Your browser is old and dusty. Try Google Chrome!

Details for slr0920

ORF slr0920
Accession NP_442398.1
Symbol
Category mutator MutT protein
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -350 -364 3.14618 0.168
NP_441061.1_2 Forward -343 -329 -0.197071 0.223
NP_441418.1_6 Reverse -169 -188 -21.7317 0.159
NP_441453.1_4 Forward -178 -170 4.93597 0.224
NP_441453.1_4 Reverse -329 -337 4.24765 0.259
NP_441818.1_9 Forward -79 -60 -9.73531 0.291
NP_440226.1_1 Forward -178 -159 6.68596 0.122
NP_440150.1_2 Reverse -318 -337 13.3716 0.167
NP_442173.1_1 Reverse -170 -178 8.27922 0.101
NP_442752.1_4 Reverse -169 -176 6.23397 0.161
NP_442752.1_4 Reverse -367 -374 5.44732 0.202
NP_443027.1_4 Forward -340 -330 8.82982 0.185
NP_441745.1_5 Forward -132 -113 5.70265 0.289
NP_442062.1_8 Forward -28 -18 9.22315 0.0658
NP_442062.1_8 Reverse -367 -377 4.20827 0.228
NP_442062.1_8 Forward -395 -385 2.7333 0.297
NP_440304.1_4 Forward -180 -170 5.87989 0.188
NP_440044.1_8 Reverse -330 -349 1.96607 0.161
NP_440908.1_10 Forward -55 -41 20.8451 0.0563
NP_442207.1_4 Forward -323 -304 7.7676 0.285
NP_439918.1_2 Reverse -369 -388 -3.24547 0.251
NP_441161.1_3 Reverse -323 -341 16.0471 0.0629
NP_441935.1_1 Forward -159 -140 5.01433 0.293
NP_441619.1_8 Forward -253 -239 6.58715 0.295
NP_441208.1_9 Forward -286 -272 6.29277 0.252
NP_441208.1_9 Forward -181 -167 5.40779 0.267
NP_442742.1_9 Reverse -33 -52 -14.2585 0.296
NP_441925.1_4 Reverse -54 -73 -14.6526 0.263
NP_441925.1_4 Reverse -78 -97 -15.0459 0.263
NP_441083.1_5 Reverse -169 -179 13.943 0.0159
NP_441083.1_5 Forward -178 -168 0.766681 0.218
NP_441434.1_3 Forward -140 -121 3.83436 0.194
NP_441738.1_2 Forward -374 -367 10.2652 0.101
NP_440209.1_2 Reverse -216 -232 13.3332 0.17
NP_440870.1_4 Forward -156 -138 3.16574 0.163
NP_440447.1_6 Forward -186 -168 7.29564 0.14
NP_440056.1_9 Forward -144 -125 14.7509 0.272
NP_442398.1_1 Forward -285 -266 23.1072 0.0526
NP_442398.1_3 Forward -50 -31 19.9574 0.196
NP_442398.1_5 Forward -392 -374 18.6037 0.236
NP_441713.1_1 Forward -184 -165 -14.1602 0.257
NP_442570.1_3 Forward -98 -79 -4.52377 0.231
NP_442570.1_3 Forward -346 -327 -8.752 0.292
NP_441716.1_2 Reverse -33 -52 2.2072 0.24
NP_441624.1_7 Forward -364 -350 8.94771 0.23
NP_441130.1_7 Reverse -296 -310 18.3868 0.287
NP_441486.1_1 Reverse -346 -360 -4.13031 0.189
NP_441486.1_1 Reverse -166 -180 -5.9986 0.272
NP_442634.1_4 Reverse -327 -341 2.2612 0.141
NP_441639.1_3 Reverse -328 -347 4.52268 0.264
NP_440842.1_5 Reverse -150 -169 14.9092 0.269
NP_443018.1_3 Forward -337 -330 12.5271 0.0523
NP_443018.1_3 Reverse -330 -337 12.5271 0.0523
NP_443018.1_3 Forward -27 -20 8.49558 0.141
NP_443018.1_3 Reverse -317 -324 7.11894 0.16
NP_441634.1_8 Reverse -327 -341 5.40779 0.114
NP_441634.1_8 Forward -360 -346 1.96621 0.175
NP_441634.1_8 Forward -322 -308 -1.96703 0.295
