Your browser is old and dusty. Try Google Chrome!

Details for slr0936

ORF slr0936
Accession NP_441715.1
Symbol nadC
Category Nicotinate and nicotinamide
Definition nicotinate-nucleotide pyrophosphorylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -115 -129 8.65272 0.0856
NP_441061.1_2 Forward -122 -108 -0.492064 0.231
NP_441061.1_2 Reverse -355 -369 -0.492064 0.231
NP_440795.1_7 Forward -122 -115 14.6904 0.0123
NP_440795.1_7 Reverse -115 -122 14.6904 0.0123
NP_440795.1_7 Forward -368 -361 7.80726 0.232
NP_441418.1_6 Forward -123 -104 -20.8467 0.129
NP_441418.1_6 Forward -363 -344 -27.5332 0.202
NP_441418.1_6 Reverse -114 -133 -29.3032 0.221
NP_442291.1_5 Forward -124 -108 -4.26803 0.269
NP_440897.1_6 Forward -123 -104 8.16011 0.074
NP_441453.1_1 Reverse -107 -125 5.42659 0.246
NP_441453.1_1 Reverse -135 -153 4.93494 0.257
NP_441453.1_4 Reverse -114 -122 16.539 0.00633
NP_441453.1_4 Forward -123 -115 16.539 0.00633
NP_441453.1_4 Forward -40 -32 6.80426 0.121
NP_441453.1_4 Reverse -31 -39 6.11594 0.121
NP_441453.1_4 Reverse -354 -362 5.13263 0.179
NP_442151.1_6 Reverse -114 -128 15.6342 0.0221
NP_442151.1_6 Reverse -31 -45 9.14437 0.157
NP_442151.1_6 Forward -123 -109 5.70279 0.266
NP_442151.1_6 Reverse -354 -368 5.50613 0.274
NP_442151.1_6 Forward -384 -370 5.30946 0.284
NP_443043.1_7 Forward -270 -251 26.6471 0.00421
NP_441818.1_1 Reverse -32 -43 13.5295 0.0731
NP_441818.1_1 Reverse -115 -126 13.1362 0.0861
NP_441818.1_1 Forward -122 -111 9.30127 0.246
NP_441818.1_9 Reverse -237 -256 -10.1286 0.292
NP_440226.1_1 Reverse -114 -133 12.7825 0.0412
NP_441630.1_3 Forward -131 -112 16.8141 0.034
NP_442287.1_3 Forward -131 -114 12.8211 0.3
NP_442655.1_2 Reverse -233 -252 5.60432 0.213
NP_441721.1_9 Reverse -249 -268 15.9291 0.254
NP_442173.1_1 Forward -122 -114 15.4574 0.00633
NP_442173.1_1 Reverse -115 -123 15.4574 0.00633
NP_442173.1_1 Reverse -32 -40 12.0158 0.0316
NP_442173.1_1 Forward -39 -31 10.7375 0.0611
NP_442752.1_4 Forward -123 -116 13.8055 0.0199
NP_442752.1_4 Reverse -114 -121 13.8055 0.0199
NP_442752.1_4 Forward -40 -33 13.8055 0.0199
NP_442752.1_4 Forward -151 -144 11.1505 0.0619
NP_443027.1_4 Reverse -112 -122 14.828 0.0437
NP_443027.1_4 Forward -125 -115 13.1564 0.0521
NP_441812.1_3 Forward -124 -110 16.2242 0.0755
NP_442975.1_10 Reverse -110 -124 13.077 0.0459
NP_442975.1_10 Forward -127 -113 2.75226 0.269
NP_440784.1_7 Forward -122 -115 15.9687 0.0123
NP_440784.1_7 Reverse -115 -122 15.9687 0.0123
NP_440784.1_7 Forward -39 -32 6.23397 0.241
NP_440784.1_7 Reverse -32 -39 6.13563 0.241
NP_442909.1_7 Forward -122 -108 5.99717 0.258
NP_440061.1_9 Reverse -112 -126 16.9119 0.0201
NP_440061.1_9 Reverse -140 -154 14.8469 0.0573
NP_440061.1_9 Reverse -241 -255 5.80051 0.272
NP_440061.1_9 Reverse -82 -96 5.21053 0.293
NP_442062.1_8 Forward -123 -113 19.4496 0.000558
NP_442062.1_8 Reverse -114 -124 17.3846 0.00193
NP_442062.1_8 Forward -40 -30 7.55152 0.0946
NP_442062.1_8 Forward -268 -258 4.3066 0.221
NP_442062.1_8 Forward -57 -47 2.92996 0.292
NP_441900.1_2 Forward -267 -249 0.903388 0.258
NP_441802.1_1 Reverse -252 -271 7.86593 0.233
NP_440304.1_4 Forward -216 -206 12.7631 0.051
NP_440304.1_4 Reverse -112 -122 10.8948 0.051
NP_440304.1_4 Forward -125 -115 9.91146 0.051
NP_440304.1_4 Forward -42 -32 9.22315 0.06
NP_440304.1_4 Forward -163 -153 2.33998 0.299
NP_442242.1_4 Forward -122 -115 14.3954 0.0124
NP_442242.1_4 Reverse -115 -122 14.3954 0.0124
NP_440044.1_8 Reverse -115 -134 4.03102 0.121
NP_440044.1_8 Forward -39 -20 2.65439 0.146
NP_441935.1_1 Forward -362 -343 9.43923 0.221
NP_441208.1_9 Forward -126 -112 5.40779 0.267
NP_441594.1_6 Forward -132 -113 2.55606 0.248
NP_442742.1_9 Forward -329 -310 -11.2103 0.269
NP_442110.1_7 Reverse -114 -128 -0.492064 0.291
NP_442726.1_7 Forward -130 -112 -1.35749 0.294
NP_441925.1_4 Forward -256 -237 -16.4225 0.282
NP_441925.1_4 Reverse -77 -96 -16.9142 0.287
NP_440856.1_7 Forward -396 -377 -8.65367 0.274
NP_441083.1_5 Reverse -114 -124 20.3345 0.00053
NP_441083.1_5 Forward -123 -113 11.3864 0.0159
NP_441083.1_5 Reverse -31 -41 8.73149 0.0307
NP_441083.1_5 Forward -40 -30 7.05986 0.067
NP_441083.1_5 Reverse -142 -152 0.176696 0.241
NP_442827.1_8 Forward -131 -112 14.6499 0.0402
NP_442827.1_8 Reverse -106 -125 10.6184 0.0597
NP_441434.1_7 Reverse -116 -130 4.22782 0.225
NP_441738.1_2 Forward -121 -114 15.28 0.0102
NP_441738.1_2 Reverse -116 -123 15.28 0.0102
NP_441738.1_2 Reverse -33 -40 15.28 0.0102
NP_441558.1_5 Reverse -112 -131 4.22769 0.286
NP_440209.1_1 Reverse -114 -122 18.1123 0.00295
NP_440209.1_1 Forward -123 -115 18.1123 0.00295
NP_440209.1_1 Forward -40 -32 8.57422 0.0425
NP_442889.1_8 Reverse -111 -125 4.52221 0.263
NP_442889.1_8 Reverse -28 -42 4.03056 0.27
NP_440447.1_1 Reverse -361 -379 7.68896 0.194
NP_440447.1_5 Reverse -183 -193 11.6814 0.291
NP_441713.1_1 Forward -129 -110 -14.8485 0.259
NP_440178.1_7 Reverse -113 -132 -12.9802 0.129
NP_440659.1_7 Forward -119 -100 8.55425 0.243
NP_442570.1_3 Reverse -40 -59 -3.3438 0.218
NP_441716.1_1 Forward -123 -109 7.37441 0.172
NP_441598.1_1 Reverse -216 -235 6.29264 0.295
NP_442111.1_4 Forward -124 -110 8.06273 0.081
NP_442111.1_4 Reverse -30 -44 7.57108 0.0923
NP_441163.1_1 Reverse -106 -123 11.7395 0.183
NP_441163.1_1 Reverse -316 -333 6.72462 0.254
NP_441163.1_9 Reverse -345 -364 20.649 0.0503
NP_440343.1_9 Reverse -143 -162 10.3242 0.244
NP_440906.1_5 Forward -122 -115 15.8704 0.0124
NP_440906.1_5 Reverse -115 -122 15.8704 0.0124
NP_440906.1_5 Forward -39 -32 6.23397 0.234
NP_440906.1_5 Reverse -32 -39 6.13563 0.241
NP_440747.1_10 Forward -126 -114 7.4138 0.00422
NP_440747.1_10 Reverse -111 -123 -2.02597 0.0196
NP_440747.1_10 Forward -154 -142 -2.32097 0.0331
NP_440747.1_10 Reverse -139 -151 -11.9574 0.178
NP_440747.1_10 Reverse -227 -239 -12.2524 0.254
NP_441130.1_10 Reverse -112 -126 11.2093 0.107
NP_441130.1_10 Forward -125 -111 8.75105 0.133
NP_441486.1_1 Reverse -111 -125 13.0776 0.00946
NP_441486.1_1 Forward -126 -112 2.65453 0.079
NP_441486.1_1 Reverse -28 -42 0.589577 0.132
NP_441486.1_1 Reverse -202 -216 -1.8687 0.175
NP_441486.1_1 Forward -43 -29 -2.85201 0.175
NP_442330.1_4 Reverse -254 -273 12.2135 0.289
NP_442634.1_4 Forward -125 -111 -3.63866 0.161
NP_441014.1_8 Forward -258 -239 -8.35868 0.283
NP_441014.1_10 Forward -124 -105 3.9319 0.206
NP_442848.1_1 Reverse -108 -122 -1.18038 0.263
NP_442848.1_1 Forward -129 -115 -2.75368 0.263
