Your browser is old and dusty. Try Google Chrome!

Details for slr0925

ORF slr0925
Accession NP_442778.1
Symbol ssb
Category single-stranded DNA-binding protein
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -178 -164 12.0943 0.222
NP_441061.1_2 Forward -177 -163 19.9608 0.0139
NP_441061.1_2 Reverse -224 -238 2.35953 0.177
NP_441061.1_2 Forward -144 -130 0.982901 0.196
NP_441061.1_2 Reverse -141 -155 -1.18038 0.252
NP_441061.1_2 Forward -171 -157 -2.36035 0.29
NP_440557.1_1 Forward -177 -158 0.0977854 0.265
NP_440795.1_7 Forward -177 -170 14.6904 0.0123
NP_440795.1_7 Reverse -170 -177 14.6904 0.0123
NP_441418.1_6 Forward -178 -159 -10.7186 0.0382
NP_441418.1_6 Reverse -169 -188 -11.2103 0.0462
NP_441418.1_6 Reverse -157 -176 -29.7948 0.238
NP_442291.1_5 Reverse -168 -184 11.0716 0.0409
NP_440897.1_6 Reverse -169 -188 0.490334 0.18
NP_441453.1_4 Reverse -169 -177 16.539 0.00633
NP_441453.1_4 Forward -178 -170 16.539 0.00633
NP_441453.1_4 Reverse -224 -232 11.8191 0.0367
NP_441453.1_7 Reverse -10 -17 12.9205 0.23
NP_442151.1_6 Forward -178 -164 9.2427 0.155
NP_442151.1_6 Reverse -169 -183 6.98109 0.214
NP_442151.1_6 Forward -233 -219 6.6861 0.224
NP_441818.1_1 Reverse -170 -181 9.30127 0.246
NP_441818.1_9 Forward -174 -155 -2.26216 0.203
NP_441818.1_9 Reverse -293 -312 -5.50708 0.254
NP_440226.1_1 Reverse -169 -188 7.47261 0.105
NP_441630.1_3 Forward -186 -167 2.16274 0.232
NP_440150.1_6 Forward -367 -348 8.45592 0.201
NP_441976.1_1 Reverse -149 -168 15.3391 0.133
NP_442287.1_3 Reverse -258 -275 14.1977 0.287
NP_442655.1_5 Forward -325 -306 10.1275 0.278
NP_442173.1_1 Forward -177 -169 15.4574 0.00633
NP_442173.1_1 Reverse -170 -178 15.4574 0.00633
NP_442173.1_1 Forward -154 -146 7.00092 0.186
NP_442752.1_4 Forward -178 -171 13.8055 0.0199
NP_442752.1_4 Reverse -169 -176 13.8055 0.0199
NP_442752.1_4 Reverse -306 -313 12.4288 0.0388
NP_442752.1_4 Forward -155 -148 6.23397 0.161
NP_443027.1_4 Forward -180 -170 14.828 0.0437
NP_443027.1_4 Reverse -167 -177 13.943 0.0452
NP_443027.1_4 Reverse -12 -22 6.37155 0.283
NP_441812.1_3 Reverse -168 -182 13.8643 0.146
NP_442975.1_10 Forward -182 -168 13.1753 0.0459
NP_442975.1_10 Reverse -165 -179 13.1753 0.0459
NP_440784.1_7 Forward -177 -170 15.9687 0.0123
NP_440784.1_7 Reverse -170 -177 15.9687 0.0123
NP_442909.1_7 Reverse -119 -133 11.602 0.131
NP_442909.1_7 Reverse -141 -155 7.86545 0.198
NP_442909.1_7 Forward -154 -140 6.48882 0.252
NP_440061.1_9 Reverse -222 -236 9.53707 0.143
NP_440061.1_9 Reverse -144 -158 5.60385 0.279
NP_440110.1_8 Reverse -308 -327 -2.16383 0.262
NP_441476.1_5 Reverse -164 -183 0.392778 0.19
NP_441476.1_5 Forward -183 -164 -8.26035 0.3
NP_439979.1_7 Reverse -105 -122 14.1985 0.267
NP_440878.1_9 Forward -188 -169 -3.3438 0.292
NP_442062.1_8 Forward -178 -168 19.4496 0.000558
NP_442062.1_8 Reverse -169 -179 19.4496 0.000558
NP_442062.1_8 Reverse -224 -234 3.81494 0.252
NP_441859.1_3 Forward -179 -160 18.8781 0.0348
NP_440304.1_4 Forward -180 -170 10.8948 0.051
NP_440304.1_4 Reverse -167 -177 9.91146 0.051
NP_442242.1_4 Forward -177 -170 14.3954 0.0124
NP_442242.1_4 Reverse -170 -177 14.3954 0.0124
NP_440044.1_8 Reverse -170 -189 2.16274 0.155
NP_442762.1_10 Reverse -290 -309 -10.9153 0.271
NP_441594.1_6 Reverse -160 -179 17.3057 0.0653
NP_441594.1_6 Reverse -364 -383 7.66927 0.17
NP_440370.1_10 Reverse -137 -156 11.1109 0.192
NP_440370.1_10 Forward -187 -168 7.7676 0.25
NP_442110.1_7 Forward -178 -164 9.93102 0.0684
NP_442110.1_7 Forward -155 -141 6.19444 0.151
NP_442110.1_7 Reverse -169 -183 1.57289 0.222
NP_441082.1_10 Reverse -294 -307 10.934 0.236
NP_441925.1_4 Forward -344 -325 -5.60616 0.179
NP_441925.1_4 Reverse -338 -357 -17.4058 0.294
NP_440014.1_2 Reverse -382 -400 14.4738 0.232
NP_440856.1_1 Reverse -159 -178 -5.40875 0.276
NP_441083.1_3 Reverse -294 -304 14.3359 0.182
NP_441083.1_5 Forward -178 -168 11.3864 0.0159
NP_441083.1_5 Reverse -169 -179 11.3864 0.0159
NP_441083.1_5 Forward -315 -305 6.27322 0.0876
NP_441083.1_5 Forward -155 -145 5.19158 0.123
NP_441083.1_5 Reverse -146 -156 -0.609952 0.272
NP_442827.1_8 Forward -186 -167 12.88 0.0434
NP_442827.1_8 Reverse -161 -180 -0.984623 0.238
NP_442827.1_8 Forward -157 -138 -1.8696 0.26
NP_442827.1_8 Reverse -203 -222 -1.96793 0.264
NP_441434.1_7 Reverse -171 -185 4.22782 0.225
NP_441738.1_2 Forward -176 -169 15.28 0.0102
NP_441738.1_2 Reverse -171 -178 15.28 0.0102
NP_441738.1_2 Forward -21 -14 6.03696 0.295
NP_441738.1_4 Reverse -159 -178 7.07928 0.203
NP_441558.1_5 Forward -180 -161 7.66927 0.174
NP_440209.1_1 Reverse -169 -177 18.1123 0.00295
NP_440209.1_1 Forward -178 -170 18.1123 0.00295
NP_440870.1_4 Reverse -134 -152 -3.12744 0.292
NP_442889.1_1 Reverse -319 -338 -14.0619 0.271
NP_442889.1_8 Reverse -166 -180 11.2087 0.0735
NP_440407.1_5 Forward -288 -269 17.9932 0.181
NP_441713.1_1 Reverse -163 -182 -7.4737 0.13
NP_442675.1_4 Forward -222 -204 -4.11075 0.257
NP_442675.1_4 Forward -135 -117 -6.4707 0.287
NP_441770.1_10 Forward -348 -329 8.25926 0.284
NP_440178.1_7 Reverse -168 -187 -12.6852 0.123
NP_440178.1_7 Forward -156 -137 -14.1602 0.149
NP_440178.1_7 Forward -179 -160 -21.0434 0.207
NP_441716.1_1 Reverse -169 -183 4.62115 0.254
NP_441327.1_5 Forward -14 -5 13.0777 0.29
NP_442111.1_4 Reverse -145 -159 8.45605 0.0744
NP_442111.1_4 Reverse -223 -237 5.21113 0.172
NP_442111.1_4 Forward -179 -165 3.44117 0.244
NP_441624.1_7 Reverse -157 -171 10.521 0.217
NP_441163.1_1 Forward -186 -169 13.8044 0.183
NP_441163.1_1 Reverse -300 -317 7.60959 0.241
NP_441533.1_7 Reverse -153 -171 11.7197 0.299
NP_440343.1_3 Forward -314 -296 6.90155 0.225
NP_440343.1_9 Reverse -295 -314 7.17762 0.29
NP_440906.1_5 Forward -177 -170 15.8704 0.0124
NP_440906.1_5 Reverse -170 -177 15.8704 0.0124
NP_440747.1_1 Forward -216 -198 10.7372 0.238
NP_440747.1_10 Forward -181 -169 -2.02597 0.0196
NP_440747.1_10 Reverse -166 -178 -2.02597 0.0196
NP_441130.1_10 Forward -180 -166 20.3541 0.00768
NP_441130.1_10 Reverse -167 -181 11.7993 0.106
NP_441130.1_10 Reverse -222 -236 4.52282 0.281
NP_441486.1_1 Forward -181 -167 11.7993 0.0143
NP_441486.1_1 Reverse -166 -180 10.4227 0.0207
NP_441486.1_1 Forward -217 -203 -2.26202 0.175
NP_442330.1_4 Reverse -167 -186 12.3111 0.289
NP_442634.1_4 Reverse -167 -181 -3.63866 0.161
NP_442848.1_1 Reverse -140 -154 10.4227 0.0791
NP_442848.1_1 Reverse -163 -177 5.1128 0.0881
NP_442848.1_1 Forward -184 -170 -1.08205 0.263
NP_442848.1_9 Forward -322 -303 6.78429 0.182
NP_441012.1_4 Reverse -159 -172 8.57408 0.272
NP_441012.1_4 Forward -344 -331 6.4108 0.279