NP_441634.1_8 Forward -156 -142 -2.75368 0.295
NP_440376.1_1 Reverse -169 -178 6.19458 0.109
NP_440376.1_1 Reverse -302 -311 3.63797 0.2
NP_440376.1_1 Forward -178 -169 -0.196935 0.285
NP_442687.1_7 Forward -318 -308 4.50326 0.245
NP_442687.1_7 Reverse -168 -178 4.50326 0.245
NP_442191.1_4 Reverse -220 -234 12.9322 0.18
NP_442485.1_3 Reverse -318 -337 -1.27885 0.256
NP_440781.1_1 Forward -107 -93 12.291 0.266
NP_440642.1_10 Reverse -109 -123 4.12889 0.26
NP_440667.1_2 Forward -361 -342 -5.21209 0.254
NP_442658.1_1 Reverse -327 -337 5.78111 0.25
NP_442658.1_1 Forward -378 -368 4.89613 0.292
NP_442198.1_3 Forward -187 -168 9.24257 0.249
NP_442198.1_7 Forward -398 -379 7.66846 0.298
NP_441855.2_4 Reverse -378 -397 11.4512 0.213
NP_441414.1_9 Reverse -245 -264 -5.9004 0.182
NP_442937.1_5 Forward -289 -270 10.5209 0.158
NP_441958.1_5 Forward -179 -169 0.865012 0.12
NP_441958.1_5 Reverse -168 -178 0.275027 0.162
NP_440651.1_4 Reverse -105 -124 14.4541 0.21
NP_440203.1_5 Reverse -352 -362 8.63269 0.29
NP_440984.1_7 Forward -183 -169 7.27608 0.178
NP_439990.1_5 Forward -400 -387 5.62415 0.283
NP_439990.1_6 Forward -100 -81 7.7676 0.251
NP_441580.1_6 Reverse -158 -177 -8.55534 0.263
NP_440858.1_1 Forward -305 -286 4.81767 0.098
NP_442064.1_1 Reverse -14 -33 1.57275 0.146
NP_441099.1_5 Forward -188 -169 -2.65548 0.125
NP_440411.1_10 Forward -65 -46 10.8472 0.27
NP_441424.1_6 Forward -104 -85 10.7498 0.296
NP_442438.1_10 Reverse -164 -178 0.786239 0.213
NP_442438.1_10 Forward -381 -367 -0.590395 0.269
NP_441752.1_6 Reverse -149 -168 5.70265 0.211
NP_440377.1_1 Forward -197 -180 12.1434 0.264
NP_441000.1_6 Forward -179 -165 2.45787 0.139
NP_441000.1_6 Forward -105 -91 -4.62196 0.248
NP_440147.1_4 Reverse -306 -319 5.42749 0.125
NP_440147.1_4 Reverse -384 -397 5.23083 0.132
NP_440147.1_4 Reverse -167 -180 1.59258 0.224
NP_440147.1_4 Forward -245 -232 1.39592 0.23
NP_441175.1_7 Reverse -274 -293 13.1758 0.113
NP_441550.1_8 Forward -180 -170 9.02601 0.11
NP_441550.1_8 Reverse -327 -337 5.28945 0.255
NP_441916.1_10 Reverse -327 -346 7.17762 0.195
NP_440016.1_9 Forward -338 -319 9.93088 0.278
NP_441725.1_5 Forward -337 -327 -0.0199663 0.223
NP_441725.1_5 Reverse -170 -180 -0.708283 0.267
NP_440202.1_10 Forward -124 -105 15.8307 0.21
NP_440289.1_2 Reverse -166 -179 11.6223 0.0184
NP_442281.1_1 Reverse -324 -338 12.5853 0.0358
NP_442281.1_1 Reverse -381 -395 5.1122 0.169
NP_442281.1_1 Forward -363 -349 1.96562 0.282
NP_442901.1_4 Forward -329 -310 -1.27885 0.284
NP_440177.1_1 Forward -228 -210 8.67227 0.272
NP_440498.1_1 Forward -385 -367 -1.35749 0.223
NP_441644.1_6 Reverse -329 -339 13.1559 0.0227
NP_441644.1_6 Reverse -355 -365 8.63269 0.097
NP_441644.1_6 Forward -83 -73 7.25606 0.132
NP_442215.1_2 Forward -397 -381 -1.02311 0.177
NP_442215.1_2 Reverse -347 -363 -2.79306 0.204