NP_442848.1_5 Forward -35 -17 -2.83245 0.286
NP_443018.1_3 Forward -122 -115 14.8871 0.0123
NP_443018.1_3 Reverse -115 -122 14.8871 0.0123
NP_443018.1_3 Reverse -32 -39 11.7405 0.0655
NP_443018.1_3 Forward -39 -32 5.44732 0.193
NP_441316.1_7 Reverse -112 -127 -3.26502 0.273
NP_441634.1_8 Forward -125 -111 5.89945 0.114
NP_440376.1_1 Forward -123 -114 19.4693 0.000692
NP_440376.1_1 Reverse -114 -123 19.4693 0.000692
NP_440376.1_1 Forward -40 -31 5.99792 0.111
NP_440376.1_1 Reverse -31 -40 -0.196935 0.285
NP_440376.1_1 Reverse -354 -363 -1.27858 0.297
NP_441588.1_4 Reverse -116 -126 6.37155 0.2
NP_442687.1_7 Reverse -113 -123 15.8113 0.0125
NP_442687.1_7 Forward -124 -114 8.92815 0.0994
NP_442687.1_7 Forward -41 -31 7.25653 0.136
NP_442687.1_7 Forward -299 -289 5.87989 0.183
NP_442687.1_7 Forward -187 -177 4.10993 0.266
NP_442485.1_3 Forward -365 -346 -1.96717 0.261
NP_442485.1_3 Reverse -343 -362 -4.13045 0.278
NP_441013.1_2 Forward -258 -240 3.95239 0.229
NP_441422.1_7 Reverse -352 -369 1.31714 0.122
NP_441422.1_7 Reverse -112 -129 -1.14113 0.181
NP_441763.1_10 Forward -256 -237 14.6499 0.121
NP_440360.1_10 Reverse -291 -305 11.996 0.137
NP_442658.1_1 Reverse -112 -122 15.9091 0.00966
NP_442658.1_1 Forward -125 -115 9.616 0.147
NP_442658.1_1 Forward -42 -32 5.09279 0.284
NP_442782.1_7 Forward -48 -29 0.884433 0.207
NP_442205.1_9 Reverse -108 -124 2.8118 0.203
NP_441414.1_9 Forward -123 -104 -2.55715 0.119
NP_443061.1_10 Reverse -348 -367 19.6656 0.166
NP_441487.1_9 Reverse -168 -187 -2.36049 0.293
NP_442937.1_5 Forward -128 -109 21.4356 0.00618
NP_442937.1_5 Forward -273 -254 7.07928 0.263
NP_441958.1_5 Forward -124 -114 12.2714 0.00183
NP_441958.1_5 Reverse -113 -123 12.2714 0.00183
NP_441958.1_5 Forward -41 -31 9.12481 0.025
NP_441958.1_5 Reverse -30 -40 0.865012 0.12
NP_441958.1_5 Forward -299 -289 -2.6749 0.28
NP_439905.1_1 Forward -122 -109 11.229 0.204
NP_439905.1_1 Reverse -115 -128 7.39411 0.262
NP_439905.1_1 Reverse -143 -156 6.70579 0.279
NP_440995.1_8 Forward -133 -114 0.884433 0.264
NP_440984.1_7 Forward -128 -114 8.84938 0.134
NP_440984.1_7 Reverse -238 -252 4.91614 0.281
NP_441162.1_3 Reverse -238 -257 10.0292 0.22
NP_439990.1_5 Forward -395 -382 9.85238 0.13
NP_442911.1_2 Reverse -104 -123 -5.80207 0.167
NP_442911.1_2 Forward -133 -114 -9.93197 0.267
NP_442911.1_2 Reverse -21 -40 -10.0303 0.268
NP_440153.1_5 Forward -122 -108 2.45787 0.223
NP_440153.1_8 Reverse -77 -90 -3.71729 0.299
NP_440369.1_5 Forward -232 -213 8.94757 0.276
NP_442536.1_8 Forward -303 -284 12.4875 0.253
NP_443055.1_6 Forward -131 -113 12.6047 0.109
NP_443055.1_6 Reverse -114 -132 1.5917 0.227
NP_440827.1_3 Forward -231 -212 11.4058 0.268
NP_440138.1_6 Reverse -115 -134 5.99684 0.227
NP_441348.1_3 Reverse -238 -257 8.45592 0.24
NP_441099.1_5 Forward -133 -114 1.76941 0.061
NP_442002.1_9 Forward -41 -34 14.1004 0.074
NP_442002.1_9 Reverse -113 -120 10.7572 0.185
NP_442013.1_7 Forward -146 -127 6.29264 0.299
NP_441294.1_7 Reverse -27 -41 15.2019 0.0285
NP_441294.1_7 Reverse -110 -124 9.34661 0.249
NP_442438.1_10 Forward -128 -114 3.73617 0.157
NP_442438.1_10 Reverse -109 -123 3.44117 0.162
NP_442438.1_10 Reverse -254 -268 2.94952 0.168
NP_441000.1_6 Forward -124 -110 -4.13031 0.227
NP_441000.1_6 Forward -41 -27 -5.21195 0.266
NP_441000.1_6 Reverse -113 -127 -5.31028 0.273
NP_441000.1_6 Reverse -30 -44 -5.60527 0.285
NP_440605.1_4 Forward -133 -114 19.4926 0.0574
NP_442771.1_1 Reverse -112 -130 -6.86402 0.169
NP_440147.1_4 Reverse -112 -125 12.8023 0.0326
NP_440147.1_4 Forward -125 -112 0.805932 0.244
NP_441550.1_8 Forward -125 -115 16.7941 0.00906
NP_441550.1_8 Forward -42 -32 14.1392 0.0182
NP_441550.1_8 Reverse -29 -39 13.4509 0.0248
NP_441550.1_8 Forward -300 -290 6.37109 0.212
NP_441550.1_8 Reverse -112 -122 6.0761 0.214
NP_441916.1_7 Forward -123 -113 18.4663 0.00144
NP_441916.1_7 Reverse -114 -124 10.3048 0.0261
NP_441916.1_7 Forward -363 -353 5.09324 0.146
NP_441916.1_10 Reverse -373 -392 2.85105 0.24
NP_441041.1_7 Reverse -28 -40 9.74986 0.108
NP_441041.1_7 Reverse -8 -20 4.98816 0.282
NP_442396.1_5 Reverse -110 -123 6.90245 0.215
NP_442004.1_6 Forward -123 -109 1.96621 0.276
NP_441725.1_5 Forward -122 -112 11.2881 0.0247
NP_441725.1_5 Reverse -32 -42 11.1898 0.0247
NP_441725.1_5 Reverse -115 -125 9.02648 0.0553
NP_441725.1_5 Reverse -206 -216 7.15819 0.103
NP_441725.1_5 Reverse -78 -88 3.12662 0.115
NP_441725.1_5 Forward -39 -29 0.766681 0.149
NP_439966.1_7 Reverse -112 -122 18.4657 0.00473
NP_439966.1_7 Forward -125 -115 14.8275 0.0177
NP_439966.1_7 Reverse -140 -150 8.82935 0.13
NP_439966.1_9 Reverse -112 -121 0.983037 0.253
NP_439966.1_9 Forward -125 -116 0.884706 0.253
NP_440202.1_8 Reverse -106 -125 11.2653 0.282
NP_442941.1_3 Forward -122 -112 11.4848 0.0116
NP_442941.1_3 Reverse -115 -125 10.9931 0.0116
NP_442941.1_3 Reverse -32 -42 1.55333 0.15
NP_442941.1_3 Reverse -143 -153 -0.118297 0.249
NP_440289.1_2 Reverse -111 -124 11.9173 0.0171
NP_440289.1_2 Forward -43 -30 6.50913 0.0591
NP_440289.1_2 Reverse -28 -41 -2.144 0.251
NP_440289.1_2 Forward -126 -113 -4.60227 0.29
NP_440983.1_2 Reverse -100 -119 4.62101 0.294
NP_440983.1_5 Reverse -375 -394 7.86593 0.151
NP_440983.1_5 Forward -120 -101 -6.98204 0.284
NP_440260.1_8 Forward -132 -114 2.47742 0.182
NP_440260.1_8 Reverse -133 -151 -2.83245 0.246
NP_441678.1_9 Forward -162 -143 0.0977854 0.225
NP_442281.1_1 Forward -45 -31 8.75042 0.0764
NP_442281.1_1 Forward -128 -114 5.30886 0.163
NP_442281.1_1 Reverse -109 -123 2.45727 0.266
NP_442281.1_1 Forward -244 -230 2.16228 0.276
NP_442281.1_1 Reverse -26 -40 1.67063 0.293
NP_441334.1_7 Reverse -112 -131 -18.6834 0.275
NP_441079.1_1 Forward -57 -38 19.2723 0.118
NP_440177.1_5 Forward -257 -238 14.0608 0.252
NP_440437.1_1 Reverse -108 -127 -0.885524 0.19
NP_441556.1_4 Reverse -345 -364 11.7404 0.247
NP_441644.1_6 Reverse -114 -124 17.3841 0.00127
NP_441644.1_6 Forward -123 -113 10.1076 0.0628
NP_441644.1_6 Reverse -31 -41 6.0761 0.167
NP_441644.1_6 Forward -40 -30 3.61784 0.272
NP_441644.1_6 Reverse -354 -364 3.12618 0.297
NP_443049.1_6 Forward -41 -31 11.9337 0.24
NP_442501.1_2 Forward -348 -329 -2.26216 0.25
NP_442215.1_2 Reverse -29 -45 5.17175 0.0796
NP_442215.1_2 Reverse -203 -219 1.23851 0.138
NP_442215.1_2 Forward -261 -245 -2.89139 0.206
NP_442215.1_2 Forward -125 -109 -7.61128 0.3
NP_442177.1_5 Forward -303 -289 9.34103 0.24
NP_442029.1_1 Forward -125 -106 -20.1584 0.297
