Your browser is old and dusty. Try Google Chrome!

Details for slr0922

ORF slr0922
Accession NP_442403.1
Symbol pth
Category Aminoacyl tRNA synthetases and tRNA modification
Definition peptidyl-tRNA hydrolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442761.1_9 Reverse -262 -281 11.6025 0.295
NP_441623.1_1 Forward -378 -360 -1.16082 0.24
NP_441623.1_1 Reverse -371 -389 -2.63579 0.241
NP_441818.1_9 Reverse -57 -76 -2.95047 0.213
NP_441818.1_9 Reverse -63 -82 -9.83364 0.291
NP_441642.1_8 Reverse -352 -371 13.7658 0.272
NP_440996.1_3 Reverse -246 -264 10.5406 0.247
NP_442655.1_2 Forward -308 -289 7.47261 0.152
NP_441250.1_3 Forward -371 -352 12.4875 0.183
NP_441054.1_2 Reverse -243 -262 11.8975 0.254
NP_441043.1_3 Reverse -174 -193 15.9291 0.254
NP_441802.1_1 Reverse -257 -276 13.3725 0.175
NP_440304.1_4 Forward -82 -72 4.79825 0.246
NP_442268.1_9 Reverse -54 -73 15.2408 0.207
NP_441035.1_3 Forward -391 -372 1.86774 0.227
NP_439918.1_2 Reverse -57 -76 -3.83545 0.262
NP_441200.1_4 Reverse -255 -274 13.5691 0.156
NP_441208.1_9 Forward -129 -115 5.60446 0.267
NP_441083.1_5 Forward -255 -245 0.865012 0.218
NP_441713.1_8 Reverse -343 -361 11.3272 0.244
NP_441713.1_8 Reverse -32 -50 10.4422 0.26
NP_441327.1_1 Reverse -191 -210 2.67563 0.287
NP_442111.1_3 Forward -374 -361 14.0991 0.244
NP_442111.1_4 Reverse -22 -36 9.04604 0.0655
NP_441624.1_7 Forward -72 -58 9.73436 0.217
NP_440747.1_1 Forward -154 -136 11.1305 0.231
NP_441854.1_10 Forward -386 -367 3.83436 0.282
NP_442973.1_5 Reverse -27 -46 15.9291 0.109
NP_442634.1_4 Reverse -34 -48 -4.52363 0.206
NP_442634.1_4 Forward -347 -333 -5.01529 0.228
NP_440403.1_10 Forward -41 -22 5.70265 0.241
NP_440403.1_10 Reverse -244 -263 4.22769 0.266
NP_442848.1_5 Forward -263 -245 4.73903 0.276
NP_443018.1_3 Forward -359 -352 8.49558 0.141
NP_441634.1_9 Reverse -233 -252 10.3234 0.254
NP_440376.1_1 Reverse -35 -44 -0.786921 0.293
NP_441422.1_7 Forward -58 -41 -2.51776 0.215
NP_440667.1_2 Forward -296 -277 -7.67036 0.283
NP_441763.1_10 Reverse -106 -125 9.7334 0.18
NP_442658.1_1 Reverse -34 -44 8.14104 0.199
NP_442782.1_2 Reverse -260 -274 8.45605 0.198
NP_442782.1_2 Reverse -358 -372 4.62115 0.251
NP_442782.1_2 Reverse -36 -50 0.589577 0.288
NP_441256.1_8 Forward -214 -195 1.47442 0.298
NP_442321.1_1 Reverse -361 -380 -8.85033 0.296
NP_441317.1_4 Reverse -303 -317 9.75043 0.29
NP_441127.1_1 Forward -80 -66 8.65272 0.288
NP_440318.1_1 Forward -366 -347 6.88262 0.218
NP_440203.1_5 Reverse -338 -348 10.796 0.213
NP_439905.1_1 Forward -65 -52 7.09911 0.268
NP_443055.1_6 Forward -80 -62 -2.63651 0.298
NP_440138.1_6 Forward -190 -171 7.86512 0.201