NP_442215.1_2 Forward -346 -330 -3.8747 0.223
NP_442215.1_2 Forward -85 -69 -6.7263 0.278
NP_442215.1_2 Forward -334 -318 -7.21796 0.289
NP_442029.1_6 Reverse -235 -254 5.50599 0.25
NP_440253.1_2 Forward -178 -160 1.78911 0.152
NP_440929.1_8 Forward -178 -169 6.68623 0.0887
NP_441751.2_8 Forward -337 -323 0.88457 0.111
NP_442554.1_8 Reverse -330 -340 13.648 0.0164
NP_442554.1_8 Forward -337 -327 12.9597 0.021
NP_442554.1_8 Reverse -170 -180 11.9764 0.0312
NP_442554.1_8 Reverse -356 -366 4.69992 0.176
NP_442554.1_8 Reverse -350 -360 2.63497 0.265
NP_442142.1_4 Forward -367 -354 9.75346 0.0873
NP_442142.1_4 Reverse -352 -365 9.16348 0.101
NP_442292.1_1 Reverse -330 -339 4.22796 0.181
NP_442292.1_1 Reverse -350 -359 3.93297 0.189
NP_443009.1_5 Reverse -328 -339 4.08976 0.263
NP_442741.1_7 Forward -332 -313 13.5691 0.196
NP_441198.1_8 Forward -340 -330 11.0251 0.228
NP_440379.1_5 Forward -398 -379 -10.0303 0.273
NP_441468.1_1 Reverse -330 -337 3.97235 0.277
NP_441468.1_1 Forward -337 -330 3.97235 0.277
NP_439939.1_3 Forward -118 -99 -2.16383 0.214
NP_441020.2_6 Forward -360 -343 6.33202 0.267
NP_441015.1_10 Forward -164 -145 -11.4069 0.296
NP_441673.1_1 Reverse -169 -178 1.37636 0.114
NP_441673.1_1 Forward -178 -169 1.1797 0.163
NP_442253.1_5 Forward -398 -381 -7.13932 0.298
NP_441876.1_9 Reverse -312 -322 14.3359 0.267
NP_441637.1_9 Forward -291 -273 -2.0458 0.292
NP_442719.1_2 Reverse -287 -305 -8.63467 0.252
NP_442677.1_3 Reverse -108 -127 -7.17871 0.287
NP_442227.1_2 Forward -374 -355 -2.45882 0.274
NP_442427.1_8 Reverse -160 -179 7.17762 0.219
NP_442542.1_9 Forward -311 -297 12.2903 0.11
NP_442050.1_8 Forward -156 -137 18.9481 0.272
NP_441114.1_3 Reverse -387 -396 14.5527 0.193
NP_441114.1_3 Reverse -82 -91 7.96454 0.231
NP_441114.1_3 Forward -393 -384 7.07956 0.251
NP_440558.1_2 Reverse -137 -156 -4.13045 0.243
NP_440558.1_2 Forward -341 -322 -5.31042 0.256
NP_441878.1_6 Reverse -328 -338 10.5014 0.0176
NP_441878.1_6 Forward -339 -329 0.668351 0.139
NP_441878.1_6 Forward -179 -169 0.57002 0.14
NP_441878.1_6 Reverse -385 -395 -7.49312 0.231
NP_441878.1_6 Forward -318 -308 -7.88644 0.278
NP_441036.1_8 Reverse -168 -178 15.0247 0.0137
NP_440614.1_2 Forward -136 -117 20.944 0.034
NP_441557.1_5 Reverse -169 -178 0.491382 0.144
NP_441557.1_5 Forward -178 -169 0.29472 0.174
NP_441590.1_4 Reverse -87 -106 10.6184 0.249
NP_442066.2_9 Forward -182 -169 11.9173 0.154
NP_441433.1_8 Forward -133 -114 3.53937 0.204
NP_442419.1_2 Forward -369 -350 0.491109 0.242
NP_441308.1_8 Reverse -167 -177 9.12481 0.231
NP_442183.1_1 Reverse -169 -183 6.09611 0.188
NP_442135.1_9 Reverse -94 -113 12.9783 0.249
NP_441574.1_1 Forward -317 -298 -5.70374 0.267
NP_441037.1_4 Forward -319 -309 6.92787 0.237
NP_442594.1_9 Forward -142 -123 8.16011 0.232
NP_440690.1_3 Forward -140 -121 13.8641 0.237