NP_443018.1_3 Forward -177 -170 14.8871 0.0123
NP_443018.1_3 Reverse -170 -177 14.8871 0.0123
NP_443018.1_3 Reverse -225 -232 10.4622 0.103
NP_443018.1_3 Forward -232 -225 4.36568 0.254
NP_441316.1_7 Forward -180 -165 -3.26502 0.273
NP_441634.1_8 Forward -180 -166 12.1926 0.0529
NP_441634.1_8 Reverse -222 -236 4.62115 0.122
NP_441634.1_8 Reverse -167 -181 -3.63866 0.295
NP_440376.1_1 Forward -178 -169 19.4693 0.000692
NP_440376.1_1 Reverse -169 -178 19.4693 0.000692
NP_440376.1_1 Reverse -306 -315 3.93297 0.188
NP_440376.1_1 Reverse -46 -55 3.34298 0.206
NP_440376.1_1 Forward -233 -224 2.65466 0.216
NP_441588.1_4 Forward -176 -166 6.96153 0.178
NP_442687.1_7 Forward -179 -169 15.8113 0.0125
NP_442687.1_7 Reverse -168 -178 15.8113 0.0125
NP_442687.1_7 Forward -55 -45 4.60159 0.243
NP_441846.1_10 Forward -128 -109 -15.3402 0.247
NP_441013.1_2 Forward -309 -291 7.78729 0.208
NP_441422.1_7 Forward -180 -163 6.03703 0.0992
NP_441422.1_7 Reverse -167 -184 -5.56602 0.247
NP_441422.1_7 Reverse -155 -172 -7.53264 0.259
NP_441029.1_3 Forward -183 -164 4.71934 0.277
NP_441763.1_10 Reverse -158 -177 11.5033 0.143
NP_440360.1_10 Forward -176 -162 4.81781 0.227
NP_440360.1_10 Reverse -226 -240 4.32615 0.227
NP_442658.1_1 Reverse -167 -177 18.7607 0.00222
NP_442658.1_1 Forward -180 -170 15.9091 0.00966
NP_442658.1_1 Forward -235 -225 5.19112 0.28
NP_440141.1_8 Forward -242 -223 5.01433 0.278
NP_440141.1_8 Reverse -196 -215 4.52268 0.288
NP_442496.1_5 Reverse -300 -318 8.7706 0.249
NP_442205.1_9 Forward -112 -96 2.12349 0.224
NP_442205.1_9 Forward -155 -139 -2.20308 0.268
NP_442205.1_9 Forward -184 -168 -2.79306 0.272
NP_439968.1_8 Reverse -321 -337 15.8898 0.171
NP_440607.1_5 Reverse -298 -317 0.982764 0.262
NP_442300.1_10 Reverse -331 -350 11.2092 0.282
NP_441256.1_1 Forward -175 -156 2.26107 0.145
NP_442937.1_5 Reverse -164 -183 12.8808 0.0991
NP_442937.1_5 Reverse -206 -225 12.1925 0.116
NP_441958.1_5 Forward -179 -169 12.2714 0.00183
NP_441958.1_5 Reverse -168 -178 12.2714 0.00183
NP_441958.1_5 Forward -156 -146 -0.609952 0.215
NP_441958.1_5 Reverse -305 -315 -0.904945 0.222
NP_441958.1_5 Forward -234 -224 -1.29827 0.236
NP_440651.1_1 Reverse -290 -309 4.52268 0.294
NP_441127.1_1 Reverse -163 -177 12.0943 0.215
NP_439905.1_1 Forward -277 -264 10.934 0.204
NP_439905.1_1 Forward -345 -332 6.80412 0.275
NP_439905.1_1 Forward -165 -152 6.50913 0.285
NP_440984.1_7 Forward -183 -169 10.4227 0.126
NP_439990.1_5 Reverse -219 -232 10.049 0.128
NP_442376.1_2 Forward -238 -219 -13.5702 0.297
NP_442911.1_2 Reverse -159 -178 7.07928 0.0267
NP_442911.1_2 Reverse -136 -155 -5.11376 0.15
NP_442911.1_2 Forward -165 -146 -6.98204 0.197
NP_442911.1_2 Forward -243 -224 -11.0136 0.296
NP_441580.1_6 Reverse -158 -177 4.62101 0.117
NP_441580.1_6 Reverse -265 -284 -8.94866 0.277
NP_441580.1_6 Reverse -194 -213 -8.94866 0.277
NP_440153.1_5 Reverse -170 -184 19.8624 0.034
NP_440153.1_5 Forward -177 -163 2.85119 0.219
NP_440369.1_5 Forward -214 -195 8.65258 0.281
NP_441941.1_9 Reverse -326 -345 6.4893 0.219
NP_443055.1_6 Forward -354 -336 2.77167 0.203
NP_443055.1_6 Reverse -140 -158 -1.55487 0.28
NP_443055.1_6 Forward -342 -324 -2.73484 0.299
NP_440993.1_2 Forward -183 -167 9.30165 0.12
NP_440993.1_4 Forward -139 -122 2.69378 0.298
NP_440827.1_3 Forward -315 -296 11.9958 0.262
NP_441099.1_5 Reverse -159 -178 7.7676 0.0409
NP_441099.1_5 Reverse -108 -127 -12.1936 0.296
NP_442002.1_1 Forward -126 -108 3.06741 0.167
NP_442002.1_1 Reverse -297 -315 0.21581 0.192
NP_442002.1_1 Forward -164 -146 -6.4707 0.249
NP_442002.1_9 Forward -179 -172 10.7572 0.185
NP_442002.1_9 Reverse -168 -175 10.7572 0.185
NP_441646.1_1 Reverse -162 -181 6.58763 0.173
NP_441646.1_1 Forward -266 -247 -1.47551 0.287
NP_441646.1_1 Forward -240 -221 -1.86883 0.296
NP_442438.1_10 Reverse -164 -178 18.7808 0.0158
NP_442438.1_10 Forward -183 -169 11.7993 0.0436
NP_442438.1_10 Reverse -200 -214 10.3243 0.0547
NP_442438.1_10 Forward -238 -224 1.86788 0.188
NP_442438.1_10 Forward -171 -157 -0.983719 0.287
NP_442431.1_7 Forward -278 -259 5.70265 0.273
NP_442431.1_10 Reverse -296 -314 3.26407 0.22
NP_441000.1_6 Reverse -168 -182 12.586 0.0408
NP_441000.1_6 Forward -179 -165 4.81781 0.0933
NP_442771.1_1 Forward -180 -162 -0.374176 0.105
NP_442771.1_1 Forward -317 -299 -3.91409 0.166
NP_442771.1_1 Reverse -299 -317 -11.1906 0.299
NP_441674.1_10 Forward -317 -299 0.117479 0.29
NP_440147.1_4 Forward -180 -167 11.524 0.0326
NP_440147.1_4 Reverse -167 -180 2.08423 0.21
NP_440147.1_4 Reverse -304 -317 1.9859 0.213
NP_441550.1_8 Reverse -222 -232 10.9926 0.0578
NP_441550.1_8 Reverse -167 -177 10.501 0.066
NP_441550.1_8 Forward -157 -147 9.12434 0.106
NP_441550.1_8 Forward -180 -170 6.0761 0.214
NP_441550.1_8 Forward -235 -225 5.58445 0.242
NP_441550.1_8 Forward -317 -307 4.60114 0.299
NP_441916.1_7 Forward -178 -168 18.4663 0.00144
NP_441916.1_7 Reverse -169 -179 18.4663 0.00144
NP_441916.1_10 Forward -228 -209 2.0644 0.253
NP_440465.1_10 Forward -349 -330 18.0924 0.0523
NP_440465.1_10 Forward -181 -162 -1.47551 0.295
NP_441041.1_4 Forward -178 -159 1.0811 0.0818
NP_441041.1_7 Reverse -166 -178 19.5648 0.00277
NP_440509.1_6 Forward -345 -326 -1.86883 0.249
NP_441725.1_5 Reverse -170 -180 11.2881 0.0247
NP_441725.1_5 Forward -177 -167 9.02648 0.0553
NP_441725.1_5 Reverse -225 -235 5.09324 0.115
NP_441725.1_5 Reverse -147 -157 -0.904945 0.274
NP_439966.1_7 Forward -180 -170 18.4657 0.00473
NP_439966.1_7 Reverse -167 -177 17.4824 0.00636
NP_439966.1_7 Reverse -222 -232 10.6976 0.0838
NP_439966.1_9 Reverse -167 -176 10.7178 0.0863
NP_439966.1_9 Forward -180 -171 0.983037 0.253
NP_440202.1_8 Forward -284 -265 9.51453 0.297
NP_442941.1_3 Reverse -170 -180 11.4848 0.0116
NP_442941.1_3 Forward -177 -167 2.53664 0.14
NP_442941.1_3 Forward -232 -222 -0.216628 0.252
NP_440674.1_3 Forward -171 -152 1.86774 0.273
NP_440289.1_2 Reverse -166 -179 12.999 0.0132
NP_440289.1_2 Forward -181 -168 5.23083 0.0636
NP_440289.1_2 Reverse -202 -215 -0.275709 0.19
NP_440983.1_5 Reverse -151 -170 -1.67217 0.228
NP_440983.1_5 Forward -316 -297 -5.11376 0.263
NP_440983.1_5 Forward -178 -159 -8.35868 0.295
NP_442281.1_1 Reverse -164 -178 16.4202 0.00801
NP_442281.1_1 Forward -183 -169 11.5037 0.0462
NP_442281.1_1 Forward -219 -205 3.24392 0.238
NP_442281.1_2 Reverse -154 -173 16.8141 0.124
NP_442901.1_4 Reverse -316 -335 -1.86883 0.291
NP_442575.1_8 Forward -123 -104 -6.68705 0.286
NP_440437.1_1 Reverse -163 -182 3.24438 0.124
NP_440437.1_1 Forward -184 -165 -3.04881 0.232
NP_441457.1_7 Forward -222 -203 4.71934 0.206