NP_442029.1_6 Forward -128 -109 13.2741 0.141
NP_440253.1_2 Reverse -114 -132 7.19731 0.0735
NP_440929.1_8 Forward -123 -114 19.2726 0.000701
NP_440929.1_8 Reverse -114 -123 19.2726 0.000701
NP_440929.1_8 Reverse -31 -40 14.651 0.0105
NP_440929.1_8 Reverse -142 -151 13.3727 0.0145
NP_440929.1_8 Forward -40 -31 7.66954 0.0624
NP_442933.1_10 Forward -123 -114 17.601 0.00325
NP_442933.1_10 Reverse -114 -123 17.601 0.00325
NP_441751.2_8 Forward -122 -108 -4.22864 0.166
NP_441751.2_8 Reverse -115 -129 -4.32697 0.17
NP_442554.1_8 Reverse -115 -125 18.0729 0.00543
NP_442554.1_8 Forward -122 -112 13.8447 0.0145
NP_442554.1_8 Forward -39 -29 8.53483 0.074
NP_442554.1_8 Reverse -32 -42 4.99491 0.163
NP_442554.1_8 Reverse -206 -216 1.84832 0.292
NP_442554.1_9 Forward -289 -270 14.9803 0.227
NP_441762.1_7 Reverse -113 -125 11.8387 0.0142
NP_441762.1_7 Forward -124 -112 2.89058 0.0676
NP_441762.1_7 Reverse -353 -365 -5.56589 0.217
NP_441762.1_7 Reverse -258 -270 -5.56589 0.217
NP_442142.1_4 Reverse -111 -124 7.98351 0.125
NP_442142.1_4 Forward -126 -113 6.80355 0.154
NP_442292.1_1 Reverse -115 -124 18.486 0.00229
NP_442292.1_1 Forward -122 -113 9.63616 0.0183
NP_442292.1_1 Reverse -32 -41 -0.295266 0.24
NP_442292.1_1 Reverse -355 -364 -0.68859 0.268
NP_442292.1_1 Forward -39 -30 -0.786921 0.287
NP_440919.1_1 Forward -45 -26 -8.35868 0.291
NP_442476.1_6 Forward -122 -108 4.71948 0.142
NP_442476.1_6 Reverse -115 -129 2.94952 0.169
NP_442381.1_8 Reverse -111 -130 -5.70374 0.148
NP_442381.1_8 Reverse -351 -370 -9.047 0.236
NP_441711.1_4 Forward -132 -113 4.42435 0.213
NP_443009.1_5 Forward -124 -113 18.3477 0.00265
NP_443009.1_5 Forward -41 -30 7.23633 0.135
NP_443009.1_5 Forward -162 -151 3.5981 0.286
NP_442301.1_2 Reverse -279 -298 5.01354 0.269
NP_442408.2_1 Reverse -31 -50 -2.95047 0.241
NP_441715.1_3 Forward -253 -243 19.0562 0.0871
NP_441715.1_4 Forward -122 -112 16.303 0.0117
NP_441715.1_4 Reverse -115 -125 7.84651 0.107
NP_441715.1_4 Reverse -45 -55 4.50326 0.27
NP_440881.1_3 Forward -256 -237 14.9449 0.276
NP_440183.1_9 Reverse -50 -69 -13.9635 0.263
NP_440379.1_5 Forward -363 -344 -7.37537 0.243
NP_440379.1_5 Forward -262 -243 -7.76869 0.248
NP_441468.1_1 Forward -122 -115 15.8704 0.0124
NP_441468.1_1 Reverse -115 -122 15.8704 0.0124
NP_441468.1_1 Forward -39 -32 6.13563 0.209
NP_441468.1_1 Reverse -32 -39 6.0373 0.223
NP_441020.2_6 Reverse -112 -129 10.8552 0.133
NP_441015.1_10 Forward -128 -109 -5.50708 0.226
NP_441015.1_10 Forward -395 -376 -10.7186 0.287
NP_441015.1_10 Forward -368 -349 -10.9153 0.289
NP_441673.1_1 Forward -123 -114 20.8459 0.000698
NP_441673.1_1 Reverse -114 -123 20.8459 0.000698
NP_441673.1_1 Forward -40 -31 1.37636 0.114
NP_441673.1_1 Reverse -31 -40 1.1797 0.163
NP_441673.1_1 Reverse -354 -363 -8.06341 0.254
NP_441673.1_1 Forward -151 -142 -8.06341 0.254
NP_441876.1_9 Reverse -371 -381 10.9926 0.28
NP_441826.1_2 Forward -46 -32 4.91614 0.0979
NP_441826.1_2 Reverse -108 -122 0.491246 0.184
NP_441826.1_5 Forward -191 -172 1.27776 0.294
NP_442490.1_9 Forward -135 -116 1.96607 0.165
NP_442490.1_9 Forward -310 -291 1.57275 0.165
NP_442490.1_9 Forward -363 -344 -1.57384 0.194
NP_442868.1_6 Forward -125 -115 17.4829 0.012
NP_442868.1_6 Forward -365 -355 8.4365 0.057
NP_442868.1_6 Forward -153 -143 1.25834 0.205
NP_442868.1_6 Reverse -112 -122 0.963343 0.205
NP_442719.1_2 Reverse -71 -89 -3.61981 0.2
NP_442719.1_2 Forward -329 -311 -11.8796 0.297
NP_441612.1_2 Reverse -114 -124 8.54929 0.21
NP_442559.1_3 Forward -196 -177 9.93088 0.258
NP_442427.1_8 Forward -49 -30 5.40766 0.266
NP_442808.1_1 Reverse -113 -123 18.4657 0.00201
NP_442808.1_1 Forward -124 -114 8.63269 0.0481
NP_440031.1_6 Forward -375 -357 15.9488 0.182
NP_440145.1_3 Forward -133 -114 -0.295539 0.14
NP_442542.1_2 Forward -88 -75 7.00078 0.197
NP_442542.1_2 Forward -125 -112 4.54251 0.3
NP_442542.1_9 Forward -232 -218 5.60385 0.26
NP_442050.1_5 Forward -125 -115 15.6142 0.01
NP_442050.1_5 Reverse -112 -122 9.12434 0.193
NP_441114.1_3 Forward -55 -46 6.29291 0.285
NP_440558.1_2 Reverse -133 -152 -4.91709 0.249
NP_440558.1_2 Forward -60 -41 -5.01543 0.251
NP_440558.1_2 Reverse -202 -221 -6.39206 0.274
NP_440558.1_2 Reverse -74 -93 -7.37537 0.293
NP_442789.1_4 Forward -365 -346 3.04771 0.164
NP_441518.1_3 Forward -133 -114 14.3558 0.0309
NP_441878.1_6 Forward -124 -114 10.4031 0.0176
NP_441878.1_6 Reverse -113 -123 10.4031 0.0176
NP_441878.1_6 Forward -41 -31 0.766681 0.134
NP_441878.1_6 Reverse -30 -40 0.57002 0.14
NP_441878.1_6 Reverse -47 -57 -6.60814 0.193
NP_441878.1_6 Forward -215 -205 -7.59145 0.245
NP_441878.1_6 Reverse -249 -259 -7.78811 0.266
NP_441036.1_8 Reverse -113 -123 17.7779 0.000554
NP_441036.1_8 Forward -124 -114 8.33817 0.174
NP_441036.1_8 Reverse -353 -363 6.27322 0.239
NP_442650.1_2 Forward -151 -137 4.62115 0.165
NP_441557.1_5 Forward -123 -114 19.9609 0.000699
NP_441557.1_5 Reverse -114 -123 19.9609 0.000699
NP_441557.1_5 Reverse -31 -40 7.57121 0.049
NP_441557.1_5 Forward -40 -31 1.08137 0.0794
NP_441557.1_5 Forward -363 -354 -0.68859 0.229
NP_441445.1_1 Reverse -105 -124 8.06259 0.122
NP_441445.1_1 Forward -132 -113 5.80098 0.163
NP_441590.1_4 Forward -258 -239 10.2251 0.249
NP_442066.2_9 Forward -127 -114 10.344 0.154
NP_442419.1_2 Forward -128 -109 4.42435 0.184
NP_441308.1_8 Reverse -112 -122 10.1081 0.22
NP_441458.1_10 Reverse -105 -124 6.09597 0.204
NP_441458.1_10 Forward -132 -113 2.3594 0.269
NP_442469.1_7 Forward -365 -346 12.5858 0.298
NP_442183.1_1 Reverse -114 -128 14.2576 0.0347
NP_442183.1_1 Forward -123 -109 11.406 0.0702
NP_442183.1_1 Forward -151 -137 5.70279 0.206
NP_442397.1_9 Reverse -31 -50 5.211 0.247
NP_442397.1_9 Reverse -205 -224 1.76941 0.283
NP_441459.1_8 Forward -47 -34 12.704 0.286
NP_441574.1_1 Forward -135 -116 7.27595 0.11
NP_441549.1_9 Reverse -110 -128 -6.66736 0.203
NP_442347.1_2 Reverse -115 -124 12.4878 0.056
NP_442347.1_2 Forward -122 -113 11.1111 0.056
NP_442347.1_2 Forward -341 -332 6.98123 0.138
NP_442645.1_2 Forward -125 -106 -20.2567 0.288
NP_442645.1_2 Forward -131 -112 -20.5517 0.288
NP_441037.1_4 Reverse -29 -39 12.288 0.109
NP_441037.1_4 Forward -125 -115 9.55921 0.21
NP_441037.1_4 Reverse -112 -122 7.02532 0.237
NP_442594.1_8 Forward -306 -287 8.06259 0.208
NP_442594.1_8 Forward -104 -85 2.55606 0.295
NP_441633.1_3 Reverse -112 -125 6.01747 0.0481
NP_441633.1_3 Forward -125 -112 1.29759 0.109
NP_441633.1_3 Reverse -29 -42 -4.7006 0.209