NP_442317.1_6 Reverse -324 -343 9.0459 0.211
NP_441633.1_3 Reverse -167 -180 -3.71729 0.177
NP_441633.1_3 Reverse -306 -319 -5.68391 0.236
NP_442764.1_8 Reverse -8 -27 3.14605 0.271
NP_442998.1_5 Forward -296 -286 8.04317 0.274
NP_442998.1_10 Reverse -236 -243 7.21728 0.144
NP_442998.1_10 Forward -176 -169 5.74231 0.255
NP_440899.1_1 Forward -139 -120 6.74838 0.267
NP_441799.1_1 Reverse -325 -339 3.93223 0.274
NP_440640.1_6 Forward -316 -297 5.01433 0.212
NP_441007.1_10 Forward -343 -330 1.49425 0.203
NP_441007.1_10 Reverse -324 -337 -0.669033 0.287
NP_442961.1_4 Forward -49 -30 3.44104 0.288
NP_441090.1_6 Reverse -355 -369 15.5359 0.114
NP_441090.1_6 Reverse -118 -132 13.0776 0.137
NP_441512.1_9 Forward -186 -167 20.2548 0.0232
NP_441559.1_8 Forward -233 -219 0.196253 0.169
NP_441559.1_8 Reverse -76 -90 -4.81863 0.238
NP_441559.1_8 Reverse -100 -114 -7.2769 0.289
NP_441270.1_5 Forward -80 -61 14.263 0.211
NP_440915.1_6 Forward -329 -315 -1.37704 0.233
NP_442855.1_6 Reverse -202 -221 12.3892 0.298
NP_440134.1_2 Reverse -167 -186 11.8975 0.227
NP_440748.1_1 Reverse -300 -319 18.3873 0.152
NP_441464.1_8 Reverse -329 -343 5.01447 0.26
NP_441464.1_8 Reverse -169 -183 3.93283 0.283
NP_442993.1_1 Reverse -302 -318 -13.9045 0.295
NP_440570.1_5 Forward -368 -349 4.22769 0.23
NP_441750.1_4 Reverse -304 -323 1.47442 0.28
NP_441340.1_5 Reverse -330 -337 4.07068 0.239
NP_441340.1_5 Forward -337 -330 4.07068 0.239
NP_440586.1_8 Forward -337 -330 7.61025 0.227
NP_440586.1_8 Reverse -330 -337 7.61025 0.227
NP_440586.1_8 Reverse -356 -363 5.8403 0.283
NP_442959.1_6 Forward -310 -291 2.16274 0.253
NP_440027.1_3 Reverse -81 -99 2.96833 0.282
NP_440451.1_10 Reverse -350 -369 8.84842 0.264
NP_439937.1_9 Reverse -150 -167 -13.0398 0.279
NP_439937.1_9 Reverse -328 -345 -16.0881 0.287
NP_439937.1_9 Reverse -168 -185 -16.1864 0.287
NP_441657.1_5 Reverse -330 -349 0.196116 0.228
NP_440408.1_7 Reverse -355 -374 7.07928 0.292
NP_440439.1_1 Reverse -166 -179 -0.0790467 0.207
NP_440372.1_2 Reverse -170 -177 4.07068 0.262
NP_441789.1_7 Reverse -339 -358 -1.18128 0.251
NP_440819.1_5 Forward -121 -113 7.98423 0.228
NP_440316.1_10 Forward -365 -355 12.4681 0.214
NP_440316.1_10 Reverse -328 -338 7.84651 0.245
NP_442488.1_4 Forward -319 -300 11.1109 0.236
NP_440139.1_1 Reverse -163 -182 3.9319 0.194
NP_441572.1_7 Reverse -138 -157 -4.81876 0.244
NP_442384.1_10 Forward -317 -304 2.2809 0.23
NP_441018.1_7 Reverse -363 -382 9.0459 0.236
NP_442790.1_4 Reverse -320 -339 -6.09707 0.144
NP_442262.1_10 Forward -337 -330 10.4622 0.145
NP_442262.1_10 Reverse -330 -337 10.4622 0.145
NP_442262.1_10 Forward -27 -20 8.59391 0.22
NP_442262.1_10 Reverse -317 -324 8.20058 0.25
NP_440163.1_10 Reverse -352 -362 8.73149 0.262
NP_440297.1_9 Forward -337 -327 9.61647 0.0917
NP_440297.1_9 Reverse -330 -340 -0.0199663 0.282