NP_440498.1_1 Forward -187 -169 -1.55415 0.225
NP_442982.1_5 Forward -188 -169 -3.24547 0.297
NP_443030.1_3 Reverse -163 -181 2.87075 0.298
NP_441644.1_6 Reverse -224 -234 11.1893 0.0538
NP_441644.1_6 Forward -178 -168 10.1076 0.0628
NP_441644.1_6 Reverse -169 -179 10.1076 0.0628
NP_441644.1_6 Reverse -211 -221 5.78111 0.176
NP_441644.1_6 Reverse -205 -215 3.32285 0.288
NP_440867.1_10 Reverse -336 -355 6.39097 0.256
NP_442215.1_2 Reverse -167 -183 -3.8747 0.223
NP_442215.1_2 Forward -216 -200 -4.1697 0.228
NP_441810.1_9 Reverse -162 -181 19.764 0.0219
NP_440253.1_2 Forward -178 -160 -1.45582 0.242
NP_440253.1_2 Reverse -169 -187 -2.53746 0.268
NP_440929.1_8 Forward -178 -169 19.2726 0.000701
NP_440929.1_8 Reverse -169 -178 19.2726 0.000701
NP_440929.1_8 Forward -315 -306 5.40793 0.138
NP_440929.1_8 Reverse -224 -233 4.81794 0.176
NP_440929.1_8 Reverse -146 -155 4.81794 0.176
NP_440929.1_8 Forward -287 -278 0.884706 0.293
NP_442933.1_10 Forward -178 -169 17.601 0.00325
NP_442933.1_10 Reverse -169 -178 17.601 0.00325
NP_441751.2_8 Forward -177 -163 4.52282 0.0494
NP_441751.2_8 Reverse -206 -220 -6.29359 0.259
NP_442926.1_1 Reverse -293 -312 -5.31042 0.278
NP_442926.1_3 Forward -177 -158 2.75272 0.295
NP_442926.1_5 Reverse -164 -183 11.3381 0.219
NP_442554.1_8 Forward -177 -167 16.008 0.0065
NP_442554.1_8 Reverse -170 -180 13.8447 0.0145
NP_442554.1_8 Forward -232 -222 12.7631 0.0225
NP_442554.1_8 Forward -154 -144 7.55152 0.0893
NP_442554.1_8 Reverse -225 -235 2.7333 0.259
NP_442554.1_8 Reverse -206 -216 2.7333 0.259
NP_441762.1_7 Forward -179 -167 21.5735 0.00342
NP_441762.1_7 Reverse -168 -180 12.0354 0.0142
NP_442142.1_4 Reverse -166 -179 16.4399 0.0264
NP_442142.1_4 Forward -181 -168 10.5401 0.0712
NP_442142.1_4 Reverse -154 -167 10.0485 0.0806
NP_442142.1_4 Forward -337 -324 9.45847 0.095
NP_442292.1_1 Forward -177 -168 9.63616 0.0183
NP_442292.1_1 Reverse -170 -179 9.63616 0.0183
NP_442292.1_1 Forward -154 -145 6.09625 0.116
NP_442476.1_6 Reverse -170 -184 4.42448 0.143
NP_442381.1_8 Reverse -166 -185 -13.7669 0.279
NP_443009.1_5 Reverse -168 -179 11.6612 0.0602
NP_443009.1_5 Forward -179 -168 11.6612 0.0602
NP_442408.2_1 Reverse -169 -188 -1.27885 0.234
NP_441715.1_4 Reverse -170 -180 16.303 0.0117
NP_441715.1_4 Forward -177 -167 9.32148 0.097
NP_441448.1_1 Forward -277 -258 19.469 0.0911
NP_441448.1_1 Forward -165 -146 4.22769 0.279
NP_441198.1_8 Reverse -138 -148 11.6111 0.193
NP_440379.1_5 Forward -175 -156 -0.688862 0.184
NP_441468.1_1 Forward -177 -170 15.8704 0.0124
NP_441468.1_1 Reverse -170 -177 15.8704 0.0124
NP_441468.1_1 Forward -232 -225 4.07068 0.263
NP_441020.2_6 Forward -180 -163 9.97027 0.156
NP_441020.2_6 Reverse -167 -184 9.28195 0.176
NP_441015.1_10 Reverse -164 -183 -3.93378 0.195
NP_441015.1_10 Forward -171 -152 -6.98204 0.26
NP_441015.1_10 Reverse -290 -309 -11.3086 0.294
NP_441015.1_10 Reverse -296 -315 -11.4069 0.296
NP_441673.1_1 Forward -178 -169 20.8459 0.000698
NP_441673.1_1 Reverse -169 -178 20.8459 0.000698
NP_441673.1_1 Reverse -306 -315 -8.06341 0.254
NP_441673.1_1 Reverse -205 -214 -8.06341 0.254
NP_441826.1_2 Reverse -163 -177 13.8643 0.0213
NP_441826.1_2 Forward -184 -170 10.226 0.0498
NP_441826.1_2 Reverse -270 -284 -0.393733 0.212
NP_441826.1_5 Reverse -296 -315 4.62101 0.253
NP_441826.1_5 Forward -213 -194 0.884433 0.298
NP_441330.1_1 Forward -183 -164 -10.6203 0.183
NP_442490.1_9 Forward -178 -159 -7.76869 0.278
NP_442868.1_6 Reverse -167 -177 8.53483 0.0555
NP_442868.1_6 Forward -180 -170 0.963343 0.205
NP_442868.1_6 Reverse -222 -232 -0.216628 0.273
NP_441056.1_1 Forward -155 -136 -7.08038 0.271
NP_441056.1_1 Forward -178 -159 -8.26035 0.282
NP_442677.1_7 Forward -306 -296 16.893 0.27
NP_442227.1_2 Reverse -107 -126 -1.47551 0.262
NP_442227.1_2 Forward -338 -319 -2.55715 0.276
NP_442227.1_2 Forward -314 -295 -3.54046 0.293
NP_442427.1_3 Reverse -164 -182 6.80398 0.171
NP_442808.1_1 Forward -179 -169 18.4657 0.00201
NP_442808.1_1 Reverse -168 -178 18.4657 0.00201
NP_442808.1_1 Forward -309 -299 5.38779 0.155
NP_442808.1_1 Forward -335 -325 3.22451 0.247
NP_441101.1_2 Forward -189 -170 17.2065 0.174
NP_441101.1_10 Reverse -220 -239 -6.68705 0.29
NP_440031.1_10 Forward -286 -267 9.93088 0.167
NP_442542.1_2 Reverse -167 -180 12.409 0.114
NP_442542.1_2 Forward -235 -222 8.67241 0.152
NP_442542.1_9 Forward -185 -171 12.5853 0.11
NP_442050.1_1 Reverse -324 -343 7.47261 0.272
NP_442050.1_5 Forward -180 -170 9.12434 0.193
NP_442050.1_5 Reverse -167 -177 8.23937 0.234
NP_442050.1_8 Reverse -118 -137 13.6959 0.272
NP_442747.1_1 Forward -238 -219 -7.67036 0.218
NP_440558.1_2 Reverse -208 -227 -3.44213 0.236
NP_442789.1_4 Reverse -308 -327 -7.96535 0.299
NP_441878.1_6 Forward -179 -169 10.4031 0.0176
NP_441878.1_6 Reverse -168 -178 10.4031 0.0176
NP_441878.1_6 Forward -234 -224 1.65166 0.0795
NP_441878.1_6 Forward -347 -337 0.963343 0.128
NP_441878.1_6 Reverse -336 -346 -0.0199663 0.163
NP_441878.1_6 Forward -316 -306 -0.118297 0.167
NP_441878.1_6 Reverse -204 -214 -7.19813 0.21
NP_441036.1_8 Forward -179 -169 17.7779 0.000554
NP_441036.1_8 Reverse -168 -178 17.7779 0.000554
NP_441036.1_8 Forward -238 -228 7.05986 0.21
NP_442650.1_2 Forward -155 -141 19.9608 0.0526
NP_441557.1_5 Forward -178 -169 19.9609 0.000699
NP_441557.1_5 Reverse -169 -178 19.9609 0.000699
NP_441557.1_8 Forward -307 -297 16.3025 0.18
NP_441557.1_8 Reverse -109 -119 10.206 0.292
NP_441445.1_1 Reverse -322 -341 6.98095 0.138
NP_441445.1_1 Forward -187 -168 0.196116 0.281
NP_442267.1_4 Reverse -114 -133 3.14605 0.223
NP_442066.2_4 Forward -178 -159 -2.45882 0.211
NP_442066.2_9 Reverse -165 -178 8.37742 0.185
NP_441433.1_8 Forward -123 -104 -0.4922 0.246
NP_442777.1_1 Forward -286 -267 5.89851 0.275
NP_442962.1_1 Forward -244 -225 8.06259 0.239
NP_442419.1_2 Reverse -164 -183 10.7175 0.122
NP_442419.1_2 Forward -183 -164 -4.72043 0.292
NP_441308.1_8 Forward -180 -170 10.1081 0.22
NP_441308.1_8 Reverse -167 -177 9.22315 0.226
NP_440101.1_3 Forward -238 -219 3.04771 0.239
NP_441564.1_2 Forward -238 -219 1.76941 0.188
NP_442469.1_8 Forward -168 -154 12.291 0.291
NP_442183.1_1 Forward -178 -164 18.3875 0.00758
NP_442183.1_1 Reverse -306 -320 8.94771 0.105
NP_442183.1_1 Forward -155 -141 8.35772 0.118
NP_442183.1_1 Reverse -169 -183 8.16106 0.121
NP_442183.1_1 Reverse -140 -154 5.50613 0.215
NP_441574.1_1 Forward -178 -159 8.35759 0.11
NP_441549.1_9 Reverse -220 -238 -3.71743 0.198
NP_441549.1_9 Reverse -142 -160 -10.4039 0.278
NP_441549.1_9 Forward -344 -326 -10.7973 0.288