NP_441913.1_3 Reverse -193 -206 16.0089 0.218
NP_441041.1_4 Reverse -51 -70 -5.11376 0.148
NP_442004.1_6 Reverse -335 -349 1.96621 0.276
NP_440289.1_2 Reverse -210 -223 -3.4223 0.267
NP_440983.1_5 Forward -268 -249 -5.60541 0.268
NP_440260.1_8 Forward -128 -110 -6.07737 0.285
NP_441514.1_6 Forward -346 -339 12.8221 0.252
NP_441678.1_9 Reverse -260 -279 -1.86883 0.257
NP_442281.1_1 Forward -71 -57 9.53707 0.0685
NP_442281.1_1 Forward -392 -378 3.63724 0.224
NP_442575.1_9 Reverse -28 -47 11.8975 0.276
NP_440395.1_8 Forward -109 -90 23.1438 0.00857
NP_442982.1_5 Forward -76 -57 3.14605 0.212
NP_442068.1_2 Forward -184 -165 7.96426 0.3
NP_442933.1_1 Forward -211 -192 6.54077 0.266
NP_440919.1_1 Reverse -373 -392 -1.96717 0.221
NP_443009.1_5 Forward -345 -334 8.71129 0.102
NP_443009.1_5 Reverse -334 -345 5.76138 0.189
NP_442301.1_10 Reverse -189 -208 18.6823 0.167
NP_440730.1_10 Forward -114 -95 29.9895 0.000114
NP_440183.1_9 Forward -358 -339 -20.8467 0.292
NP_441198.1_8 Forward -346 -336 10.4392 0.271
NP_441015.1_10 Reverse -52 -71 -3.44213 0.189
NP_442253.1_5 Reverse -375 -392 -7.04099 0.298
NP_442719.1_2 Forward -207 -189 6.60656 0.135
NP_441251.1_8 Forward -396 -383 15.7225 0.254
NP_440789.1_8 Forward -82 -63 13.4708 0.28
NP_442692.1_10 Forward -367 -354 18.3499 0.175
NP_442692.1_10 Reverse -364 -377 18.1571 0.175
NP_442542.1_2 Reverse -370 -383 12.409 0.114
NP_440342.1_3 Forward -126 -107 14.3558 0.265
NP_441114.1_3 Forward -386 -377 7.37455 0.239
NP_440558.1_2 Reverse -68 -87 -3.83545 0.239
NP_440274.1_4 Forward -149 -131 12.4089 0.157
NP_441878.1_6 Reverse -70 -80 -7.59145 0.245
NP_441878.1_6 Reverse -35 -45 -7.88644 0.278
NP_442066.2_9 Forward -281 -268 9.06573 0.181
NP_441739.1_2 Forward -198 -182 12.1525 0.135
NP_442192.1_5 Forward -321 -302 8.45592 0.265
NP_441574.1_1 Forward -372 -353 -7.67036 0.293
NP_441549.1_9 Reverse -67 -85 -7.94566 0.216
NP_441037.1_4 Forward -82 -72 8.97447 0.237
NP_440151.1_2 Forward -113 -95 16.3413 0.222
NP_442590.1_10 Reverse -51 -70 9.24257 0.2
NP_442998.1_5 Forward -374 -364 14.3364 0.149
NP_442998.1_5 Forward -373 -363 11.3864 0.187
NP_440299.1_1 Forward -172 -159 8.18017 0.0964
NP_441559.1_8 Forward -273 -259 -6.49025 0.279
NP_440717.1_3 Forward -149 -135 8.94708 0.25
NP_440319.1_5 Reverse -91 -110 17.5998 0.265
NP_442452.1_2 Forward -191 -172 10.2251 0.212
NP_442866.1_1 Reverse -52 -71 -0.39387 0.193
NP_441464.1_10 Forward -301 -287 9.63603 0.262
NP_440677.1_6 Forward -354 -335 13.9625 0.167
NP_441750.1_1 Reverse -42 -61 -9.047 0.3
NP_441750.1_7 Forward -299 -289 13.4514 0.262
NP_441340.1_9 Forward -311 -301 8.25522 0.256