NP_440136.1_2 Forward -122 -115 15.9687 0.0123
NP_440136.1_2 Reverse -115 -122 15.9687 0.0123
NP_440136.1_2 Forward -39 -32 6.23397 0.171
NP_440136.1_2 Reverse -32 -39 6.13563 0.193
NP_442590.1_9 Forward -355 -336 5.40766 0.273
NP_442590.1_10 Forward -342 -323 4.32602 0.276
NP_442998.1_10 Forward -121 -114 15.5754 0.0102
NP_442998.1_10 Reverse -116 -123 15.5754 0.0102
NP_442998.1_10 Reverse -33 -40 15.5754 0.0102
NP_442998.1_10 Reverse -144 -151 6.0373 0.205
NP_440299.1_1 Forward -127 -114 12.605 0.0362
NP_440299.1_1 Forward -367 -354 9.5568 0.0699
NP_440299.1_1 Reverse -110 -123 8.08184 0.098
NP_440299.1_1 Reverse -350 -363 2.772 0.274
NP_441799.1_1 Reverse -110 -124 14.7486 0.0222
NP_441799.1_1 Forward -127 -113 12.8803 0.0385
NP_441007.1_10 Forward -128 -115 10.934 0.0646
NP_442334.1_1 Forward -135 -116 -4.32711 0.259
NP_442201.1_10 Forward -134 -115 -7.27704 0.196
NP_442201.1_10 Forward -162 -143 -11.4069 0.267
NP_440256.1_1 Reverse -227 -246 3.04771 0.0575
NP_440256.1_1 Forward -126 -107 -5.01543 0.171
NP_441512.1_4 Reverse -110 -129 7.96426 0.265
NP_441559.1_8 Reverse -147 -161 3.34284 0.143
NP_441559.1_8 Reverse -109 -123 2.45787 0.143
NP_441559.1_8 Reverse -148 -162 1.57289 0.155
NP_441559.1_8 Forward -193 -179 -6.78525 0.279
NP_441270.1_5 Forward -396 -377 11.2376 0.294
NP_440915.1_6 Forward -44 -30 4.81781 0.0953
NP_440915.1_6 Forward -127 -113 3.53951 0.101
NP_441704.1_8 Reverse -103 -122 10.6184 0.153
NP_441704.1_8 Forward -134 -115 8.25844 0.208
NP_442866.1_1 Forward -303 -284 -8.55534 0.282
NP_441464.1_8 Forward -40 -26 13.7659 0.14
NP_441464.1_8 Reverse -114 -128 9.5377 0.189
NP_441464.1_10 Forward -309 -295 11.406 0.22
NP_441464.1_10 Forward -308 -294 10.226 0.262
NP_440702.1_2 Forward -104 -85 -5.40875 0.257
NP_440702.1_2 Forward -306 -287 -6.49039 0.26
NP_441939.1_3 Reverse -115 -134 7.96426 0.186
NP_441199.1_6 Reverse -110 -129 2.85105 0.194
NP_442993.1_1 Forward -123 -107 -0.334789 0.0725
NP_440677.1_6 Reverse -221 -240 14.0608 0.167
NP_442386.1_9 Reverse -113 -122 15.7322 0.0144
NP_442386.1_9 Forward -124 -115 13.8639 0.0289
NP_441750.1_4 Reverse -110 -129 1.17943 0.288
NP_441340.1_5 Forward -122 -115 15.6737 0.0124
NP_441340.1_5 Reverse -115 -122 15.6737 0.0124
NP_441340.1_5 Forward -39 -32 13.5105 0.0314
NP_441340.1_5 Reverse -32 -39 5.84064 0.208
NP_441340.1_5 Forward -150 -143 4.07068 0.239
NP_441947.1_4 Reverse -103 -122 21.5339 0.0167
NP_440168.1_9 Forward -365 -346 -3.44213 0.296
NP_442240.1_2 Reverse -143 -162 -19.4701 0.295
NP_440161.1_3 Reverse -45 -64 9.14423 0.255
NP_440586.1_1 Forward -272 -253 -4.32711 0.278
NP_440586.1_8 Forward -122 -115 13.2151 0.026
NP_440586.1_8 Reverse -115 -122 13.2151 0.026
NP_440586.1_8 Reverse -32 -39 9.47853 0.146
NP_440586.1_8 Forward -39 -32 5.74197 0.283
NP_440586.1_9 Reverse -37 -56 4.916 0.288
NP_442251.1_6 Forward -122 -115 15.2804 0.0124
NP_442251.1_6 Reverse -115 -122 15.2804 0.0124
NP_441262.1_3 Reverse -114 -121 14.7888 0.0223
NP_441262.1_3 Forward -123 -116 14.7888 0.0223
NP_441262.1_3 Forward -40 -33 14.7888 0.0223
NP_441262.1_3 Forward -151 -144 5.34899 0.181
NP_443051.1_1 Forward -41 -32 15.1427 0.00754
NP_443051.1_1 Reverse -113 -122 10.4228 0.00754
NP_443051.1_1 Forward -124 -115 10.4228 0.00754
NP_443051.1_1 Reverse -30 -39 6.19458 0.0849
NP_441232.1_10 Forward -134 -115 6.58763 0.161
NP_441232.1_10 Reverse -20 -39 6.19431 0.164
NP_439984.1_3 Forward -158 -144 17.0102 0.098
NP_439937.1_9 Forward -58 -41 -10.5815 0.231
NP_439937.1_9 Reverse -150 -167 -15.3014 0.287
NP_439937.1_9 Forward -41 -24 -15.5964 0.287
NP_439937.1_9 Forward -124 -107 -16.1864 0.287
NP_442294.1_3 Forward -203 -189 11.7003 0.298
NP_440926.1_9 Forward -162 -143 11.7008 0.275
NP_440836.1_1 Reverse -346 -365 7.86593 0.222
NP_440836.1_6 Forward -268 -254 13.6676 0.214
NP_440439.1_1 Reverse -111 -124 10.639 0.0362
NP_440439.1_1 Forward -126 -113 1.29759 0.157
NP_442239.1_8 Forward -304 -285 6.78429 0.263
NP_442239.1_8 Forward -192 -173 6.39097 0.266
NP_440372.1_2 Forward -122 -115 16.3621 0.0124
NP_440372.1_2 Reverse -115 -122 16.3621 0.0124
NP_440372.1_2 Forward -39 -32 13.8055 0.0214
NP_440372.1_2 Reverse -32 -39 6.52896 0.188
NP_440372.1_2 Forward -150 -143 4.36568 0.205
NP_440574.1_2 Reverse -173 -192 7.17762 0.242
NP_441181.1_6 Forward -297 -279 4.05072 0.254
NP_440819.1_5 Reverse -188 -196 7.8859 0.266
NP_439977.1_1 Forward -164 -145 19.5673 0.116
NP_439977.1_3 Forward -109 -91 20.0787 0.0846
NP_439977.1_5 Reverse -25 -44 -0.197208 0.22
NP_440139.1_1 Forward -46 -27 8.75009 0.109
NP_440139.1_1 Reverse -25 -44 0.293673 0.293
NP_441572.1_7 Forward -46 -27 14.7491 0.0265
NP_442384.1_10 Forward -123 -110 15.4572 0.00986
NP_442384.1_10 Reverse -114 -127 2.67422 0.216
NP_440364.1_2 Reverse -237 -256 17.2459 0.184
NP_441604.1_9 Reverse -225 -244 17.3057 0.136
NP_441877.1_7 Reverse -349 -368 15.8299 0.0595
NP_441018.1_7 Forward -394 -375 14.3558 0.119
NP_441018.1_7 Forward -305 -286 7.66927 0.268
NP_441018.1_7 Reverse -201 -220 7.17762 0.276
NP_442262.1_10 Forward -122 -115 14.1988 0.0123
NP_442262.1_10 Reverse -115 -122 14.1988 0.0123
NP_442262.1_10 Reverse -32 -39 13.2155 0.0213
NP_441689.1_5 Reverse -112 -122 8.53436 0.132
NP_441689.1_5 Forward -42 -32 6.0761 0.197
NP_441689.1_5 Forward -184 -174 5.87944 0.197
NP_441689.1_5 Forward -125 -115 5.87944 0.197
NP_442244.1_6 Forward -271 -252 10.0292 0.225
NP_440344.1_10 Reverse -107 -124 1.02215 0.0322
NP_440344.1_10 Forward -130 -113 -3.99273 0.09
NP_440344.1_10 Reverse -24 -41 -9.49926 0.147
NP_440344.1_10 Forward -47 -30 -9.59759 0.15
NP_440531.1_6 Reverse -106 -125 2.45773 0.157
NP_440531.1_6 Reverse -40 -59 0.491109 0.191
NP_442910.1_1 Forward -47 -28 -6.68705 0.254
NP_440189.1_10 Forward -349 -330 2.45773 0.293
NP_440826.1_5 Forward -188 -170 15.2862 0.231
NP_441965.1_3 Reverse -21 -40 -1.47551 0.285
NP_441965.1_10 Forward -126 -110 16.6765 0.0438
NP_440297.1_9 Forward -122 -112 9.32148 0.0917
NP_440297.1_9 Reverse -32 -42 9.22315 0.0917
NP_440297.1_9 Reverse -206 -216 7.05986 0.15
NP_440297.1_9 Forward -56 -46 5.09324 0.215
NP_440297.1_9 Forward -39 -29 0.176696 0.282
NP_440297.1_9 Reverse -115 -125 -0.216628 0.282
NP_441896.1_3 Reverse -105 -124 2.0644 0.206
NP_441896.1_3 Forward -132 -113 0.491109 0.225
NP_440999.1_9 Reverse -110 -124 9.14437 0.0676
NP_440888.1_2 Reverse -114 -128 17.7968 0.00308
NP_440888.1_2 Forward -123 -109 14.2569 0.0193
NP_440888.1_2 Forward -268 -254 7.27547 0.202