NP_442347.1_2 Forward -177 -168 11.1111 0.056
NP_442347.1_2 Reverse -170 -179 11.1111 0.056
NP_442645.1_2 Forward -222 -203 -17.8968 0.266
NP_442645.1_2 Reverse -167 -186 -20.3551 0.288
NP_442888.1_9 Forward -178 -159 21.6323 0.034
NP_441037.1_4 Reverse -167 -177 16.2838 0.0168
NP_441037.1_4 Forward -235 -225 7.51261 0.237
NP_441037.1_4 Forward -180 -170 7.02532 0.237
NP_442594.1_7 Forward -189 -170 7.07848 0.196
NP_442317.1_6 Reverse -332 -351 6.88262 0.231
NP_441633.1_3 Forward -180 -167 13.3923 0.018
NP_441633.1_3 Reverse -167 -180 3.5592 0.0699
NP_441633.1_3 Reverse -144 -157 -4.40561 0.195
NP_441633.1_3 Reverse -222 -235 -6.07724 0.236
NP_441633.1_3 Forward -287 -274 -6.76555 0.271
NP_440136.1_2 Forward -177 -170 15.9687 0.0123
NP_440136.1_2 Reverse -170 -177 15.9687 0.0123
NP_440136.1_2 Forward -148 -141 3.97235 0.288
NP_442590.1_10 Forward -184 -165 9.0459 0.2
NP_442590.1_10 Forward -178 -159 7.17762 0.23
NP_442590.1_10 Reverse -318 -337 3.6377 0.289
NP_441728.2_8 Reverse -164 -183 15.9291 0.259
NP_442998.1_2 Reverse -146 -165 6.88182 0.254
NP_442998.1_5 Forward -13 -3 7.84651 0.28
NP_442998.1_5 Reverse -182 -192 7.35486 0.295
NP_442998.1_10 Forward -176 -169 15.5754 0.0102
NP_442998.1_10 Reverse -171 -178 15.5754 0.0102
NP_442998.1_10 Reverse -148 -155 5.74231 0.255
NP_440299.1_1 Reverse -165 -178 11.4251 0.0489
NP_440299.1_1 Forward -182 -169 8.18017 0.0964
NP_440299.1_1 Reverse -142 -155 6.0169 0.155
NP_441799.1_1 Forward -182 -168 15.0436 0.0206
NP_441799.1_1 Reverse -165 -179 5.01387 0.227
NP_440640.1_6 Reverse -193 -212 -0.787193 0.292
NP_441007.1_10 Reverse -164 -177 5.42749 0.182
NP_440256.1_1 Reverse -166 -185 11.0125 0.0162
NP_440256.1_1 Forward -217 -198 3.24438 0.0553
NP_440256.1_1 Reverse -352 -371 -8.55534 0.263
NP_441512.1_4 Forward -182 -163 9.63589 0.237
NP_441559.1_8 Reverse -164 -178 -6.19526 0.275
NP_441559.1_8 Forward -183 -169 -6.98191 0.281
NP_440915.1_6 Reverse -165 -179 15.9292 0.0183
NP_440915.1_6 Forward -59 -45 0.0979218 0.176
NP_440915.1_6 Reverse -302 -316 -1.5737 0.239
NP_442855.1_3 Forward -121 -102 12.5858 0.237
NP_441179.1_9 Reverse -155 -165 17.2858 0.212
NP_441179.1_9 Forward -336 -326 8.73102 0.284
NP_441296.1_9 Forward -149 -136 13.6867 0.214
NP_441296.1_9 Forward -314 -301 9.06515 0.286
NP_440717.1_2 Reverse -299 -318 -11.1119 0.271
NP_440717.1_3 Reverse -105 -119 10.5204 0.231
NP_440717.1_3 Reverse -111 -125 8.16044 0.27
NP_441704.1_8 Forward -189 -170 10.9134 0.146
NP_441704.1_8 Reverse -77 -96 6.1935 0.262
NP_440748.1_5 Forward -175 -156 2.26107 0.223
NP_441464.1_8 Reverse -224 -238 3.53951 0.296
NP_441939.1_3 Forward -177 -158 22.8122 0.00342
NP_441199.1_6 Forward -182 -163 14.0608 0.0427
NP_439985.1_7 Forward -239 -220 13.6675 0.163
NP_442993.1_1 Forward -178 -162 0.746852 0.0615
NP_442993.1_1 Reverse -169 -185 -7.80794 0.146
NP_442993.1_1 Reverse -331 -347 -13.5111 0.292
NP_440677.1_1 Reverse -160 -179 8.45592 0.21
NP_442386.1_9 Reverse -168 -177 15.7322 0.0144
NP_442386.1_9 Forward -179 -170 15.7322 0.0144
NP_442386.1_9 Forward -150 -141 10.5207 0.126
NP_442386.1_9 Reverse -223 -232 8.55409 0.193
NP_442386.1_9 Reverse -156 -165 4.52254 0.297
NP_442386.1_10 Reverse -299 -312 14.3756 0.107
NP_440570.1_5 Reverse -297 -316 5.60432 0.191
NP_440570.1_5 Reverse -153 -172 -2.16383 0.277
NP_440570.1_5 Reverse -195 -214 -3.04881 0.286
NP_441340.1_5 Forward -177 -170 15.6737 0.0124
NP_441340.1_5 Reverse -170 -177 15.6737 0.0124
NP_441340.1_5 Forward -232 -225 4.07068 0.239
NP_441340.1_9 Forward -14 -4 8.25522 0.256
NP_441947.1_4 Forward -189 -170 13.5691 0.22
NP_441947.1_10 Forward -180 -162 1.59244 0.276
NP_442484.1_2 Reverse -110 -129 2.0644 0.226
NP_442484.1_2 Reverse -213 -232 0.491109 0.247
NP_442791.1_5 Forward -372 -353 -7.4737 0.279
NP_442240.1_2 Reverse -170 -189 -16.8151 0.249
NP_440586.1_1 Reverse -162 -181 -3.63879 0.272
NP_440586.1_1 Forward -176 -157 -4.81876 0.278
NP_440586.1_8 Forward -177 -170 13.2151 0.026
NP_440586.1_8 Reverse -170 -177 13.2151 0.026
NP_440586.1_8 Reverse -225 -232 7.61025 0.227
NP_440586.1_8 Forward -165 -158 5.8403 0.283
NP_442251.1_6 Forward -177 -170 15.2804 0.0124
NP_442251.1_6 Reverse -170 -177 15.2804 0.0124
NP_440192.1_4 Reverse -296 -315 14.0546 0.169
NP_440684.1_9 Reverse -163 -177 8.94771 0.221
NP_441262.1_3 Reverse -169 -176 14.7888 0.0223
NP_441262.1_3 Forward -178 -171 14.7888 0.0223
NP_441262.1_3 Forward -233 -226 5.34899 0.181
NP_440027.1_3 Forward -314 -296 7.68819 0.207
NP_443051.1_1 Reverse -168 -177 10.4228 0.00754
NP_443051.1_1 Forward -179 -170 10.4228 0.00754
NP_443051.1_1 Forward -156 -147 5.40793 0.0926
NP_443051.1_1 Forward -234 -225 3.34298 0.118
NP_439937.1_8 Forward -180 -161 8.06259 0.191
NP_439937.1_8 Reverse -155 -174 -3.63879 0.271
NP_439937.1_9 Forward -179 -162 -0.650168 0.122
NP_439937.1_9 Reverse -223 -240 -7.63163 0.164
NP_440408.1_10 Reverse -163 -182 6.09597 0.238
NP_440439.1_1 Forward -181 -168 17.8172 0.0105
NP_440439.1_1 Reverse -166 -179 9.65572 0.0447
NP_440439.1_1 Reverse -303 -316 0.412608 0.192
NP_440439.1_1 Forward -122 -109 -1.75067 0.281
NP_442239.1_8 Reverse -301 -320 7.17762 0.258
NP_442239.1_8 Reverse -295 -314 4.42435 0.297
NP_440372.1_2 Forward -177 -170 16.3621 0.0124
NP_440372.1_2 Reverse -170 -177 16.3621 0.0124
NP_440372.1_2 Forward -232 -225 4.07068 0.262
NP_440372.1_2 Forward -154 -147 4.07068 0.262
NP_442511.1_5 Forward -30 -11 12.2875 0.265
NP_441789.1_7 Reverse -152 -171 3.63691 0.194
NP_441789.1_7 Reverse -109 -128 -4.22953 0.28
NP_440819.1_5 Reverse -236 -244 6.41093 0.285
NP_440316.1_10 Reverse -298 -308 5.38824 0.299
NP_441803.1_2 Forward -183 -164 16.1257 0.0361
NP_441803.1_2 Forward -232 -213 5.50599 0.169
NP_441803.1_2 Forward -219 -200 2.65439 0.206
NP_441803.1_2 Reverse -131 -150 -0.688862 0.284
NP_439977.1_5 Forward -161 -142 0.687771 0.205
NP_439977.1_5 Reverse -163 -182 -0.4922 0.227
NP_440139.1_1 Forward -184 -165 9.53674 0.097
NP_441572.1_7 Reverse -163 -182 5.99764 0.0851
NP_442384.1_10 Reverse -169 -182 8.37742 0.0656
NP_442384.1_10 Forward -315 -302 2.37923 0.228
NP_442384.1_10 Forward -178 -165 2.2809 0.23
NP_442384.1_10 Forward -233 -220 1.69091 0.249
NP_442114.1_4 Forward -178 -167 12.1534 0.107
NP_441877.1_7 Forward -183 -164 6.98015 0.218
NP_442262.1_10 Forward -177 -170 14.1988 0.0123
NP_442262.1_10 Reverse -170 -177 14.1988 0.0123
NP_442262.1_10 Reverse -225 -232 10.6589 0.14
NP_441689.1_5 Forward -180 -170 8.53436 0.132
NP_440344.1_10 Reverse -162 -179 19.2134 0.00218
NP_440344.1_10 Forward -185 -168 -8.90928 0.135
NP_440282.1_10 Reverse -327 -346 -0.787193 0.21