NP_441592.1_4 Forward -338 -319 -3.24547 0.279
NP_440894.1_10 Forward -183 -164 10.5209 0.155
NP_440999.1_9 Reverse -70 -84 1.37622 0.166
NP_440999.1_9 Reverse -140 -154 0.392915 0.187
NP_440888.1_2 Forward -178 -164 12.2903 0.0476
NP_439969.1_1 Forward -237 -218 -7.4737 0.297
NP_442845.1_2 Forward -331 -317 5.30946 0.237
NP_442845.1_2 Forward -344 -330 3.53951 0.287
NP_442845.1_2 Reverse -234 -248 3.53951 0.287
NP_441918.1_7 Reverse -274 -293 -2.85214 0.297
NP_441469.1_8 Reverse -328 -337 10.9145 0.191
NP_442315.1_1 Forward -360 -342 8.67227 0.21
NP_443064.1_6 Reverse -52 -62 9.75513 0.199
NP_442578.1_5 Reverse -307 -326 1.96607 0.257
NP_442578.1_7 Forward -152 -145 9.97054 0.112
NP_440710.1_1 Reverse -301 -319 -6.86402 0.228
NP_441462.1_2 Reverse -169 -179 8.63316 0.0339
NP_443062.1_1 Forward -100 -82 8.74094 0.148
NP_443062.1_6 Forward -261 -242 4.62101 0.216
NP_441601.1_4 Reverse -351 -370 -5.01543 0.293
NP_442204.1_1 Forward -368 -357 0.0586712 0.284
NP_440516.1_8 Reverse -169 -178 7.17789 0.0754
NP_440516.1_8 Forward -178 -169 5.01461 0.118
NP_440516.1_8 Reverse -219 -228 -0.295266 0.232
NP_442080.1_7 Forward -369 -350 -1.27885 0.287
NP_442428.1_5 Forward -337 -330 4.36568 0.271
NP_442428.1_5 Reverse -330 -337 4.36568 0.271
NP_440673.1_2 Forward -348 -329 7.75569 0.292
NP_440865.1_9 Forward -159 -140 -5.60541 0.215
NP_441052.1_2 Reverse -81 -91 2.14332 0.216
NP_440314.1_9 Reverse -170 -189 -7.67036 0.241
NP_440648.1_1 Reverse -219 -238 3.93269 0.232
NP_441733.1_10 Forward -181 -168 5.23083 0.223
NP_441004.1_1 Forward -323 -304 -15.2418 0.273
NP_441004.1_2 Forward -252 -233 1.47442 0.22
NP_441004.1_4 Reverse -217 -227 17.4829 0.12
NP_442366.1_3 Reverse -348 -366 0.707465 0.166
NP_442366.1_3 Reverse -354 -372 -5.48739 0.288
NP_440323.1_4 Forward -315 -296 13.7658 0.148
NP_441729.1_4 Reverse -100 -119 11.1109 0.293
NP_441115.1_4 Reverse -354 -372 7.78652 0.272
NP_441851.1_9 Forward -80 -61 9.63589 0.239
NP_441851.1_10 Reverse -328 -338 5.97822 0.19
NP_441851.1_10 Forward -318 -308 5.28991 0.218
NP_442515.1_1 Reverse -168 -182 -2.75368 0.279
NP_440593.1_3 Reverse -113 -132 -7.4737 0.295
NP_440432.1_9 Reverse -309 -324 -3.06836 0.179
NP_442843.1_1 Forward -337 -318 -0.0988766 0.18
NP_440474.1_8 Reverse -330 -344 6.19383 0.23
NP_440474.1_8 Forward -357 -343 4.22722 0.287
NP_442006.1_2 Forward -128 -111 -8.61428 0.197
NP_442006.1_2 Reverse -219 -236 -16.1858 0.243
NP_441003.1_9 Forward -59 -40 3.24438 0.295
NP_441003.1_9 Reverse -313 -332 2.94938 0.3
NP_441078.1_4 Reverse -169 -178 0.196389 0.205
NP_441078.1_4 Forward -178 -169 0.196389 0.205
NP_441078.1_4 Reverse -329 -338 -1.6719 0.266
NP_441078.1_4 Forward -338 -329 -1.77023 0.266
NP_442729.1_8 Forward -182 -169 10.8357 0.125
NP_441663.1_7 Forward -361 -342 5.80098 0.236
NP_441094.1_7 Reverse -117 -136 15.5152 0.295