NP_440211.1_2 Forward -193 -174 21.5331 0.145
NP_440586.1_1 Reverse -53 -72 -6.39206 0.299
NP_440027.1_3 Forward -360 -342 5.62325 0.239
NP_440027.1_3 Forward -388 -370 3.65664 0.267
NP_440027.1_8 Reverse -32 -51 5.80018 0.279
NP_443051.1_5 Forward -317 -298 5.30933 0.256
NP_439937.1_9 Reverse -188 -205 -13.6298 0.287
NP_442294.1_3 Forward -212 -198 12.5853 0.282
NP_441657.1_5 Reverse -331 -350 1.96607 0.172
NP_442374.1_3 Forward -128 -111 12.6252 0.269
NP_441803.1_2 Forward -145 -126 3.6377 0.191
NP_439977.1_5 Reverse -307 -326 0.58944 0.207
NP_440948.1_4 Forward -58 -39 12.9791 0.175
NP_441877.1_5 Reverse -360 -379 7.07928 0.195
NP_442262.1_10 Forward -359 -352 8.59391 0.22
NP_441814.1_5 Reverse -40 -59 12.1925 0.18
NP_440531.1_6 Reverse -343 -362 0.786102 0.187
NP_440297.1_9 Forward -113 -103 -0.314959 0.282
NP_440350.1_2 Reverse -136 -155 13.1758 0.154
NP_442129.1_6 Reverse -87 -106 15.8856 0.246
NP_440999.1_9 Forward -360 -346 1.27789 0.168
NP_440999.1_9 Forward -292 -278 -0.983719 0.223
NP_440888.1_2 Forward -126 -112 10.422 0.0946
NP_442337.1_6 Reverse -62 -81 15.1061 0.233
NP_442337.1_8 Reverse -340 -359 15.3391 0.0923
NP_441621.1_7 Reverse -69 -83 0.196253 0.154
NP_440519.1_8 Reverse -247 -263 1.5335 0.282
NP_442204.1_6 Reverse -48 -67 4.916 0.286
NP_442859.1_2 Forward -118 -99 2.16274 0.28
NP_442120.1_10 Reverse -357 -376 -12.5869 0.273
NP_440778.1_3 Reverse -178 -197 23.0089 0.0183
NP_441052.1_2 Forward -360 -350 4.50326 0.157
NP_441884.1_9 Forward -390 -371 -22.8133 0.284
NP_441719.1_6 Forward -264 -245 5.99684 0.288
NP_441004.1_1 Reverse -42 -61 -17.0118 0.288
NP_441851.1_10 Forward -345 -335 4.10993 0.287
NP_442208.1_5 Reverse -245 -264 -6.58872 0.266
NP_442814.1_5 Reverse -135 -154 15.4366 0.196
NP_442622.1_1 Reverse -243 -262 -12.2919 0.262
NP_441273.1_8 Reverse -129 -148 -2.75381 0.296
NP_442515.1_1 Forward -81 -67 -3.44199 0.29
NP_441982.1_6 Reverse -356 -365 10.3845 0.297
NP_442689.1_8 Forward -206 -189 -1.82945 0.225
NP_442843.1_1 Reverse -352 -371 -10.1286 0.276
NP_442843.1_1 Forward -377 -358 -11.4069 0.291
NP_442450.1_3 Forward -318 -300 15.4563 0.118
NP_440078.1_10 Reverse -179 -198 5.99764 0.224
NP_442348.1_2 Reverse -143 -152 7.57121 0.28
NP_442348.1_2 Reverse -378 -387 7.17789 0.285
NP_442443.1_1 Reverse -174 -193 -5.01543 0.28
NP_441432.1_8 Reverse -350 -359 5.21127 0.185
NP_441432.1_8 Forward -81 -72 3.24465 0.252
NP_441732.1_2 Forward -70 -54 -16.9527 0.223
NP_441990.1_2 Reverse -359 -378 7.17762 0.119
NP_439956.1_7 Reverse -242 -261 7.17762 0.257
NP_439956.1_7 Reverse -51 -70 4.81767 0.257
NP_442346.1_5 Forward -81 -71 6.66654 0.195