NP_440531.1_6 Reverse -268 -287 -1.18052 0.229
NP_440531.1_6 Forward -186 -167 -3.54046 0.268
NP_442123.1_3 Reverse -169 -188 10.0292 0.294
NP_440487.1_1 Reverse -166 -185 -5.11376 0.214
NP_440826.1_5 Forward -355 -337 16.2543 0.231
NP_441965.1_10 Reverse -166 -182 5.76173 0.197
NP_440297.1_1 Forward -343 -324 8.94757 0.197
NP_440297.1_9 Reverse -170 -180 9.32148 0.0917
NP_440297.1_9 Reverse -225 -235 0.275027 0.282
NP_440297.1_9 Forward -177 -167 -0.216628 0.282
NP_440350.1_2 Reverse -117 -136 7.7676 0.248
NP_442280.1_10 Reverse -106 -124 7.79204 0.268
NP_441896.1_3 Reverse -160 -179 0.294447 0.229
NP_441103.1_9 Reverse -112 -122 13.0755 0.27
NP_440894.1_10 Forward -183 -164 9.3409 0.163
NP_440894.1_10 Forward -290 -271 4.12936 0.258
NP_440937.1_5 Reverse -292 -311 8.94757 0.275
NP_440999.1_9 Reverse -165 -179 14.6509 0.0277
NP_440888.1_2 Forward -178 -164 19.1735 0.00165
NP_440888.1_2 Reverse -169 -183 16.9119 0.00511
NP_440888.1_2 Forward -214 -200 13.6669 0.026
NP_440491.1_1 Forward -181 -162 14.0314 0.114
NP_442948.1_2 Reverse -168 -187 6.09597 0.245
NP_441543.1_2 Forward -177 -168 18.486 0.00236
NP_441543.1_2 Reverse -170 -179 18.486 0.00236
NP_442845.1_2 Reverse -163 -177 7.17775 0.198
NP_442845.1_2 Forward -155 -141 6.78443 0.202
NP_442845.1_4 Reverse -167 -186 11.6025 0.178
NP_441834.1_7 Forward -137 -118 15.2408 0.248
NP_441918.1_7 Forward -86 -67 -0.590531 0.297
NP_439904.1_7 Reverse -185 -204 15.8307 0.139
NP_441469.1_8 Reverse -168 -177 16.126 0.00797
NP_441469.1_8 Forward -179 -170 16.126 0.00797
NP_441469.1_8 Reverse -204 -213 11.3078 0.173
NP_443064.1_6 Forward -315 -305 11.8882 0.113
NP_442578.1_7 Forward -177 -170 14.5921 0.026
NP_442578.1_7 Reverse -170 -177 14.5921 0.026
NP_441462.1_2 Forward -178 -168 11.5831 0.00406
NP_441462.1_2 Reverse -169 -179 11.5831 0.00406
NP_441462.1_2 Reverse -306 -316 -0.41329 0.225
NP_441621.1_7 Forward -180 -166 6.09611 0.068
NP_441621.1_7 Reverse -167 -181 5.99778 0.068
NP_441621.1_7 Forward -168 -154 -2.55701 0.188
NP_443062.1_1 Forward -178 -160 14.2989 0.0493
NP_443062.1_1 Forward -334 -316 4.45062 0.26
NP_443062.1_6 Forward -186 -167 2.45773 0.255
NP_443062.1_6 Reverse -161 -180 1.47442 0.275
NP_441601.1_4 Forward -315 -296 -1.86883 0.293
NP_441601.1_4 Reverse -268 -287 -4.42544 0.293
NP_440349.1_3 Forward -177 -158 11.7 0.282
NP_442204.1_5 Reverse -159 -178 6.09597 0.147
NP_442204.1_5 Forward -188 -169 -0.590531 0.293
NP_440516.1_2 Reverse -163 -181 -2.3408 0.299
NP_440516.1_8 Forward -178 -169 16.9127 0.00442
NP_440516.1_8 Reverse -169 -178 16.9127 0.00442
NP_440516.1_8 Forward -155 -146 -0.196935 0.185
NP_441785.1_1 Forward -178 -164 14.2897 0.164
NP_442428.1_4 Forward -179 -160 3.73603 0.24
NP_442428.1_4 Reverse -102 -121 2.65439 0.251
NP_442428.1_5 Forward -177 -170 15.8704 0.0124
NP_442428.1_5 Reverse -170 -177 15.8704 0.0124
NP_442428.1_5 Forward -232 -225 4.46401 0.267
NP_442428.1_8 Forward -170 -151 2.94938 0.224
NP_441068.1_5 Forward -148 -129 20.2556 0.291
NP_442120.1_10 Forward -178 -159 0.392778 0.157
NP_442120.1_10 Reverse -205 -224 -9.73531 0.244
NP_442120.1_10 Reverse -163 -182 -13.8652 0.288
NP_441867.1_2 Reverse -298 -317 -16.2252 0.291
NP_440673.1_2 Forward -188 -169 10.5847 0.203
NP_440673.1_3 Forward -176 -169 12.4288 0.0426
NP_440673.1_3 Reverse -171 -178 12.4288 0.0426
NP_440673.1_7 Reverse -265 -284 17.5024 0.0608
NP_441714.1_3 Reverse -162 -180 12.8997 0.26
NP_440865.1_9 Reverse -308 -327 -8.85033 0.271
NP_440865.1_9 Reverse -163 -182 -8.85033 0.271
NP_441052.1_2 Forward -178 -168 10.5014 0.0285
NP_441052.1_2 Reverse -169 -179 10.5014 0.0285
NP_442219.1_8 Reverse -120 -139 7.10414 0.277
NP_442219.1_9 Forward -177 -168 8.35786 0.0681
NP_442219.1_9 Reverse -170 -179 8.35786 0.0681
NP_442219.1_9 Reverse -141 -150 5.60459 0.146
NP_440436.1_4 Forward -177 -168 18.1905 0.00233
NP_440436.1_4 Reverse -170 -179 18.1905 0.00233
NP_441884.1_8 Forward -179 -160 -8.55534 0.262
NP_441884.1_8 Reverse -168 -187 -10.6203 0.268
NP_441884.1_9 Reverse -166 -185 -3.14714 0.0594
NP_441884.1_9 Reverse -145 -164 -23.1083 0.284
NP_442086.1_6 Forward -178 -159 8.65258 0.274
NP_442412.1_3 Forward -290 -271 22.0256 0.0367
NP_441719.1_4 Forward -177 -170 16.3621 0.0124
NP_441719.1_4 Reverse -170 -177 16.3621 0.0124
NP_441733.1_10 Reverse -166 -179 19.9805 0.0151
NP_441004.1_1 Reverse -301 -320 -8.06369 0.2
NP_441004.1_1 Reverse -193 -212 -10.7186 0.225
NP_441004.1_2 Reverse -296 -315 8.94757 0.163
NP_442366.1_3 Forward -179 -161 9.75391 0.054
NP_442366.1_3 Reverse -168 -186 -2.63579 0.231
NP_442873.1_9 Reverse -324 -343 4.62021 0.287
NP_441115.1_4 Forward -179 -161 13.9813 0.0645
NP_443054.1_2 Forward -180 -166 22.0257 0.00482
NP_443054.1_2 Forward -287 -273 -0.295402 0.293
NP_442430.1_10 Reverse -159 -178 17.4032 0.0779
NP_441851.1_10 Forward -179 -169 16.008 0.00552
NP_441851.1_10 Reverse -168 -178 16.008 0.00552
NP_441851.1_10 Forward -234 -224 4.79825 0.247
NP_440682.1_2 Forward -171 -152 -16.6185 0.25
NP_441501.1_9 Reverse -329 -348 14.1583 0.281
NP_442856.1_7 Reverse -361 -380 -2.65548 0.236
NP_441668.1_4 Reverse -285 -304 -2.36049 0.288
NP_442515.1_1 Reverse -168 -182 1.08123 0.172
NP_442515.1_1 Reverse -305 -319 -4.03198 0.298
NP_440463.1_8 Forward -173 -154 9.53296 0.247
NP_440463.1_8 Reverse -108 -127 9.14571 0.247
NP_440940.1_7 Forward -374 -356 6.1149 0.225
NP_441349.1_10 Forward -188 -169 -0.983855 0.0981
NP_441661.1_3 Reverse -179 -196 2.20212 0.226
NP_440432.1_9 Reverse -170 -185 -1.88839 0.167
NP_442843.1_1 Forward -232 -213 -4.52377 0.239
NP_439960.1_10 Reverse -156 -174 -4.11075 0.292
NP_440474.1_8 Forward -177 -163 13.4703 0.0696
NP_440474.1_8 Reverse -170 -184 5.30886 0.251
NP_441596.1_3 Reverse -294 -312 21.4553 0.0801
NP_442450.1_5 Forward -180 -170 9.32148 0.115
NP_440588.1_2 Forward -187 -168 1.27776 0.138
NP_440588.1_2 Reverse -160 -179 -0.590531 0.151
NP_440588.1_2 Reverse -328 -347 -6.68705 0.289
NP_440195.1_4 Reverse -157 -176 6.29264 0.273
NP_440195.1_5 Forward -239 -220 2.55606 0.276
NP_442006.1_2 Forward -124 -107 -7.72931 0.182
NP_442006.1_2 Forward -125 -108 -16.5791 0.256
NP_441003.1_9 Reverse -328 -347 6.19431 0.254
NP_440483.1_1 Reverse -156 -175 -7.4737 0.265
NP_441570.1_1 Reverse -169 -187 2.37909 0.0252
NP_441570.1_1 Forward -155 -137 -10.4039 0.17
NP_441570.1_1 Forward -178 -160 -17.7788 0.291
NP_440078.1_10 Reverse -325 -344 6.4893 0.224
NP_441078.1_4 Forward -178 -169 19.6659 0.0007
NP_441078.1_4 Reverse -169 -178 19.6659 0.0007
NP_441078.1_4 Reverse -205 -214 -1.77023 0.266