NP_440491.1_1 Reverse -111 -130 9.15853 0.219
NP_441345.1_10 Reverse -361 -380 21.7297 0.0699
NP_440663.1_8 Forward -272 -253 15.8307 0.141
NP_441543.1_2 Forward -122 -113 18.486 0.00236
NP_441543.1_2 Reverse -115 -124 16.9127 0.00359
NP_441543.1_2 Reverse -355 -364 4.42462 0.246
NP_441543.1_2 Forward -362 -353 4.32629 0.26
NP_442845.1_2 Forward -129 -115 6.78443 0.202
NP_442845.1_2 Forward -46 -32 5.1128 0.243
NP_442845.1_2 Reverse -237 -251 3.8345 0.275
NP_441178.1_6 Forward -262 -243 6.29183 0.268
NP_441319.1_5 Reverse -237 -256 15.6341 0.236
NP_440982.1_1 Reverse -375 -394 4.52188 0.294
NP_441469.1_8 Reverse -113 -122 16.126 0.00797
NP_441469.1_8 Forward -87 -78 7.17789 0.227
NP_441469.1_8 Forward -124 -115 6.48957 0.227
NP_443064.1_6 Reverse -114 -124 12.5669 0.0796
NP_442337.1_8 Forward -311 -292 1.27776 0.241
NP_442578.1_7 Forward -122 -115 14.5921 0.026
NP_442578.1_7 Reverse -115 -122 14.5921 0.026
NP_442578.1_7 Reverse -355 -362 8.69224 0.172
NP_442578.1_7 Forward -39 -32 6.0373 0.18
NP_440710.1_1 Forward -131 -113 -7.45401 0.238
NP_440071.1_1 Reverse -352 -369 9.5762 0.259
NP_441462.1_2 Forward -123 -113 11.5831 0.00406
NP_441462.1_2 Reverse -114 -124 11.5831 0.00406
NP_441462.1_2 Forward -40 -30 9.51814 0.0171
NP_441462.1_2 Reverse -31 -41 0.471689 0.148
NP_441462.1_2 Forward -363 -353 -0.708283 0.245
NP_441621.1_7 Reverse -112 -126 -3.147 0.188
NP_441621.1_7 Forward -125 -111 -3.44199 0.188
NP_443062.1_6 Reverse -106 -125 11.2092 0.105
NP_443062.1_6 Reverse -40 -59 0.491109 0.294
NP_442204.1_1 Forward -44 -33 0.451995 0.281
NP_442204.1_5 Reverse -104 -123 5.89931 0.153
NP_442204.1_5 Forward -50 -31 3.53937 0.187
NP_441560.1_8 Forward -128 -109 13.85 0.196
NP_440516.1_2 Reverse -108 -126 -2.63579 0.299
NP_440516.1_8 Forward -123 -114 16.9127 0.00442
NP_440516.1_8 Reverse -114 -123 16.9127 0.00442
NP_440516.1_8 Forward -40 -31 9.53783 0.0136
NP_440516.1_8 Reverse -31 -40 5.01461 0.118
NP_440516.1_8 Forward -151 -142 0.0980582 0.143
NP_442428.1_5 Forward -122 -115 15.8704 0.0124
NP_442428.1_5 Reverse -115 -122 15.8704 0.0124
NP_442428.1_5 Forward -39 -32 6.13563 0.209
NP_442428.1_5 Reverse -32 -39 6.0373 0.212
NP_440818.1_6 Reverse -40 -59 12.3892 0.228
NP_441032.1_3 Reverse -285 -304 14.3558 0.259
NP_442120.1_10 Forward -271 -252 -9.73531 0.244
NP_440673.1_2 Reverse -350 -369 13.121 0.126
NP_440673.1_2 Reverse -104 -123 12.3406 0.149
NP_440673.1_2 Forward -133 -114 8.73121 0.263
NP_440673.1_3 Forward -121 -114 12.4288 0.0426
NP_440673.1_3 Reverse -116 -123 12.4288 0.0426
NP_440673.1_3 Reverse -33 -40 12.4288 0.0426
NP_440673.1_7 Forward -51 -32 4.62101 0.185
NP_440077.1_3 Forward -274 -255 17.6007 0.197
NP_443048.1_4 Forward -205 -186 15.9339 0.241
NP_441052.1_2 Reverse -114 -124 19.9412 0.00106
NP_441052.1_2 Forward -123 -113 10.5014 0.0285
NP_442219.1_8 Reverse -110 -129 13.2887 0.153
NP_442219.1_8 Forward -373 -354 7.10414 0.277
NP_442219.1_9 Reverse -115 -124 17.7976 0.00718
NP_442219.1_9 Forward -122 -113 8.35786 0.0681
NP_440436.1_4 Forward -122 -113 18.1905 0.00233
NP_440436.1_4 Reverse -115 -124 17.2072 0.00233
NP_440436.1_4 Reverse -32 -41 6.29249 0.164
NP_440436.1_4 Reverse -143 -152 4.91586 0.23
NP_441884.1_9 Reverse -111 -130 -12.1936 0.138
NP_441884.1_9 Forward -204 -185 -21.6334 0.256
NP_441884.1_9 Forward -126 -107 -23.1083 0.284
NP_441884.1_9 Forward -271 -252 -27.6315 0.291
NP_442086.1_3 Reverse -115 -134 12.0942 0.168
NP_442086.1_3 Forward -150 -131 8.55425 0.231
NP_442412.1_3 Forward -51 -32 11.6025 0.248
NP_441719.1_4 Forward -122 -115 16.3621 0.0124
NP_441719.1_4 Reverse -115 -122 16.3621 0.0124
NP_441719.1_4 Forward -39 -32 6.82395 0.0855
NP_441719.1_4 Reverse -32 -39 6.52896 0.188
NP_441733.1_10 Forward -126 -113 16.9322 0.0382
NP_441004.1_1 Forward -304 -285 -16.1268 0.283
NP_441004.1_1 Forward -192 -173 -16.1268 0.283
NP_441004.1_1 Forward -369 -350 -18.1918 0.298
NP_441004.1_4 Reverse -17 -27 11.5831 0.254
NP_442813.1_4 Reverse -29 -48 -8.85033 0.299
NP_442366.1_3 Forward -299 -281 -5.88071 0.298
NP_442873.1_3 Reverse -281 -300 3.73524 0.284
NP_442694.1_4 Forward -390 -381 11.9961 0.275
NP_442694.1_4 Forward -332 -323 11.4061 0.277
NP_442694.1_9 Forward -209 -190 9.93088 0.24
NP_442206.1_10 Forward -151 -136 0.766545 0.245
NP_443054.1_2 Reverse -112 -126 3.14618 0.24
NP_443054.1_2 Forward -42 -28 0.589577 0.258
NP_441851.1_10 Reverse -113 -123 16.008 0.00552
NP_441851.1_10 Forward -124 -114 15.8113 0.00552
NP_441851.1_10 Forward -41 -31 7.64985 0.135
NP_441851.1_10 Reverse -30 -40 6.07655 0.187
NP_442208.1_5 Forward -95 -76 -9.83364 0.295
NP_440611.1_8 Forward -255 -236 9.73422 0.236
NP_442515.1_1 Reverse -113 -127 12.586 0.0337
NP_442515.1_1 Forward -124 -110 11.111 0.0428
NP_442515.1_1 Reverse -288 -302 -4.22864 0.298
NP_441396.1_5 Forward -306 -297 8.25953 0.224
NP_441349.1_10 Reverse -21 -40 -9.34199 0.289
NP_441409.1_6 Reverse -108 -127 1.47442 0.0603
NP_441394.1_1 Forward -314 -300 16.4209 0.271
NP_440432.1_9 Reverse -115 -130 10.2063 0.0419
NP_440432.1_9 Reverse -32 -47 -3.16669 0.179
NP_442843.1_1 Reverse -251 -270 -1.96717 0.202
NP_439960.1_10 Reverse -135 -153 -4.50408 0.293
NP_440474.1_8 Reverse -115 -129 9.04542 0.168
NP_440474.1_8 Forward -122 -108 4.62054 0.271
NP_442450.1_5 Forward -42 -32 9.61647 0.115
NP_442450.1_5 Reverse -112 -122 9.32148 0.115
NP_442168.1_5 Reverse -115 -134 3.14605 0.232
NP_442168.1_5 Forward -39 -20 1.27776 0.241
NP_440588.1_2 Reverse -105 -124 -0.885524 0.154
NP_442006.1_2 Forward -253 -236 -8.61428 0.197
NP_442006.1_2 Forward -234 -217 -15.0058 0.214
NP_442006.1_3 Forward -192 -174 -5.58572 0.298
NP_443047.1_7 Reverse -115 -134 8.06259 0.215
NP_442243.1_1 Reverse -177 -195 -1.75153 0.279
NP_441570.1_1 Reverse -114 -132 1.00246 0.034
NP_441570.1_1 Forward -151 -133 -8.92897 0.124
NP_441570.1_1 Forward -123 -105 -12.8622 0.219
NP_441078.1_4 Forward -123 -114 19.6659 0.0007
NP_441078.1_4 Reverse -114 -123 19.6659 0.0007
NP_441078.1_4 Forward -40 -31 0.196389 0.205
NP_441078.1_4 Reverse -31 -40 -0.000272808 0.205
NP_441078.1_4 Forward -363 -354 -1.27858 0.246
NP_441078.1_4 Reverse -354 -363 -2.06522 0.295
NP_442729.1_8 Forward -127 -114 10.4424 0.125
NP_442729.1_8 Reverse -110 -123 9.45906 0.125
NP_442443.1_1 Reverse -252 -271 -3.73712 0.267
NP_442443.1_1 Reverse -145 -164 -6.49039 0.294
NP_440526.1_3 Reverse -115 -126 10.7762 0.0646
NP_440526.1_3 Reverse -32 -43 1.23817 0.267
NP_440526.1_3 Forward -39 -28 0.156538 0.297