NP_440526.1_3 Forward -337 -326 1.23817 0.267
NP_442320.1_8 Reverse -163 -177 3.24451 0.064
NP_441732.1_2 Reverse -230 -246 -17.1494 0.24
NP_440760.1_1 Reverse -245 -264 -14.2585 0.128
NP_442797.1_1 Reverse -60 -79 -5.31042 0.288
NP_440199.1_10 Reverse -166 -176 13.8447 0.0988
NP_440199.1_10 Reverse -22 -32 6.96153 0.251
NP_440713.1_4 Reverse -120 -139 1.57275 0.284
NP_442489.1_7 Forward -178 -169 0.688044 0.152
NP_442489.1_7 Reverse -169 -178 0.688044 0.152
NP_442489.1_7 Reverse -329 -338 -1.6719 0.235
NP_442489.1_7 Forward -338 -329 -1.77023 0.247
NP_440559.1_1 Reverse -170 -179 4.81794 0.193
NP_441659.2_8 Reverse -329 -339 5.78156 0.0979
NP_441659.2_8 Reverse -169 -179 0.0783647 0.277
NP_441040.1_2 Forward -237 -218 -5.50708 0.18
NP_441040.1_2 Reverse -133 -152 -9.34199 0.236
NP_440779.1_5 Reverse -308 -325 -5.66436 0.152
NP_442346.1_5 Reverse -328 -338 14.7297 0.0103
NP_442346.1_5 Forward -339 -329 4.89658 0.269
NP_440545.1_3 Forward -342 -325 7.11867 0.0518
NP_441923.1_8 Forward -64 -50 12.0943 0.286
NP_442311.1_8 Forward -368 -349 22.2223 0.0361
NP_442603.1_7 Reverse -169 -183 5.99717 0.264
NP_441050.1_5 Reverse -121 -139 5.13236 0.194
NP_441050.1_5 Forward -320 -302 -3.12744 0.286
NP_440170.1_6 Reverse -151 -170 12.9791 0.283
NP_440912.1_3 Reverse -31 -50 12.88 0.254
NP_441112.1_6 Reverse -38 -57 -4.52377 0.297
NP_440671.1_4 Reverse -163 -177 10.521 0.155
NP_440671.1_4 Forward -364 -350 8.65272 0.193
NP_442404.1_9 Reverse -172 -186 8.94708 0.289
NP_440772.1_6 Forward -217 -198 10.1275 0.245
NP_442199.1_5 Reverse -347 -366 -3.04881 0.2
NP_442199.1_5 Forward -346 -327 -3.83545 0.214
NP_442199.1_7 Reverse -59 -78 4.22689 0.245
NP_442140.1_3 Forward -337 -327 6.76487 0.159
NP_442140.1_3 Reverse -330 -340 4.10993 0.261
NP_442140.1_3 Forward -99 -89 3.51995 0.294
NP_440875.1_9 Reverse -331 -341 9.05339 0.233
NP_442497.1_10 Reverse -170 -179 0.393051 0.175
NP_442497.1_10 Forward -337 -328 0.29472 0.199
NP_440821.1_4 Forward -180 -170 -0.118297 0.229
NP_440821.1_4 Reverse -167 -177 -0.216628 0.244
NP_441239.1_9 Forward -340 -328 18.5252 0.0114
NP_441239.1_9 Reverse -327 -339 8.59377 0.128
NP_441239.1_9 Forward -180 -168 5.93884 0.202
NP_441239.1_9 Forward -230 -218 5.44718 0.221
NP_441239.1_9 Reverse -353 -365 3.2839 0.289
NP_441239.1_9 Reverse -167 -179 2.98891 0.3
NP_441951.1_9 Reverse -300 -319 3.04771 0.254
NP_441892.1_1 Forward -162 -145 1.71047 0.148
NP_441892.1_1 Forward -373 -356 -2.91109 0.23
NP_441892.1_1 Reverse -299 -316 -6.05768 0.296
NP_441508.1_4 Reverse -41 -55 12.903 0.299
NP_441017.1_6 Reverse -64 -78 12.9786 0.209
NP_440546.1_4 Forward -100 -90 9.07643 0.156
NP_440546.1_4 Forward -57 -47 8.39772 0.192
NP_440546.1_4 Reverse -355 -365 6.55553 0.291
NP_440675.1_1 Forward -347 -328 3.34271 0.252
NP_440638.2_2 Reverse -294 -313 14.1591 0.189