NP_442729.1_4 Forward -314 -295 15.2399 0.259
NP_442729.1_5 Forward -167 -157 8.04317 0.251
NP_442729.1_7 Reverse -210 -228 14.4738 0.183
NP_442729.1_8 Reverse -165 -178 8.47575 0.125
NP_440539.1_9 Reverse -258 -277 -5.50708 0.286
NP_442443.1_1 Reverse -300 -319 -5.50708 0.282
NP_440526.1_3 Forward -177 -166 11.7595 0.0646
NP_440526.1_3 Reverse -225 -236 0.156538 0.297
NP_441432.1_8 Reverse -168 -177 8.25953 0.0755
NP_441432.1_8 Forward -179 -170 8.25953 0.0755
NP_442320.1_8 Reverse -163 -177 16.8142 0.00635
NP_442320.1_8 Forward -184 -170 4.81781 0.0459
NP_442344.1_7 Forward -177 -158 -8.06369 0.202
NP_441732.1_2 Forward -182 -166 -7.51295 0.0859
NP_441732.1_2 Reverse -165 -181 -14.9861 0.145
NP_440760.1_1 Forward -178 -159 -11.8003 0.0882
NP_440760.1_1 Reverse -146 -165 -22.6167 0.263
NP_440760.1_1 Reverse -250 -269 -23.01 0.278
NP_440760.1_7 Reverse -93 -112 5.99684 0.211
NP_442797.1_6 Forward -176 -157 17.339 0.17
NP_442797.1_7 Forward -179 -161 7.09898 0.198
NP_442797.1_7 Reverse -323 -341 3.95239 0.234
NP_440131.1_2 Reverse -156 -175 6.19431 0.279
NP_440199.1_10 Forward -181 -171 13.2547 0.108
NP_441945.1_10 Forward -173 -154 11.3075 0.238
NP_441057.1_4 Reverse -295 -313 13.6872 0.14
NP_441072.1_2 Reverse -295 -314 13.8641 0.159
NP_440713.1_4 Reverse -159 -178 4.81767 0.222
NP_440713.1_4 Reverse -295 -314 3.44104 0.244
NP_440713.1_4 Forward -359 -340 2.45773 0.262
NP_442489.1_2 Forward -189 -170 9.53756 0.168
NP_442489.1_7 Forward -178 -169 20.1576 0.000695
NP_442489.1_7 Reverse -169 -178 20.1576 0.000695
NP_442489.1_7 Reverse -205 -214 -1.27858 0.185
NP_442489.1_7 Forward -233 -224 -1.6719 0.235
NP_441830.1_2 Reverse -291 -310 -4.13045 0.275
NP_440757.1_7 Reverse -326 -344 -0.669169 0.269
NP_440559.1_1 Reverse -170 -179 8.75118 0.0586
NP_440559.1_1 Forward -177 -168 8.75118 0.0586
NP_440559.1_1 Forward -232 -223 4.91628 0.175
NP_442763.1_1 Reverse -301 -320 13.9625 0.223
NP_441659.2_8 Forward -178 -168 11.9764 0.0147
NP_441659.2_8 Reverse -169 -179 11.9764 0.0147
NP_441659.2_8 Reverse -224 -234 10.7964 0.0219
NP_442913.1_10 Forward -242 -223 4.81767 0.0824
NP_440442.1_1 Forward -91 -72 5.60432 0.272
NP_440779.1_5 Reverse -224 -241 -6.05768 0.159
NP_442346.1_1 Forward -177 -158 13.5691 0.27
NP_442346.1_5 Forward -179 -169 9.02648 0.118
NP_442346.1_5 Reverse -168 -178 9.02648 0.118
NP_442346.1_5 Reverse -223 -233 4.40493 0.29
NP_442346.1_10 Reverse -335 -354 -0.885524 0.28
NP_440545.1_3 Forward -182 -165 -1.14113 0.163
NP_440545.1_3 Reverse -165 -182 -1.82945 0.175
NP_440545.1_3 Forward -237 -220 -4.68105 0.23
NP_440545.1_3 Reverse -220 -237 -6.64766 0.285
NP_441629.1_3 Reverse -259 -278 -4.1312 0.29
NP_441923.1_6 Reverse -158 -172 12.1926 0.24
NP_441923.1_6 Forward -123 -109 9.83269 0.278
NP_441126.1_8 Reverse -296 -309 13.1956 0.291
NP_440459.1_2 Forward -187 -170 7.31533 0.296
NP_441653.1_2 Reverse -158 -177 18.5079 0.0332
NP_440010.1_4 Forward -182 -163 6.88182 0.197
NP_440010.1_4 Reverse -153 -172 5.80018 0.199
NP_440010.1_10 Forward -142 -123 3.83436 0.25
NP_442551.1_4 Forward -348 -333 -2.77337 0.276
NP_440847.1_3 Reverse -225 -239 12.6836 0.234
NP_441233.1_2 Reverse -296 -315 13.2741 0.231
NP_441888.1_7 Reverse -164 -178 2.65453 0.225
NP_440449.1_6 Reverse -161 -179 11.7573 0.128
NP_440449.1_6 Reverse -294 -312 4.94889 0.287
NP_441948.1_4 Forward -185 -167 24.4052 0.0121
NP_441047.1_2 Forward -171 -152 -3.63879 0.298
NP_441833.1_4 Forward -177 -170 15.9687 0.0124
NP_441833.1_4 Reverse -170 -177 15.9687 0.0124
NP_441895.1_10 Reverse -234 -253 -27.7299 0.29
NP_442060.1_10 Reverse -258 -277 10.0292 0.244
NP_442162.1_9 Forward -177 -170 16.2637 0.0124
NP_442162.1_9 Reverse -170 -177 16.2637 0.0124
NP_440671.1_4 Reverse -163 -177 11.5043 0.132
NP_440671.1_4 Reverse -199 -213 10.521 0.155
NP_440671.1_4 Reverse -325 -339 9.2427 0.184
NP_440671.1_4 Forward -184 -170 7.66941 0.21
NP_442404.1_9 Forward -175 -161 10.6187 0.263
NP_442073.1_6 Reverse -160 -179 -2.36049 0.286
NP_442199.1_5 Reverse -161 -180 -1.67217 0.181
NP_442199.1_5 Forward -372 -353 -5.21209 0.24
NP_442140.1_3 Forward -177 -167 17.4829 0.0159
NP_442140.1_3 Reverse -225 -235 9.91146 0.0958
NP_442140.1_3 Forward -165 -155 9.7148 0.103
NP_442140.1_3 Reverse -170 -180 8.33817 0.119
NP_442140.1_3 Reverse -158 -168 4.20827 0.254
NP_440875.1_9 Forward -176 -166 17.619 0.0104
NP_440875.1_9 Reverse -159 -169 12.8495 0.0972
NP_440875.1_9 Forward -332 -322 8.95605 0.233
NP_440875.1_9 Forward -283 -273 8.5667 0.233
NP_442547.1_7 Reverse -159 -178 10.9037 0.269
NP_442547.1_9 Reverse -296 -314 19.1012 0.174
NP_441813.1_5 Forward -180 -170 17.188 0.00979
NP_441813.1_5 Reverse -167 -177 10.0098 0.0208
NP_441813.1_5 Reverse -222 -232 5.19158 0.142
NP_441813.1_5 Reverse -144 -154 2.14332 0.199
NP_440594.1_8 Forward -148 -135 8.86849 0.21
NP_441259.1_3 Reverse -264 -283 6.19431 0.268
NP_440590.1_4 Forward -177 -164 21.7504 0.00377
NP_440590.1_4 Forward -232 -219 11.3273 0.0209
NP_440590.1_4 Reverse -170 -183 3.5592 0.0719
NP_440567.1_1 Forward -177 -163 17.4042 0.0153
NP_440567.1_1 Reverse -170 -184 1.67122 0.196
NP_440567.1_1 Reverse -147 -161 1.47456 0.204
NP_442497.1_10 Forward -177 -168 10.4228 0.0087
NP_442497.1_10 Reverse -170 -179 10.4228 0.0087
NP_442497.1_10 Reverse -147 -156 0.196389 0.208
NP_440821.1_4 Forward -180 -170 19.0562 0.00399
NP_440821.1_4 Reverse -167 -177 18.7612 0.00422
NP_440821.1_4 Forward -151 -141 3.02829 0.131
NP_440821.1_4 Forward -157 -147 0.275027 0.19
NP_440821.1_4 Forward -235 -225 -0.511621 0.269
NP_441239.1_9 Reverse -167 -179 18.6235 0.0114
NP_441239.1_9 Forward -180 -168 15.8703 0.0178
NP_441239.1_9 Reverse -335 -347 8.9871 0.117
NP_441239.1_9 Forward -317 -305 5.93884 0.202
NP_441239.1_9 Forward -235 -223 4.26721 0.256
NP_441239.1_9 Reverse -222 -234 3.97222 0.269
NP_441239.1_9 Reverse -155 -167 3.18557 0.292
NP_441951.1_3 Forward -224 -205 14.5524 0.286
NP_441951.1_4 Reverse -169 -188 0.58944 0.297
NP_441951.1_9 Reverse -329 -348 5.01433 0.254
NP_441892.1_1 Reverse -160 -177 3.67709 0.121
NP_440665.1_1 Reverse -151 -170 -14.6519 0.262
NP_442193.1_1 Forward -172 -154 8.37728 0.272
NP_441017.1_6 Reverse -220 -234 12.0937 0.227
NP_441017.1_6 Reverse -142 -156 12.0937 0.227
NP_440354.1_7 Reverse -163 -181 8.27895 0.249
NP_442138.1_1 Reverse -353 -372 0.0970122 0.298
NP_440546.1_4 Forward -178 -168 11.8882 0.0679
NP_440546.1_4 Reverse -169 -179 11.8882 0.0679
NP_442041.1_5 Forward -177 -158 3.6377 0.244
NP_441230.1_5 Reverse -164 -183 3.83436 0.191
NP_440462.1_4 Reverse -324 -338 9.83269 0.242
NP_440462.1_6 Reverse -167 -177 17.9746 0.00578