NP_441432.1_8 Forward -124 -115 16.8143 0.00595
NP_441432.1_8 Reverse -113 -122 8.25953 0.0755
NP_441432.1_8 Forward -364 -355 5.99792 0.124
NP_441432.1_8 Forward -41 -32 5.60459 0.147
NP_441432.1_8 Forward -152 -143 4.62128 0.201
NP_442320.1_8 Forward -129 -115 15.1426 0.011
NP_442320.1_8 Forward -46 -32 4.12949 0.0551
NP_442320.1_8 Forward -369 -355 -3.93365 0.136
NP_442320.1_8 Forward -274 -260 -5.21195 0.209
NP_441732.1_2 Reverse -110 -126 1.92682 0.0254
NP_440313.1_5 Forward -29 -11 12.2114 0.239
NP_440497.1_2 Reverse -115 -134 4.12936 0.293
NP_440760.1_1 Reverse -114 -133 -4.91709 0.0475
NP_440199.1_10 Reverse -111 -121 13.2547 0.108
NP_440199.1_10 Forward -43 -33 7.74818 0.231
NP_440578.1_8 Forward -307 -288 10.4225 0.285
NP_442298.1_8 Reverse -174 -184 18.9579 0.238
NP_440713.1_4 Forward -192 -173 7.86593 0.174
NP_442489.1_2 Reverse -103 -122 11.6025 0.151
NP_442489.1_7 Forward -123 -114 20.1576 0.000695
NP_442489.1_7 Reverse -114 -123 20.1576 0.000695
NP_442489.1_7 Forward -40 -31 0.688044 0.152
NP_442489.1_7 Reverse -31 -40 0.688044 0.152
NP_442079.1_7 Reverse -115 -134 13.2741 0.0806
NP_440559.1_1 Reverse -115 -124 17.4043 0.00658
NP_440559.1_1 Forward -39 -30 13.6677 0.0368
NP_440559.1_1 Forward -122 -113 8.75118 0.0586
NP_440559.1_1 Reverse -32 -41 7.66954 0.0999
NP_440559.1_1 Forward -150 -141 4.32629 0.288
NP_441659.2_8 Reverse -114 -124 18.1713 0.00133
NP_441659.2_8 Forward -123 -113 11.9764 0.0147
NP_441659.2_8 Reverse -31 -41 6.66654 0.0694
NP_441659.2_8 Forward -40 -30 6.46988 0.0744
NP_441040.1_2 Forward -276 -257 -14.7502 0.286
NP_439956.1_7 Reverse -225 -244 1.86774 0.28
NP_441800.1_7 Reverse -286 -304 0.21581 0.218
NP_440779.1_5 Reverse -114 -131 -14.0225 0.238
NP_442346.1_5 Forward -124 -114 16.6963 0.00248
NP_442346.1_5 Reverse -113 -123 9.02648 0.118
NP_442346.1_5 Forward -364 -354 8.63316 0.131
NP_442346.1_5 Forward -41 -31 7.55152 0.165
NP_442346.1_5 Forward -215 -205 4.3066 0.291
NP_442346.1_10 Forward -365 -346 -2.45882 0.294
NP_442346.1_10 Forward -270 -251 -3.04881 0.294
NP_440545.1_3 Forward -127 -110 11.3469 0.0266
NP_440545.1_3 Reverse -27 -44 -6.15601 0.27
NP_440831.1_3 Forward -132 -113 6.67837 0.271
NP_440831.1_3 Reverse -250 -269 5.51345 0.28
NP_441629.1_1 Forward -222 -203 14.2574 0.147
NP_441629.1_3 Forward -130 -111 -3.83621 0.288
NP_441786.1_10 Reverse -39 -58 7.17762 0.268
NP_440486.1_6 Forward -93 -74 9.43923 0.23
NP_440459.1_2 Reverse -175 -192 8.88863 0.246
NP_441653.1_2 Reverse -281 -300 6.04209 0.235
NP_440010.1_4 Forward -127 -108 -2.45958 0.284
NP_440010.1_4 Forward -133 -114 -3.04956 0.294
NP_442551.1_4 Forward -125 -110 -2.38005 0.259
NP_442603.1_7 Forward -123 -109 9.53707 0.146
NP_441888.1_7 Reverse -349 -363 3.34284 0.225
NP_441888.1_7 Forward -273 -259 0.88457 0.276
NP_441888.1_8 Forward -191 -172 8.75091 0.296
NP_441948.1_4 Reverse -107 -125 9.55725 0.0565
NP_441833.1_4 Forward -122 -115 15.9687 0.0124
NP_441833.1_4 Reverse -115 -122 15.9687 0.0124
NP_441833.1_4 Reverse -32 -39 6.52896 0.0924
NP_441833.1_4 Forward -39 -32 6.23397 0.163
NP_441895.1_2 Reverse -297 -316 -17.8968 0.234
NP_442699.1_8 Reverse -248 -267 -12.3902 0.253
NP_442162.1_9 Forward -122 -115 16.2637 0.0124
NP_442162.1_9 Reverse -115 -122 16.2637 0.0124
NP_442162.1_9 Forward -39 -32 12.9205 0.0282
NP_442162.1_9 Reverse -32 -39 12.9205 0.0282
NP_442162.1_9 Forward -150 -143 3.4807 0.246
NP_442162.1_9 Reverse -143 -150 3.38237 0.276
NP_440671.1_4 Forward -46 -32 15.3392 0.0454
NP_440224.1_1 Reverse -117 -136 -1.67217 0.181
NP_440224.1_1 Forward -134 -115 -3.54046 0.267
NP_442546.1_5 Forward -121 -102 18.3873 0.218
NP_441915.1_4 Forward -340 -321 6.58682 0.293
NP_442199.1_6 Forward -133 -114 8.55425 0.274
NP_442140.1_3 Reverse -115 -125 13.5497 0.0542
NP_442140.1_3 Forward -122 -112 8.33817 0.119
NP_442140.1_3 Forward -39 -29 5.28991 0.216
NP_442140.1_3 Reverse -32 -42 3.61828 0.288
NP_442021.1_3 Forward -304 -285 -5.99873 0.257
NP_441813.1_5 Reverse -112 -122 17.188 0.00979
NP_441813.1_5 Forward -125 -115 8.73149 0.0367
NP_441813.1_5 Forward -42 -32 6.37155 0.0947
NP_441813.1_5 Reverse -29 -39 4.89658 0.143
NP_441813.1_5 Reverse -140 -150 2.43831 0.187
NP_441813.1_5 Reverse -352 -362 -0.511621 0.247
NP_440590.1_4 Reverse -115 -128 9.65572 0.0341
NP_440590.1_4 Forward -122 -109 5.62415 0.0585
NP_440590.1_4 Reverse -355 -368 0.314277 0.16
NP_440590.1_4 Reverse -32 -45 -5.58558 0.283
NP_440567.1_1 Reverse -115 -129 9.63603 0.0422
NP_440567.1_1 Reverse -32 -46 4.91614 0.109
NP_440567.1_1 Forward -39 -25 1.57289 0.2
NP_440567.1_1 Forward -267 -253 0.491246 0.244
NP_440567.1_1 Forward -122 -108 -0.000409212 0.261
NP_442497.1_1 Reverse -289 -308 10.2251 0.255
NP_442497.1_10 Forward -122 -113 10.4228 0.0087
NP_442497.1_10 Reverse -115 -124 10.4228 0.0087
NP_442497.1_10 Reverse -32 -41 10.0295 0.0222
NP_442497.1_10 Forward -39 -30 8.25953 0.047
NP_440821.1_4 Reverse -112 -122 19.0562 0.00399
NP_440821.1_4 Forward -125 -115 17.9746 0.00497
NP_440821.1_4 Forward -42 -32 10.1081 0.0188
NP_440821.1_4 Reverse -29 -39 0.57002 0.169
NP_441239.1_9 Reverse -112 -124 13.3137 0.037
NP_441239.1_9 Reverse -29 -41 13.0187 0.0389
NP_441239.1_9 Forward -125 -113 9.67541 0.0987
NP_441239.1_9 Forward -261 -249 5.44718 0.221
NP_441239.1_9 Forward -356 -344 4.46387 0.253
NP_441951.1_4 Forward -369 -350 1.47442 0.283
NP_440706.1_1 Forward -127 -108 -2.65548 0.258
NP_441727.1_3 Forward -130 -111 9.14423 0.195
NP_441727.1_9 Forward -27 -8 10.4225 0.273
NP_440400.1_1 Reverse -285 -304 -2.45958 0.285
NP_441892.1_1 Forward -132 -115 -1.0428 0.196
NP_441892.1_1 Forward -49 -32 -5.56602 0.283
NP_442193.1_1 Forward -108 -90 10.8356 0.228
NP_440900.1_1 Reverse -227 -246 12.9791 0.165
NP_440354.1_7 Forward -129 -111 17.0304 0.167
NP_442138.1_10 Reverse -114 -133 -6.98204 0.286
NP_442052.1_7 Reverse -246 -260 12.4876 0.261
NP_441782.1_5 Forward -131 -112 24.0905 0.0195
NP_440546.1_4 Forward -123 -113 11.8882 0.0679
NP_440546.1_4 Reverse -114 -124 10.046 0.109
NP_440546.1_4 Forward -371 -361 7.52511 0.235
NP_440546.1_4 Forward -40 -30 6.94336 0.269
NP_440546.1_6 Reverse -104 -123 7.07928 0.278
NP_441230.1_5 Forward -128 -109 4.03102 0.188
NP_441230.1_5 Reverse -168 -187 0.491109 0.266
NP_440462.1_6 Reverse -112 -122 15.418 0.0142
NP_440462.1_6 Forward -125 -115 10.3048 0.0396
NP_442340.1_3 Forward -367 -348 -8.35868 0.246
NP_440868.1_4 Reverse -110 -122 20.2952 0.00865