NP_442346.1_6 Reverse -279 -298 15.1424 0.204
NP_440352.1_5 Reverse -349 -368 10.125 0.278
NP_440545.1_3 Forward -84 -67 4.56207 0.0691
NP_440545.1_5 Forward -304 -287 4.95539 0.244
NP_441126.1_6 Reverse -355 -369 14.231 0.267
NP_440847.1_8 Reverse -363 -382 19.9606 0.129
NP_441585.1_5 Forward -379 -360 12.7816 0.211
NP_441585.1_5 Forward -263 -244 -1.47628 0.298
NP_441895.1_2 Forward -99 -80 -26.8449 0.256
NP_441239.1_9 Forward -116 -104 8.88877 0.12
NP_440156.1_4 Reverse -362 -372 13.9425 0.176
NP_442193.1_1 Reverse -57 -75 18.702 0.113
NP_441017.1_8 Reverse -375 -390 15.5162 0.174
NP_441874.1_1 Forward -303 -289 8.65272 0.298
NP_443012.1_7 Forward -280 -261 10.7175 0.277
NP_442216.1_4 Forward -267 -259 8.27883 0.255
NP_442216.1_4 Reverse -337 -345 8.1805 0.255
NP_442809.1_3 Reverse -94 -113 19.4681 0.156
NP_442041.1_5 Reverse -358 -377 -0.197208 0.266
NP_440675.1_10 Reverse -365 -384 11.4058 0.268
NP_442340.1_3 Forward -358 -339 -7.96535 0.241
NP_442611.1_3 Reverse -52 -70 15.4571 0.159
NP_442592.1_2 Reverse -143 -162 6.4893 0.227
NP_441497.1_3 Forward -379 -360 -9.63698 0.294
NP_440532.1_6 Reverse -149 -168 8.55425 0.286
NP_442479.1_9 Reverse -361 -380 -0.983855 0.21
NP_442479.1_9 Forward -209 -190 -14.0619 0.294
NP_442402.1_4 Reverse -328 -347 -5.1145 0.236
NP_442402.1_4 Forward -276 -257 -7.47443 0.276
NP_441848.1_4 Reverse -191 -207 10.0335 0.265
NP_441848.1_4 Forward -317 -301 8.50558 0.288
NP_441848.1_7 Forward -370 -351 4.71854 0.215
NP_441084.1_6 Forward -230 -216 9.73195 0.269
NP_442882.1_6 Forward -68 -51 17.0493 0.0787
NP_442039.1_7 Reverse -353 -363 13.5497 0.211
NP_441811.1_4 Forward -85 -66 5.89931 0.196
NP_442625.1_3 Reverse -268 -287 13.4708 0.194
NP_442679.1_1 Forward -237 -218 -3.04881 0.248
NP_440160.1_2 Forward -51 -32 -3.3438 0.259
NP_440160.1_9 Forward -87 -68 11.9958 0.216
NP_442360.1_5 Reverse -254 -264 16.1063 0.161
NP_441252.1_6 Reverse -257 -264 11.6422 0.288
NP_440263.1_5 Forward -205 -191 9.5377 0.294
NP_442232.1_4 Reverse -234 -253 11.3075 0.26
NP_441482.1_7 Forward -350 -336 -10.1285 0.209
NP_440816.1_2 Forward -399 -380 13.115 0.157
NP_441028.1_6 Forward -365 -355 9.71433 0.21
NP_441028.1_6 Reverse -229 -239 5.87944 0.236
NP_441028.1_6 Reverse -366 -376 5.78111 0.243
NP_442202.1_10 Reverse -70 -84 3.24451 0.278
NP_441106.1_1 Forward -81 -72 2.75299 0.261
NP_439903.1_6 Forward -48 -29 -0.29631 0.28
NP_442588.1_1 Reverse -338 -357 12.7825 0.145
NP_442588.1_6 Reverse -54 -73 -1.37718 0.268
NP_442928.1_3 Reverse -275 -294 11.357 0.293
NP_442072.1_9 Reverse -70 -88 -23.187 0.284
NP_442072.1_9 Forward -127 -109 -23.482 0.297
NP_441962.1_9 Forward -362 -343 5.11266 0.28