NP_440462.1_6 Forward -180 -170 15.418 0.0142
NP_442611.1_1 Forward -240 -221 -3.04881 0.297
NP_440868.1_4 Forward -182 -170 18.0335 0.0124
NP_440868.1_4 Reverse -165 -177 2.98891 0.142
NP_442499.1_3 Reverse -330 -348 4.05072 0.289
NP_441879.1_3 Reverse -170 -189 13.1758 0.0606
NP_441582.1_5 Reverse -167 -186 4.91521 0.216
NP_442402.1_10 Forward -191 -181 11.4843 0.251
NP_442258.1_3 Reverse -362 -381 6.09597 0.131
NP_440696.1_3 Reverse -169 -187 1.39578 0.217
NP_440696.1_3 Forward -237 -219 -3.42244 0.287
NP_442039.1_4 Forward -177 -170 15.1821 0.0124
NP_442039.1_4 Reverse -170 -177 15.1821 0.0124
NP_442039.1_4 Reverse -141 -148 10.8555 0.109
NP_442039.1_4 Forward -154 -147 7.80726 0.24
NP_441811.1_1 Reverse -147 -166 10.2259 0.26
NP_441811.1_1 Forward -344 -325 4.42435 0.285
NP_441811.1_4 Forward -180 -161 6.78429 0.178
NP_441811.1_8 Reverse -134 -148 5.80112 0.289
NP_442409.1_10 Reverse -105 -119 16.0269 0.266
NP_442837.1_3 Forward -177 -170 15.7721 0.0124
NP_442837.1_3 Reverse -170 -177 15.7721 0.0124
NP_442053.1_1 Forward -178 -169 18.3876 0.0007
NP_442053.1_1 Reverse -169 -178 18.3876 0.0007
NP_442053.1_1 Reverse -306 -315 4.22796 0.261
NP_440505.1_3 Reverse -167 -177 14.1397 0.0235
NP_440505.1_3 Forward -180 -170 13.8447 0.0247
NP_441701.1_3 Forward -164 -147 7.217 0.265
NP_440013.1_2 Reverse -162 -176 14.6509 0.235
NP_442532.1_7 Forward -178 -164 8.45605 0.171
NP_440914.1_1 Forward -178 -168 8.6151 0.186
NP_440914.1_1 Reverse -169 -179 8.6151 0.186
NP_441011.1_8 Forward -177 -168 16.9127 0.00602
NP_441011.1_8 Reverse -170 -179 16.9127 0.00602
NP_442533.1_1 Forward -275 -256 -15.4385 0.254
NP_442533.1_6 Forward -178 -169 17.2076 0.00137
NP_442533.1_6 Reverse -169 -178 17.2076 0.00137
NP_442533.1_6 Reverse -224 -233 5.21127 0.15
NP_442533.1_6 Reverse -337 -346 4.62128 0.179
NP_442533.1_6 Forward -315 -306 4.22796 0.186
NP_442533.1_6 Forward -346 -337 4.0313 0.194
NP_442533.1_6 Reverse -205 -214 3.83464 0.202
NP_442533.1_6 Forward -340 -331 2.94966 0.232
NP_442533.1_6 Forward -308 -299 1.37636 0.3
NP_442541.1_10 Reverse -223 -237 3.73557 0.252
NP_442232.1_3 Forward -241 -222 -5.9004 0.172
NP_442232.1_3 Reverse -161 -180 -11.8986 0.282
NP_442322.1_4 Forward -311 -294 -8.02495 0.286
NP_442322.1_4 Reverse -108 -125 -9.30325 0.29
NP_443016.1_1 Forward -266 -247 -5.70374 0.251
NP_441219.1_2 Reverse -320 -339 11.9958 0.232
NP_441482.1_7 Reverse -218 -232 -4.4253 0.149
NP_441482.1_7 Reverse -163 -177 -8.26021 0.193
NP_441482.1_7 Forward -184 -170 -8.94853 0.193
NP_441482.1_7 Reverse -140 -154 -11.0135 0.229
NP_439944.1_9 Forward -177 -167 10.4031 0.0887
NP_439944.1_9 Reverse -170 -180 10.3048 0.0887
NP_441028.1_6 Reverse -105 -115 3.71617 0.281
NP_442202.1_4 Reverse -167 -181 18.5558 0.104
NP_440116.1_8 Forward -232 -213 -5.60541 0.194
NP_440116.1_8 Forward -177 -158 -10.1286 0.299
NP_440007.1_9 Forward -137 -123 8.55439 0.175
NP_439965.1_1 Forward -187 -168 0.294447 0.146
NP_441680.1_4 Reverse -155 -174 -0.590531 0.255
NP_443045.1_9 Forward -316 -298 12.6047 0.207
NP_441602.1_3 Reverse -164 -183 0.982764 0.217
NP_441602.1_3 Forward -183 -164 0.196116 0.219
NP_441602.1_3 Reverse -206 -225 -2.55715 0.233
NP_441170.1_4 Reverse -328 -346 7.68896 0.194
NP_441972.1_5 Forward -177 -158 -1.86883 0.178
NP_441106.1_1 Reverse -168 -177 18.191 0.0028
NP_441106.1_1 Forward -179 -170 18.191 0.0028
NP_440429.1_9 Forward -286 -267 2.16274 0.278
NP_442306.1_10 Forward -183 -164 -18.7818 0.197
NP_441286.1_1 Forward -179 -167 5.25052 0.0259
NP_441286.1_1 Reverse -168 -180 4.95553 0.027
NP_441286.1_1 Reverse -145 -157 3.2839 0.048
NP_441286.1_1 Reverse -223 -235 -4.58258 0.165
NP_440670.1_6 Forward -316 -297 11.8975 0.295
NP_440670.1_8 Forward -178 -169 18.3876 0.000699
NP_440670.1_8 Reverse -169 -178 18.3876 0.000699
NP_440670.1_8 Reverse -146 -155 9.34117 0.0581
NP_440670.1_8 Forward -155 -146 6.29291 0.124
NP_440670.1_8 Forward -233 -224 5.3096 0.167
NP_440670.1_8 Reverse -224 -233 3.93297 0.212
NP_440886.1_7 Forward -179 -169 17.7774 0.0011
NP_440886.1_7 Reverse -168 -178 17.7774 0.0011
NP_440886.1_7 Forward -338 -328 10.6976 0.0805
NP_440886.1_7 Forward -215 -205 4.7978 0.218
NP_440886.1_7 Forward -309 -299 4.60114 0.227
NP_440886.1_7 Reverse -109 -119 3.71617 0.267
NP_440886.1_7 Forward -286 -276 3.61784 0.272
NP_442614.1_2 Reverse -224 -238 10.4227 0.234
NP_442614.1_2 Forward -340 -326 6.29277 0.291
NP_442072.1_9 Forward -179 -161 5.23069 0.0167
NP_442072.1_9 Reverse -168 -186 -23.2853 0.288
NP_442213.1_5 Reverse -288 -307 10.2259 0.127
NP_442213.1_6 Reverse -317 -336 11.9958 0.246
NP_440907.2_8 Forward -177 -167 17.4824 0.00685
NP_440907.2_8 Reverse -147 -157 8.43603 0.117
NP_440907.2_8 Reverse -170 -180 7.84605 0.117
NP_440907.2_8 Reverse -225 -235 6.17443 0.178
NP_440907.2_8 Forward -314 -304 3.91283 0.289
NP_440907.2_8 Forward -148 -138 3.8145 0.297
NP_442264.1_2 Forward -176 -159 10.6586 0.187
NP_441021.1_1 Forward -177 -158 4.916 0.0751
NP_441021.1_1 Forward -315 -296 -11.1119 0.257
NP_441021.1_8 Reverse -164 -182 13.2938 0.0938
NP_441021.1_8 Forward -183 -165 8.96727 0.165
NP_441463.1_3 Reverse -159 -178 8.45592 0.0487
NP_441626.1_2 Forward -177 -170 15.7721 0.0124
NP_441626.1_2 Reverse -170 -177 15.7721 0.0124
NP_442365.1_7 Reverse -220 -239 0.687771 0.177
NP_442794.1_1 Reverse -220 -232 5.84051 0.203
NP_442794.1_1 Forward -137 -125 3.77555 0.286
NP_442615.1_1 Reverse -160 -178 6.31233 0.0355
NP_442615.1_1 Forward -187 -169 -5.29072 0.209
NP_441962.1_4 Forward -177 -158 -7.4737 0.189
NP_441962.1_4 Forward -348 -329 -11.6036 0.243
NP_441962.1_4 Reverse -164 -183 -14.1602 0.284
NP_440387.1_1 Forward -178 -162 8.41667 0.0282
NP_440387.1_1 Reverse -169 -185 -3.28472 0.157
NP_440387.1_1 Reverse -46 -62 -5.64466 0.243
NP_440855.1_1 Reverse -193 -212 -1.37718 0.281
NP_440855.1_5 Forward -180 -161 4.62021 0.285
NP_441431.1_2 Reverse -166 -180 9.43874 0.186
NP_441431.1_2 Forward -181 -167 8.25877 0.221
NP_441836.1_2 Forward -239 -220 -4.6221 0.261
NP_440634.1_10 Forward -301 -282 5.11187 0.28
NP_441993.1_1 Forward -178 -159 3.89583 0.227
NP_441174.1_2 Forward -181 -167 17.6992 0.0437
NP_440814.1_4 Reverse -160 -179 -12.3902 0.23
NP_440467.1_3 Forward -177 -158 10.7679 0.296
NP_440114.1_10 Reverse -169 -183 14.1593 0.0429
NP_440114.1_10 Forward -178 -164 8.75105 0.195
NP_440114.1_10 Forward -149 -135 5.60446 0.3
NP_442437.1_8 Reverse -158 -177 14.1591 0.133
NP_441510.2_7 Forward -184 -170 9.93039 0.281
NP_440287.1_5 Reverse -103 -122 10.9134 0.286
NP_441272.1_4 Reverse -160 -179 2.65439 0.233