NP_440868.1_4 Forward -127 -115 7.11881 0.0756
NP_440868.1_4 Forward -155 -143 5.05386 0.107
NP_440401.1_9 Reverse -295 -302 14.5917 0.287
NP_442499.1_1 Reverse -355 -374 7.17762 0.203
NP_441249.1_3 Forward -253 -234 -0.197208 0.293
NP_442402.1_9 Forward -268 -249 8.45592 0.291
NP_440696.1_3 Reverse -27 -45 11.7205 0.123
NP_440579.1_7 Forward -136 -118 17.1287 0.203
NP_442039.1_4 Forward -122 -115 15.1821 0.0124
NP_442039.1_4 Reverse -115 -122 15.1821 0.0124
NP_442039.1_4 Forward -39 -32 11.6422 0.0747
NP_441811.1_8 Reverse -108 -122 6.88276 0.259
NP_441811.1_8 Forward -129 -115 5.99778 0.289
NP_440825.1_7 Forward -39 -29 10.8602 0.286
NP_442837.1_3 Forward -122 -115 15.7721 0.0124
NP_442837.1_3 Reverse -115 -122 15.7721 0.0124
NP_442837.1_3 Forward -39 -32 6.0373 0.25
NP_442837.1_3 Reverse -32 -39 6.0373 0.25
NP_440160.1_2 Forward -162 -143 -8.85033 0.291
NP_442053.1_1 Forward -123 -114 18.3876 0.0007
NP_442053.1_1 Reverse -114 -123 18.3876 0.0007
NP_442053.1_1 Reverse -31 -40 7.07956 0.105
NP_440505.1_3 Forward -125 -115 16.598 0.00683
NP_440505.1_3 Reverse -112 -122 13.8447 0.0247
NP_440505.1_3 Forward -82 -72 8.53483 0.141
NP_440505.1_3 Forward -153 -143 7.35486 0.157
NP_440505.1_3 Forward -42 -32 5.97822 0.202
NP_440505.1_7 Reverse -149 -168 7.27595 0.162
NP_441203.1_1 Reverse -32 -51 -9.34199 0.137
NP_442532.1_7 Reverse -114 -128 5.70279 0.171
NP_440914.1_1 Reverse -114 -124 17.5935 0.000537
NP_440914.1_1 Forward -123 -113 8.6151 0.186
NP_440914.1_1 Forward -137 -127 7.44401 0.237
NP_441011.1_8 Forward -122 -113 16.9127 0.00602
NP_441011.1_8 Forward -297 -288 9.14451 0.135
NP_441011.1_8 Reverse -115 -124 8.25953 0.144
NP_441011.1_8 Forward -362 -353 5.99792 0.208
NP_442533.1_6 Forward -123 -114 17.2076 0.00137
NP_442533.1_6 Reverse -114 -123 17.2076 0.00137
NP_442533.1_6 Reverse -330 -339 5.40793 0.14
NP_442533.1_6 Reverse -31 -40 4.42462 0.179
NP_442533.1_6 Reverse -250 -259 1.86802 0.284
NP_442533.1_6 Forward -252 -243 1.47469 0.298
NP_442541.1_10 Forward -258 -244 10.1271 0.198
NP_441482.1_7 Reverse -108 -122 -9.04686 0.193
NP_441482.1_7 Forward -46 -32 -9.04686 0.193
NP_441482.1_7 Forward -129 -115 -10.6202 0.211
NP_439944.1_9 Reverse -115 -125 19.1546 0.00329
NP_439944.1_9 Forward -122 -112 10.3048 0.0887
NP_439944.1_9 Reverse -32 -42 7.55152 0.138
NP_442202.1_4 Forward -125 -111 18.071 0.104
NP_442202.1_6 Reverse -381 -400 -0.4922 0.265
NP_440116.1_8 Reverse -237 -256 -8.85033 0.261
NP_440115.1_6 Forward -126 -116 9.7148 0.115
NP_440115.1_6 Forward -154 -144 6.76487 0.167
NP_440115.1_6 Forward -189 -179 4.79825 0.282
NP_440007.1_9 Forward -44 -30 11.7993 0.163
NP_440007.1_9 Forward -155 -141 2.75286 0.277
NP_441680.1_4 Reverse -376 -395 -0.885524 0.256
NP_441059.1_10 Forward -223 -210 10.7374 0.277
NP_441602.1_3 Forward -368 -349 1.17943 0.217
NP_441602.1_3 Forward -303 -284 -5.11376 0.278
NP_441170.1_4 Forward -132 -114 7.39397 0.194
NP_441972.1_5 Reverse -115 -134 6.78429 0.0825
NP_441972.1_5 Reverse -32 -51 -4.6221 0.211
NP_441106.1_1 Reverse -113 -122 18.191 0.0028
NP_441106.1_1 Forward -124 -115 9.63616 0.0311
NP_440429.1_2 Forward -193 -174 7.17762 0.29
NP_440429.1_4 Reverse -149 -168 12.2908 0.263
NP_442306.1_10 Reverse -109 -128 9.43923 0.0289
NP_441286.1_1 Forward -124 -112 14.4936 0.00418
NP_441286.1_1 Reverse -113 -125 12.1337 0.0104
NP_441286.1_1 Reverse -30 -42 3.38223 0.0467
NP_441286.1_1 Forward -152 -140 -6.64753 0.271
NP_440670.1_8 Forward -123 -114 18.3876 0.000699
NP_440670.1_8 Reverse -114 -123 18.3876 0.000699
NP_440670.1_8 Forward -40 -31 16.0277 0.00443
NP_440670.1_8 Reverse -31 -40 12.5861 0.0253
NP_440670.1_8 Forward -151 -142 6.5879 0.11
NP_441886.1_1 Forward -358 -339 5.11266 0.159
NP_439955.1_10 Reverse -379 -398 10.6184 0.299
NP_440886.1_7 Reverse -113 -123 17.7774 0.0011
NP_440886.1_7 Forward -124 -114 7.94438 0.0805
NP_442614.1_2 Forward -40 -26 13.9626 0.11
NP_442614.1_2 Forward -123 -109 8.45605 0.255
NP_442401.1_2 Reverse -113 -132 9.53674 0.204
NP_441753.1_10 Reverse -328 -347 3.44104 0.216
NP_441069.1_5 Reverse -351 -369 2.67408 0.221
NP_440028.1_6 Reverse -237 -255 12.5072 0.24
NP_440907.2_8 Reverse -115 -125 10.8943 0.0969
NP_440907.2_8 Reverse -32 -42 8.04271 0.117
NP_440907.2_8 Forward -122 -112 7.84605 0.117
NP_440907.2_8 Forward -39 -29 4.7978 0.243
NP_442264.1_2 Forward -394 -377 11.5436 0.181
NP_441021.1_1 Reverse -355 -374 -10.0303 0.227
NP_441021.1_1 Reverse -115 -134 -10.522 0.24
NP_440841.1_4 Reverse -112 -131 -6.09707 0.215
NP_440841.1_4 Reverse -46 -65 -8.16202 0.25
NP_441463.1_3 Forward -133 -114 -2.36049 0.153
NP_441463.1_6 Reverse -112 -126 8.63851 0.25
NP_441626.1_2 Forward -122 -115 15.7721 0.0124
NP_441626.1_2 Reverse -115 -122 15.7721 0.0124
NP_441626.1_2 Forward -39 -32 12.2322 0.0511
NP_441626.1_2 Forward -150 -143 9.08556 0.1
NP_441626.1_2 Reverse -32 -39 5.93897 0.231
NP_441626.1_2 Reverse -355 -362 4.85733 0.244
NP_442365.1_7 Reverse -110 -129 7.57094 0.0956
NP_442794.1_1 Reverse -377 -389 4.75886 0.249
NP_442615.1_1 Forward -132 -114 4.73903 0.0437
NP_442615.1_1 Reverse -22 -40 -3.6191 0.165
NP_442615.1_1 Reverse -105 -123 -5.58572 0.217
NP_441962.1_4 Forward -368 -349 2.45773 0.102
NP_441962.1_4 Reverse -254 -273 -2.65548 0.135
NP_441962.1_4 Forward -128 -109 -5.99873 0.175
NP_440387.1_1 Reverse -354 -370 10.285 0.023
NP_440387.1_1 Reverse -114 -130 6.25339 0.0282
NP_440387.1_1 Forward -123 -107 3.50012 0.0568
NP_441431.1_2 Reverse -111 -125 7.57046 0.238
NP_441488.1_8 Forward -45 -31 9.6354 0.148
NP_441836.1_1 Forward -309 -290 15.2979 0.149
NP_441836.1_2 Reverse -108 -127 -1.37718 0.217
NP_441836.1_2 Reverse -348 -367 -1.67217 0.223
NP_441836.1_2 Reverse -41 -60 -5.40875 0.279
NP_441993.1_1 Forward -369 -350 3.99329 0.227
NP_441993.1_1 Reverse -236 -255 1.94669 0.267
NP_441993.1_1 Reverse -114 -133 1.55686 0.274
NP_442224.1_1 Reverse -112 -131 -4.42544 0.233
NP_440467.1_3 Reverse -351 -370 11.8422 0.265
NP_440467.1_3 Forward -225 -206 11.6469 0.268
NP_440114.1_10 Forward -40 -26 16.1259 0.02
NP_440114.1_10 Forward -123 -109 11.701 0.106
NP_440114.1_10 Reverse -114 -128 7.86607 0.223
NP_442698.1_10 Forward -121 -102 -0.0988766 0.297
NP_441552.1_3 Reverse -24 -43 13.7649 0.263
NP_440293.1_10 Forward -354 -335 -1.67217 0.271
NP_440766.1_4 Forward -44 -30 11.111 0.0771
NP_441237.1_9 Reverse -115 -125 14.9263 0.0242
NP_441237.1_9 Forward -39 -29 13.943 0.0577
NP_439910.1_2 Reverse -106 -123 -13.4325 0.162
