGCCCAGGAACAATTGGCCCATACGGTGGCGGAATTGCAGGTTTACCAAGAAGCGTGTAAACAACAACAGTTACAGGTGGAAACCCTGACGGAACAGCTCGCCGCCAGCCAGGATTTGATCATTGCCCAACAAAATCAGTTGCACAGTGGAGAGCATGGCAATAGCAATGAGGTAAAAATTCAAGAACTTCGCACTGAGATCAATAGTTTGAAGACGGAAAATGAACAACTAAAAGGACAGATCACTTGCCACAACTCAGAGGTGGCCCGCTTTGAACAACAACTTGCTGAACTGACTGCCCGCTTACAACGACAACAGCGCTACGCCTTGCAATATAAATCTGCCTTGGAACAATACCTGGCCCAACCTGACCTTCTTCCCCTGGAAGCCATTGGTGAGGTGGTGGCTAACGTAACAACCCAGTCTAAGGAAGTGAAACCCTGGGCCAGTGTGGGGGATGTGTTGGCTTCATTTACCAGGGGCAGTTCTGAGTCGGCCAGTGCTCCGGTGGCGGATCTCACACCAGGCTTGGTAAACTTTTCCCCTTCCCCAGATAAAGAATCGGCTGGCCAGCCATCGGCAAGTAAGAAGGAGCAAAAAGAGCAAAGGAATCAGACAGAAGAAGTTCCTTTCTCCCCTCCCGTGGAGCCGGCTAAACCCGTTGACCCTATCCCCGCCATTGACCAACTGAGTTTTGCGGTTAAGGAGCCAAAACCTTCCCGTCGCTCCATTGATTTGCCAGGCTTTTTACCCCGCTCTACGCCAATGGAGTAA

Protein

MNNSDFLSFFPESENNGPADVNAEELALLFNGLNEEVQEQVNSSENEDFGAMLDGIEMLEEMLVETELAGEAALQEMTPLEQETSVMFEGNDLQYEEVDEDNFAPSVLIPPFLRAHEALQEQVVSLGQRLASTEQELLGHQRRASSAENLIQDQAIALTQAQEQLAHTVAELQVYQEACKQQQLQVETLTEQLAASQDLIIAQQNQLHSGEHGNSNEVKIQELRTEINSLKTENEQLKGQITCHNSEVARFEQQLAELTARLQRQQRYALQYKSALEQYLAQPDLLPLEAIGEVVANVTTQSKEVKPWASVGDVLASFTRGSSESASAPVADLTPGLVNFSPSPDKESAGQPSASKKEQKEQRNQTEEVPFSPPVEPAKPVDPIPAIDQLSFAVKEPKPSRRSIDLPGFLPRSTPME