NP_442402.1_4 Reverse -185 -204 -6.98278 0.268
NP_442402.1_9 Forward -164 -145 9.93088 0.275
NP_440696.1_3 Forward -104 -86 -3.81576 0.29
NP_440696.1_3 Forward -175 -157 -4.01242 0.294
NP_442039.1_4 Reverse -170 -177 7.80726 0.24
NP_440160.1_7 Forward -221 -202 20.5506 0.0579
NP_442053.1_1 Forward -178 -169 12.9794 0.0225
NP_440505.1_7 Reverse -137 -156 -2.26216 0.289
NP_442532.1_7 Reverse -329 -343 11.2093 0.132
NP_440914.1_1 Reverse -386 -396 10.7621 0.122
NP_440914.1_1 Forward -343 -333 6.56569 0.273
NP_441699.1_2 Forward -130 -111 6.58763 0.279
NP_441011.1_8 Forward -316 -307 8.35786 0.144
NP_442533.1_6 Reverse -329 -338 7.17789 0.0948
NP_442533.1_6 Forward -338 -329 6.68623 0.105
NP_442533.1_6 Forward -178 -169 5.3096 0.145
NP_442541.1_10 Reverse -150 -164 12.3887 0.182
NP_442541.1_10 Reverse -110 -124 6.48882 0.248
NP_442541.1_10 Reverse -329 -343 1.76896 0.279
NP_442232.1_3 Forward -346 -327 -7.17871 0.194
NP_442229.1_1 Forward -340 -326 5.21053 0.283
NP_442229.1_1 Forward -397 -383 5.01387 0.291
NP_441028.1_6 Reverse -311 -321 6.0761 0.232
NP_440007.1_4 Forward -349 -330 11.7992 0.244
NP_440007.1_9 Reverse -325 -339 9.14437 0.171
NP_440007.1_9 Reverse -241 -255 5.99778 0.238
NP_441106.1_1 Forward -365 -356 2.16301 0.297
NP_440480.1_10 Reverse -31 -45 17.3052 0.224
NP_441286.1_1 Reverse -168 -180 -4.48425 0.161
NP_440670.1_8 Forward -178 -169 12.5861 0.0253
NP_440670.1_8 Reverse -169 -178 8.35786 0.069
NP_440886.1_7 Forward -179 -169 4.89613 0.213
NP_440886.1_7 Reverse -354 -364 3.8145 0.265
NP_440828.1_1 Reverse -60 -79 1.08032 0.256
NP_442382.1_9 Forward -55 -36 9.14342 0.281
NP_440513.1_6 Forward -348 -329 13.7649 0.191
NP_441021.1_1 Forward -337 -318 2.26107 0.083
NP_441463.1_3 Reverse -339 -358 6.4893 0.0616
NP_442842.1_4 Forward -62 -43 7.57094 0.223
NP_442842.1_10 Forward -220 -201 3.66898 0.244
NP_441962.1_4 Reverse -381 -400 -10.522 0.229
NP_441431.1_2 Reverse -326 -340 6.88214 0.257
NP_441431.1_3 Reverse -355 -374 2.26107 0.289
NP_441488.1_8 Forward -369 -355 10.422 0.146
NP_441836.1_2 Forward -156 -137 -5.70374 0.284
NP_442352.1_8 Reverse -313 -327 16.5185 0.242
NP_440467.1_3 Reverse -356 -375 13.6978 0.188
NP_440114.1_10 Reverse -329 -343 12.4876 0.0814
NP_440114.1_10 Reverse -91 -105 5.70279 0.296
NP_442437.1_3 Reverse -247 -266 11.8967 0.193
NP_440293.1_9 Forward -170 -156 9.21831 0.286
NP_440293.1_10 Reverse -217 -236 -1.67217 0.271
NP_440766.1_4 Reverse -165 -179 6.78443 0.0973
NP_440766.1_5 Forward -299 -287 7.5603 0.29
NP_441237.1_9 Reverse -81 -91 9.61647 0.281
NP_442743.1_5 Reverse -350 -369 3.14605 0.277
NP_439910.1_2 Reverse -161 -178 -22.3806 0.232
NP_442867.1_8 Reverse -111 -130 11.6025 0.197
NP_442867.1_8 Forward -177 -158 5.211 0.276
NP_441984.1_4 Forward -310 -296 19.3708 0.118
NP_442040.1_4 Forward -373 -354 5.30933 0.268