NP_442867.1_2 Forward -398 -379 2.75272 0.247
NP_440457.1_1 Forward -44 -32 19.1152 0.0353
NP_440457.1_1 Reverse -110 -122 1.80894 0.223
NP_440798.1_6 Forward -39 -26 2.87088 0.159
NP_440942.1_7 Forward -136 -117 23.4022 0.0277
NP_442297.1_4 Reverse -149 -168 13.8914 0.214
NP_440054.1_9 Reverse -32 -51 15.6332 0.135
NP_442509.1_9 Forward -123 -113 16.2041 0.00739
NP_442509.1_9 Forward -40 -30 10.8943 0.152
NP_442509.1_9 Reverse -31 -41 10.5993 0.167
NP_442509.1_9 Reverse -114 -124 8.14104 0.192
NP_442784.1_3 Reverse -115 -134 13.7658 0.264
NP_440524.1_2 Forward -121 -102 -4.42544 0.276
NP_442514.1_5 Forward -260 -241 7.17681 0.114
NP_442514.1_5 Reverse -177 -196 -0.0996487 0.182
NP_442514.1_6 Forward -133 -114 8.55425 0.24
NP_442514.1_10 Forward -53 -34 8.55425 0.258
NP_440554.1_4 Forward -122 -112 14.6313 0.02
NP_440554.1_4 Reverse -115 -125 6.37155 0.123
NP_440554.1_4 Reverse -32 -42 4.0116 0.205
NP_441885.1_5 Reverse -114 -124 20.9245 0.000538
NP_441885.1_5 Forward -123 -113 11.4848 0.00668
NP_441885.1_5 Forward -151 -141 0.0783647 0.183
NP_441885.1_5 Forward -40 -30 -0.0199663 0.186
NP_441885.1_5 Forward -363 -353 -0.609952 0.215
NP_442341.1_7 Forward -124 -110 15.6342 0.0218
NP_442341.1_7 Reverse -113 -127 9.93102 0.0692
NP_442341.1_7 Reverse -30 -44 4.71948 0.181
NP_442341.1_7 Forward -379 -365 1.27789 0.295
NP_442395.2_4 Reverse -258 -277 1.96529 0.229
NP_440409.1_1 Reverse -106 -125 -0.000545616 0.216
NP_440423.1_6 Forward -131 -112 -13.7669 0.224
NP_443000.1_7 Forward -125 -115 10.4031 0.0345
NP_443000.1_7 Reverse -112 -122 8.73149 0.0437
NP_443000.1_7 Forward -153 -143 0.766681 0.29
NP_440507.2_3 Forward -132 -113 13.7649 0.144
NP_440507.2_3 Forward -372 -353 9.7334 0.216
NP_440507.2_3 Forward -126 -107 8.35677 0.253
NP_442513.1_5 Forward -131 -112 12.585 0.265
NP_441842.1_10 Forward -47 -33 13.8643 0.0667
NP_441842.1_10 Forward -130 -116 12.1926 0.107
NP_440275.1_3 Forward -125 -115 17.6796 0.0102
NP_440275.1_3 Reverse -112 -122 8.4365 0.0602
NP_440275.1_3 Forward -42 -32 7.45319 0.0714
NP_440275.1_3 Forward -365 -355 6.8632 0.0962
NP_440275.1_3 Forward -153 -143 3.61828 0.219
NP_440091.1_1 Forward -127 -115 8.9871 0.0567
NP_440091.1_1 Reverse -110 -122 8.29878 0.0653
NP_442275.1_1 Forward -268 -249 0.392778 0.285
NP_441902.1_1 Reverse -252 -271 10.3234 0.282
NP_442451.1_2 Reverse -106 -125 9.24257 0.0761
NP_442451.1_2 Reverse -251 -270 -6.09707 0.23
NP_439962.1_4 Reverse -251 -270 2.65439 0.197
NP_439962.1_4 Reverse -346 -365 1.17943 0.197
NP_440175.1_7 Forward -394 -376 11.2174 0.235
NP_442234.1_1 Reverse -308 -327 9.14423 0.265
NP_440149.1_8 Forward -123 -104 6.29264 0.0684
NP_440149.1_8 Reverse -114 -133 3.6377 0.0912
NP_440149.1_8 Reverse -230 -249 -5.31042 0.223
NP_440149.1_8 Forward -369 -350 -5.70374 0.231
NP_442373.1_2 Forward -396 -377 -4.6221 0.205
NP_440216.1_1 Forward -123 -109 -1.18038 0.0301
NP_440216.1_1 Reverse -114 -128 -2.85201 0.0608
NP_440216.1_1 Reverse -31 -45 -3.83532 0.09
NP_440216.1_1 Forward -40 -26 -11.8001 0.219
NP_440216.1_1 Reverse -142 -156 -12.3901 0.264
NP_440216.1_1 Forward -162 -148 -12.5868 0.288
NP_440216.1_9 Reverse -186 -195 5.60459 0.292
NP_440172.1_1 Reverse -114 -124 15.0247 0.00945
NP_440172.1_1 Forward -214 -204 9.41981 0.0586
NP_440172.1_1 Forward -123 -113 8.73149 0.0586
NP_440172.1_1 Reverse -31 -41 3.51995 0.224
NP_442015.1_10 Reverse -110 -123 9.75405 0.0449
NP_442015.1_10 Reverse -27 -40 2.18257 0.199
NP_442015.1_10 Reverse -138 -151 -0.669033 0.277
NP_441226.1_7 Forward -122 -115 14.4934 0.0123
NP_441226.1_7 Reverse -115 -122 14.4934 0.0123
NP_441226.1_7 Forward -39 -32 12.7234 0.0312
NP_441226.1_7 Reverse -32 -39 11.5435 0.0757
NP_441226.1_7 Forward -181 -174 7.1186 0.218
NP_441111.1_7 Forward -122 -114 18.7023 0.00294
NP_441111.1_7 Reverse -115 -123 18.7023 0.00294
NP_441111.1_7 Reverse -32 -40 8.86921 0.0589
NP_441111.1_7 Reverse -355 -363 -0.472234 0.131
NP_441111.1_7 Reverse -143 -151 -0.668896 0.274
NP_441766.1_2 Forward -123 -114 17.5026 0.00297
NP_441766.1_2 Reverse -114 -123 17.5026 0.00297
NP_441766.1_2 Reverse -31 -40 12.6844 0.0158
NP_441766.1_2 Reverse -142 -151 3.24465 0.227
NP_441766.1_9 Forward -159 -140 1.67108 0.246
NP_442417.1_5 Forward -363 -349 9.04604 0.138
NP_442179.1_8 Reverse -205 -224 20.7473 0.0717
NP_440416.1_9 Reverse -76 -95 -13.0786 0.163
NP_440416.1_9 Forward -130 -111 -15.2418 0.187
NP_440416.1_9 Forward -349 -330 -17.1101 0.231
NP_441135.1_4 Reverse -107 -126 8.84924 0.246
NP_442154.1_1 Forward -270 -252 -18.4671 0.282
NP_442154.1_1 Forward -107 -89 -19.0571 0.289
NP_441430.1_1 Forward -258 -239 12.0933 0.271
NP_440261.1_5 Forward -122 -109 4.93583 0.0478
NP_440261.1_5 Reverse -143 -156 -3.12731 0.115
NP_440261.1_5 Reverse -115 -128 -10.5021 0.201
NP_440261.1_5 Reverse -32 -45 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGATTTTGTGGCCGTTGTGATGGGATTAAGCGCTGTGGCTACCGCTGGAGTGGCCCTATTGGTCCCCGGCAGTTTTGCGCTCCAGTCCCTTTTTTGGTTGGGGTTATCGGTGTTGTCGATTATTTTACTGCGGCGTTTTCTGCCCCGGCCCAGCCGCAAAAGCATTCTCCAGGATGCAGTGGAAGGGCAATGTCTAACAGCTATTTTGCCCGGGGAAACCGGTCGGGTGCTCTATGAGGGCAACTCCTGGCGAGCGGAATGTCAGGATCCCGATGTGGCGATCGCCGTCAATGAAAAGGTTTATGTGGTGGGGCGCAGTGGCAATACGTTATTGGTTTATCCGGCCAATGCTCTCCAAGGGCGATCGGACATCCAACACCCCAATTTCTGATAAGAAGA

CDS

GTGATGCGAATTTTGGTAACAAACCCAGCCCCCATGACCTGTTTACCCCCGTGGATAATTATTGATCCTTGGCTCCAGCAATGGTTGGCGGAGGATATTGGCCGGGGAGATTGGTCTACCCAGGGTCTCGGTTTACAGCATCGAGGCCAGGCCCGCTGGGTAGCAAAGGAAAATGGTGTGATAGCTGGATTACCCATGGCCGCCCGTATTTTTCAGCTTTTGGATCCCTCCATGGAATTCCAAGTCTTGGCTGGGGAAGGGCAAGCGGTGACTGCGAGCACGGTGGTGGCCACCATGGCAGGGAATTTAGGCAGTTTACTGACTGGGGAAAGGGTAGCTCTTAATTTGGTGATGGGTTTAAGCGGCATTGCCACCATGACCAGACAATACGTCCAGGCGATCGCCGACTATCCCACCCGCTTTGTCGATACGAGAAAAACCACCCCAGGGCTGCGGGTGTTGGAAAAATATGCCAGTCGTTTGGGGGGAGCCATGAACCATCGCCTTGGCCTGGATGATGCGGTAATGGTCAAGGATAATCATATTCAAGCGGCGGGAAGTATTACAAAAGCAGTGCAAACCCTACGGCAAAATTTGCCCTATCCCTTGGCCATTGAAGTGGAAACCAGCAATTTGGAGGAAGTACAGGAGGCGATCGCCACCCAGGTGGAAATTATTATGCTGGATAATATGGGCACCGACACCATGGCCACTGCCGTCAAATTAATCCGCCAAGCTAATCCCCTGATCCGCATTGAAGCTTCCGGCAACGTTACCCTGGCCAATCTAACGGCGATCGCCAGCACCGGGGTGGACTTTATCTCCAGCAGTGCCCCCATCACCCGTTCTCCCTGGTTAGACTTAAGTATGCAAATTGTACGAAATTGA

Protein

MMRILVTNPAPMTCLPPWIIIDPWLQQWLAEDIGRGDWSTQGLGLQHRGQARWVAKENGVIAGLPMAARIFQLLDPSMEFQVLAGEGQAVTASTVVATMAGNLGSLLTGERVALNLVMGLSGIATMTRQYVQAIADYPTRFVDTRKTTPGLRVLEKYASRLGGAMNHRLGLDDAVMVKDNHIQAAGSITKAVQTLRQNLPYPLAIEVETSNLEEVQEAIATQVEIIMLDNMGTDTMATAVKLIRQANPLIRIEASGNVTLANLTAIASTGVDFISSSAPITRSPWLDLSMQIVRN