NP_440387.1_1 Reverse -213 -229 -2.39974 0.147
NP_440387.1_1 Reverse -71 -87 -5.34967 0.227
NP_441193.1_1 Forward -275 -256 11.8967 0.229
NP_441993.1_1 Reverse -117 -136 3.40855 0.235
NP_440293.1_3 Forward -352 -333 3.6377 0.192
NP_440293.1_3 Reverse -55 -74 -4.6221 0.264
NP_440766.1_5 Reverse -356 -368 8.61071 0.277
NP_442867.1_8 Forward -358 -339 3.93269 0.295
NP_441801.1_4 Reverse -338 -348 3.02829 0.231
NP_441436.1_6 Reverse -162 -181 12.1925 0.193
NP_441436.1_8 Reverse -270 -289 8.25926 0.283
NP_441253.1_8 Forward -392 -378 14.3399 0.128
NP_442514.1_5 Reverse -121 -140 -9.14605 0.294
NP_442341.1_3 Reverse -25 -44 4.22769 0.236
NP_442341.1_9 Reverse -32 -46 5.80051 0.255
NP_442395.2_4 Reverse -116 -135 0.588665 0.264
NP_442513.1_6 Reverse -346 -365 9.83173 0.296
NP_441842.1_9 Reverse -187 -206 18.8781 0.288
NP_441902.1_3 Reverse -257 -267 14.4393 0.222
NP_442834.1_9 Reverse -339 -358 5.40766 0.268
NP_440416.1_1 Forward -134 -115 -14.3569 0.287
NP_440416.1_9 Forward -361 -342 -19.0768 0.269
NP_440416.1_9 Reverse -340 -359 -19.7651 0.278
NP_443052.1_8 Reverse -104 -123 -12.2919 0.252
NP_440072.1_5 Reverse -57 -75 -2.0458 0.269
NP_442403.1_1 Forward -213 -194 20.9431 0.105
NP_442403.1_7 Forward -190 -171 22.1575 0.0189
NP_442564.1_10 Forward -381 -367 9.73436 0.296
NP_440988.1_10 Forward -148 -134 14.3865 0.134
NP_440988.1_10 Reverse -135 -149 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTAGCAAAAATGAGAAATGCCCACCGGGGCAAAATTTTCCGCCATTGACAGCCAGGGGAATTCCTCGATAAAACTATTGGGCACACAGCAGAAAAACTTTGGGTGTGGGGCCGTAATCTTCAGCCGGCCAAGTTATTCCCCAAAGCAGCTCCGCCCTTTGACAGAGAGAAGAACCATGGATACCTCCGTTAGTGTTTTTGCTGAAATTCCCGAAGACCTGCACCAGTCCTTGACCACCTATCTGGATAAACATCCCCATTGGGACCTAGACCGGGTGTTTTCCGCTGCCCTGTCCCTGTTCCTGCTGCAAAATGAGGGAGGCTACGGCACCAAACCCATGTCCACCAGTTACAAAGCCTGTGCCCGGGTCTATCTGGAAACTTTATTGCAAACTGCCGA

CDS

ATGATTCCCAAGTTAATTGTGGGTTTGGGTAACCCTGAGCCGAAATATGATCAAACTCGCCACAACATTGGTTTTGCGGTGGTGGATGCGTTGGCGATCACCTGGCAGTGTTCTTGGTATGACCATAAGCGCTTCCAGGGCTGGTTTGGCGAAGGGCTAATGGCCGGACAAAAAACCTGTTTGCTCAAACCCCGTACCTATATGAATCGCTCTGGCCAAGCTGTGCGGGCGGTGGTGGACTGGTACAAACTCGACCCCCAGTCGGTGCTGGTGGTCTATGACGATATGGATTTACCCCTGGGCCGATTACGCCTGAGACAAACGGGTTCCGCCGGGGGCCATAACGGGATGAAATCCCTGATTAGTCATTTGGGCACCCAGGATTTTCCCCGCCTCCGGTTAGGCATTGGCAAAAGTGACGGCAGTAAAGACACCATCGCCCATGTGCTAGGCAAATTTAGCCCGTCGGAATTACCCATCGTCGAGAAAAGCTTAGACCTGGCCACGGAGGCGATCGCCCATAGTCTGCACCATGGCATTGCCAAAACCATGAGTTTATTTAATAATCGTGACGTCTGCCCTTAG

Protein

MIPKLIVGLGNPEPKYDQTRHNIGFAVVDALAITWQCSWYDHKRFQGWFGEGLMAGQKTCLLKPRTYMNRSGQAVRAVVDWYKLDPQSVLVVYDDMDLPLGRLRLRQTGSAGGHNGMKSLISHLGTQDFPRLRLGIGKSDGSKDTIAHVLGKFSPSELPIVEKSLDLATEAIAHSLHHGIAKTMSLFNNRDVCP