NP_442509.1_9 Reverse -169 -179 11.7793 0.114
NP_442509.1_9 Reverse -274 -284 8.3377 0.192
NP_442514.1_5 Reverse -148 -167 -0.886293 0.192
NP_442514.1_5 Forward -135 -116 -2.95123 0.222
NP_442514.1_5 Reverse -110 -129 -9.44104 0.296
NP_440554.1_4 Reverse -330 -340 4.0116 0.205
NP_440554.1_4 Forward -177 -167 1.84832 0.287
NP_441885.1_5 Reverse -169 -179 -0.609952 0.215
NP_441885.1_5 Forward -311 -301 -1.49493 0.264
NP_442341.1_7 Forward -179 -165 5.89945 0.142
NP_442341.1_7 Reverse -168 -182 1.86788 0.278
NP_442341.1_9 Reverse -299 -313 7.17714 0.204
NP_441173.1_9 Reverse -312 -320 10.8354 0.243
NP_441173.1_9 Reverse -291 -299 9.75379 0.284
NP_441842.1_10 Reverse -162 -176 9.93102 0.178
NP_443060.1_5 Forward -91 -72 16.7149 0.0701
NP_443010.1_10 Reverse -166 -183 2.57753 0.273
NP_442451.1_2 Reverse -161 -180 0.0977854 0.153
NP_441105.1_3 Forward -349 -330 -0.0988766 0.132
NP_442373.1_2 Forward -313 -294 -2.75381 0.198
NP_440216.1_1 Forward -178 -164 4.03116 0.0279
NP_440216.1_1 Reverse -234 -248 -12.1934 0.247
NP_440216.1_9 Forward -26 -17 14.0611 0.184
NP_440172.1_1 Forward -178 -168 3.91327 0.213
NP_442290.1_8 Reverse -328 -342 16.4209 0.278
NP_441226.1_7 Reverse -220 -227 9.47853 0.147
NP_442834.1_9 Forward -130 -111 5.40766 0.268
NP_442034.1_7 Forward -297 -279 8.57394 0.245
NP_441766.1_2 Forward -178 -169 10.1278 0.0243
NP_440416.1_9 Reverse -84 -103 -19.0768 0.269
NP_440416.1_9 Forward -371 -352 -20.0601 0.281
NP_443052.1_8 Reverse -291 -310 -10.1286 0.203
NP_443052.1_9 Reverse -60 -79 -3.54046 0.25
NP_442116.1_2 Reverse -93 -112 10.7167 0.289
NP_442403.1_8 Forward -356 -337 -1.67217 0.258
NP_442564.1_9 Reverse -329 -343 17.1181 0.181
NP_440261.1_5 Reverse -170 -183 -3.12731 0.115
NP_440261.1_5 Forward -337 -324 -4.30728 0.145
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGTGGACATTGCTCAGCCGGACTACAATCCCCTAGACCATGGCGGTGTCAGTTTTGAGGATGCCATGGCCCGTATCCATGGGGTGAAGGCTGACGGCAGTGTGGTAAAAAATGTGGCCGTTTTCCGAGAAGTTTACGAAATTCTCGGTATCGGCTGGCTATATGCTCCCACCCGTTGGCCCATTATCGGACCCTTGGTGGATAGAATTTACGACTTTTGGGCCGATCTCCGTTTGAGCTGGACTGGGCGGTCAAGCCTAGCGGAAATCCTTGCCCAGCGGGAAAAGGGAATGTGTGCCACCGATGGTTGTGCATTGCCGGTTACCAGTGGTGTTGAGGGTAAGCCCTAGGTTTTTGCGACAATAATTGAAGGCCATTGAAAAGAATACAGGCATAGTC

CDS

GTGAATTTTCGTAACCCAGTTCCCACGGTGGATTTGATCATCGAAATGATTGATCAACCCCGCCGACCTATTTTATTAATTGAGCGGCAAAATCCGCCCCACGGCTGGGCCCTGCCCGGAGGCTTTGTGGACTACGGCGAAACCCTAGAAGCGGCAGCCCTGCGGGAAGCCAAGGAAGAAATTTCCCTGGACGTCCAGCTTATCGAAATGTTTTATGCCTACTCAGATCCCCGCCGGGATCCCCGGCAACACACCCTCAGTGTGGTATTCCTGGCGGCGGCCACCGGCAAACCCCAAGCGGCGGACGATGCTAAAACCGTTGGCTTTTTTGATTTGTGGGAATTTCCCGACCCAGTTTGCTTTGATCATGGACAAATTTTGCGGGATTATCGCCGCTACCGCTATTATCGTCAACGCCCCGATCCCCACCGGAATTATTTGGGGGACTAA

Protein

MNFRNPVPTVDLIIEMIDQPRRPILLIERQNPPHGWALPGGFVDYGETLEAAALREAKEEISLDVQLIEMFYAYSDPRRDPRQHTLSVVFLAAATGKPQAADDAKTVGFFDLWEFPDPVCFDHGQILRDYRRYRYYRQRPDPHRNYLGD