NP_440293.1_3 Reverse -293 -312 -0.885524 0.238
NP_440766.1_4 Reverse -165 -179 17.9942 0.0255
NP_440766.1_4 Forward -182 -168 8.06273 0.0871
NP_441979.1_5 Reverse -163 -182 -11.5053 0.228
NP_441979.1_5 Forward -184 -165 -12.4886 0.228
NP_442743.1_4 Reverse -170 -189 -6.58872 0.279
NP_439910.1_2 Forward -186 -169 -13.4325 0.162
NP_439910.1_2 Reverse -161 -178 -21.2006 0.183
NP_442867.1_8 Forward -170 -151 3.73603 0.297
NP_440457.1_1 Forward -237 -225 16.4603 0.0486
NP_440457.1_1 Forward -159 -147 10.4621 0.092
NP_440457.1_1 Reverse -165 -177 5.34885 0.141
NP_440457.1_1 Reverse -302 -314 2.20226 0.216
NP_440457.1_1 Forward -182 -170 1.90727 0.223
NP_440798.1_6 Reverse -170 -183 14.5723 0.0423
NP_440798.1_6 Reverse -225 -238 10.7374 0.074
NP_441984.1_1 Reverse -163 -181 18.3087 0.143
NP_441984.1_2 Reverse -162 -181 7.86593 0.263
NP_441984.1_3 Forward -182 -164 7.78729 0.239
NP_441436.1_2 Forward -275 -256 -1.86883 0.28
NP_442509.1_9 Forward -178 -168 16.2041 0.00739
NP_442509.1_9 Reverse -169 -179 16.2041 0.00739
NP_440554.1_4 Reverse -170 -180 14.6313 0.02
NP_440554.1_4 Forward -177 -167 13.943 0.0218
NP_440554.1_4 Reverse -225 -235 1.65166 0.293
NP_441845.1_6 Reverse -157 -175 0.0191479 0.274
NP_441885.1_5 Forward -178 -168 11.4848 0.00668
NP_441885.1_5 Reverse -169 -179 11.4848 0.00668
NP_441885.1_5 Forward -155 -145 -0.216628 0.189
NP_441885.1_5 Forward -233 -223 -0.904945 0.241
NP_440478.1_9 Forward -372 -353 17.8957 0.151
NP_440649.2_8 Reverse -302 -316 13.0776 0.232
NP_441428.1_8 Reverse -161 -180 5.80098 0.226
NP_442341.1_7 Forward -179 -165 22.0257 0.00401
NP_442341.1_7 Reverse -168 -182 9.63603 0.0726
NP_442341.1_7 Forward -215 -201 8.06273 0.0947
NP_442341.1_9 Reverse -160 -174 6.78381 0.215
NP_442395.2_4 Forward -179 -160 10.3234 0.101
NP_440409.1_1 Forward -186 -167 8.16093 0.158
NP_443000.1_7 Forward -180 -170 8.73149 0.0437
NP_443000.1_7 Reverse -167 -177 2.04498 0.226
NP_440507.2_3 Reverse -160 -179 13.175 0.145
NP_441842.1_10 Reverse -162 -176 11.8976 0.115
NP_441842.1_10 Forward -240 -226 10.1277 0.171
NP_440275.1_3 Reverse -167 -177 17.9746 0.0082
NP_440275.1_3 Forward -180 -170 8.4365 0.0602
NP_440275.1_3 Forward -235 -225 7.35486 0.0755
NP_440275.1_3 Forward -157 -147 7.25653 0.0823
NP_442932.1_10 Reverse -317 -336 11.0125 0.123
NP_440091.1_1 Forward -182 -170 15.8703 0.0161
NP_440091.1_1 Reverse -165 -177 12.6253 0.0353
NP_442275.1_1 Forward -269 -250 6.98095 0.253
NP_440679.1_10 Forward -143 -124 -20.2567 0.283
NP_441359.1_5 Forward -181 -162 25.4672 0.00759
NP_442451.1_2 Forward -186 -167 9.63589 0.0755
NP_442451.1_2 Reverse -138 -157 -0.000545616 0.153
NP_439962.1_4 Forward -315 -296 9.93088 0.134
NP_439962.1_4 Forward -312 -293 -5.50708 0.28
NP_439962.1_4 Forward -171 -152 -5.60541 0.28
NP_439962.1_4 Reverse -107 -126 -7.08038 0.287
NP_439962.1_4 Forward -342 -323 -7.96535 0.292
NP_439962.1_4 Forward -186 -167 -7.96535 0.292
NP_439962.1_6 Reverse -292 -310 6.80398 0.292
NP_440641.1_8 Reverse -236 -255 16.0274 0.178
NP_442495.1_3 Reverse -326 -344 15.2604 0.242
NP_442495.1_5 Forward -345 -326 23.6972 0.0127
NP_442495.1_5 Forward -177 -158 5.30933 0.291
NP_440149.1_8 Reverse -169 -188 20.059 0.00856
NP_440149.1_8 Forward -155 -136 -4.6221 0.211
NP_440149.1_8 Forward -220 -201 -6.88371 0.265
NP_441105.1_3 Reverse -158 -177 15.5357 0.0173
NP_441105.1_3 Reverse -326 -345 -9.83364 0.297
NP_441105.1_3 Reverse -213 -232 -9.93197 0.298
NP_440216.1_1 Reverse -169 -183 16.4209 0.00307
NP_440216.1_1 Forward -178 -164 -1.5737 0.034
NP_440216.1_1 Reverse -224 -238 -4.13031 0.1
NP_440216.1_6 Reverse -162 -178 5.76173 0.189
NP_440216.1_9 Forward -16 -7 14.0611 0.184
NP_440172.1_1 Forward -178 -168 8.73149 0.0586
NP_440172.1_1 Reverse -169 -179 8.73149 0.0586
NP_440172.1_1 Forward -196 -186 2.24165 0.279
NP_442290.1_3 Reverse -326 -345 13.8641 0.237
NP_442015.1_10 Forward -182 -169 9.85238 0.0433
NP_442015.1_10 Reverse -142 -155 9.36073 0.0503
NP_442015.1_10 Reverse -165 -178 3.95252 0.178
NP_441226.1_7 Forward -177 -170 14.4934 0.0123
NP_441226.1_7 Reverse -170 -177 14.4934 0.0123
NP_441226.1_7 Reverse -225 -232 11.2485 0.0971
NP_440198.1_3 Forward -320 -301 13.8633 0.277
NP_441111.1_7 Forward -177 -169 18.7023 0.00294
NP_441111.1_7 Reverse -170 -178 18.7023 0.00294
NP_441766.1_2 Forward -178 -169 17.5026 0.00297
NP_441766.1_2 Reverse -169 -178 17.5026 0.00297
NP_441766.1_2 Reverse -146 -155 8.84951 0.0484
NP_440416.1_9 Reverse -162 -181 -4.13045 0.0767
NP_440416.1_9 Forward -173 -154 -5.21209 0.0791
NP_440416.1_9 Forward -315 -296 -10.227 0.14
NP_440416.1_9 Reverse -108 -127 -17.3068 0.237
NP_443052.1_8 Forward -188 -169 -8.45701 0.175
NP_443052.1_9 Reverse -268 -287 3.73603 0.161
NP_443052.1_9 Forward -286 -267 -5.31042 0.266
NP_443052.1_9 Forward -338 -319 -6.49039 0.283
NP_443052.1_9 Reverse -152 -171 -6.68705 0.287
NP_443052.1_9 Forward -312 -293 -6.88371 0.289
NP_442403.1_8 Reverse -120 -139 3.44104 0.226
NP_440591.1_9 Reverse -162 -180 14.1788 0.0893
NP_440591.1_9 Forward -156 -138 9.45892 0.151
NP_442154.1_1 Forward -165 -147 -7.06068 0.141
NP_442154.1_1 Reverse -296 -314 -7.45401 0.142
NP_442154.1_1 Reverse -326 -344 -10.1089 0.199
NP_442154.1_6 Reverse -324 -343 8.75091 0.205
NP_442154.1_6 Reverse -162 -181 2.55606 0.234
NP_442564.1_10 Reverse -231 -245 13.7659 0.244
NP_440261.1_5 Reverse -170 -183 -2.73398 0.0924
NP_440261.1_5 Forward -177 -164 -10.5021 0.201
NP_440988.1_10 Forward -174 -160 6.35102 0.232
NP_440988.1_10 Reverse -161 -175 6.2542 0.232
NP_440988.1_10 Reverse -128 -142 4.7052 0.253
NP_440988.1_10 Reverse -222 -236 3.25301 0.298
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCACTCCCTGTAAGGTTTTAGTCTGCACCGGCACACCGATGACTGGTAAAGGGGTCAGGGCCGCCACCATGCCCGGTAAATGGGCCGCTCCCCCAGCCCCGGCAATAATTATCCGCAAGCCCCGCTGGTGGGCAGTTTGGGCATACTCCACCATTCTTTCCGGGGTGCGATGGGCAGAGATAATGGCCACCTCCGTTGGTACGGCAAATTCTTCACAGACGGCGATCGCCGCTGCCATGGTGGGGAGATCGGAATCGCTTCCCATGATGATGCCGACCAGGGGAGAGGGGGAAGTCATAAATTAAATTGAGATGACGAAGATGGAGGTTTGACTTTAAACTGAGGCTAACCGCTAATAGCGTATCGGAAAATCTTCAAGATCCCAAGGAAAGATTTTT

CDS

ATGTCAGTGAACAGCATCCATTTGGTGGGAAGGGCCGGCCGTGACCCTGAAGTTAAATATTTTGAGTCCGGTAATGTAGTTTGTAACTTCACCCTGGCGGTGAATCGACGCACAAGCAAAAAGGATGAACCCCCCGATTGGTTTGACCTGGAAATTTGGGGTAAAACTGCTGAAATAGCCGGTAACTACGTCAAAAAAGGCAGTTTGATTGGTATCCAAGGATCGTTAAAGTTTGACCATTGGGAAGACCGGAACTCCGGTACTCCTCGTTCCAAGCCAGTGATCCGGGTCAATAATTTGGATTTACTCGGCTCTAAGCGGGACAACGCCGAAGCCACCATGAATAATTACCCCGAAGAGTTCTAA

Protein

MSVNSIHLVGRAGRDPEVKYFESGNVVCNFTLAVNRRTSKKDEPPDWFDLEIWGKTAEIAGNYVKKGSLIGIQGSLKFDHWEDRNSGTPRSKPVIRVNNLDLLGSKRDNAEATMNNYPEEF