Your browser is old and dusty. Try Google Chrome!

Details for slr0919

ORF slr0919
Accession NP_442397.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -243 -257 6.98109 0.11
NP_441061.1_2 Forward -62 -48 0.982901 0.196
NP_441061.1_2 Forward -257 -243 -0.197071 0.223
NP_441453.1_7 Reverse -282 -289 14.1988 0.175
NP_441453.1_7 Reverse -170 -177 14.1988 0.175
NP_441623.1_1 Reverse -12 -30 2.18243 0.206
NP_442151.1_6 Forward -99 -85 16.5192 0.0145
NP_442151.1_6 Reverse -248 -262 9.63603 0.142
NP_440561.1_1 Reverse -237 -256 13.3716 0.249
NP_441818.1_9 Forward -275 -256 -9.83364 0.291
NP_440348.1_6 Reverse -381 -400 3.83436 0.266
NP_442744.1_9 Forward -332 -318 13.9018 0.266
NP_442752.1_4 Reverse -221 -228 12.4288 0.0388
NP_442752.1_4 Reverse -90 -97 10.5605 0.1
NP_443027.1_4 Forward -101 -91 11.0914 0.107
NP_441225.1_4 Reverse -190 -209 2.55606 0.237
NP_440784.1_7 Forward -98 -91 8.59391 0.129
NP_440061.1_9 Reverse -119 -133 6.98048 0.223
NP_441054.1_2 Reverse -53 -72 9.93088 0.284
NP_442062.1_8 Forward -360 -350 5.48657 0.168
NP_441781.1_7 Reverse -158 -177 -3.3438 0.296
NP_439918.1_3 Reverse -218 -237 12.9791 0.172
NP_441208.1_9 Reverse -87 -101 5.40779 0.267
NP_442136.1_4 Reverse -41 -60 6.48849 0.295
NP_442889.1_8 Forward -102 -88 8.84875 0.109
NP_440407.1_6 Reverse -146 -160 12.7826 0.255
NP_442445.1_2 Forward -255 -236 16.1257 0.191
NP_441716.1_1 Forward -390 -376 4.52282 0.255
NP_441716.1_1 Reverse -90 -104 3.93283 0.259
NP_440747.1_10 Reverse -87 -99 -4.58258 0.109
NP_441486.1_1 Forward -102 -88 7.86607 0.0337
NP_441014.1_5 Forward -301 -283 12.8022 0.231
NP_442848.1_5 Forward -391 -373 -0.374176 0.276
NP_441012.1_4 Forward -55 -42 10.934 0.26
NP_441634.1_8 Reverse -301 -315 2.45787 0.167
NP_441634.1_8 Reverse -88 -102 -3.147 0.295
NP_442485.1_3 Forward -262 -243 -3.44213 0.274
NP_442583.1_8 Forward -262 -243 9.73422 0.238
NP_440642.1_10 Reverse -187 -201 3.93223 0.264
NP_441013.1_2 Reverse -79 -97 -0.374176 0.267
NP_441950.1_8 Forward -261 -247 4.52282 0.292
NP_442658.1_1 Forward -199 -189 8.63269 0.184
NP_440141.1_8 Reverse -206 -225 8.06259 0.232
NP_442782.1_2 Reverse -48 -62 5.80112 0.236
NP_439968.1_8 Reverse -80 -96 16.8731 0.13
NP_442937.1_5 Forward -331 -312 11.3075 0.141
NP_442937.1_5 Reverse -85 -104 6.58763 0.275
NP_440318.1_1 Forward -285 -266 5.60432 0.218
NP_440950.1_8 Reverse -256 -275 12.63 0.163
NP_440203.1_5 Reverse -353 -363 12.1726 0.164
NP_441097.1_2 Reverse -205 -222 8.10198 0.236
NP_439990.1_5 Reverse -85 -98 9.65572 0.136
NP_441338.2_9 Reverse -48 -67 5.01433 0.261
NP_442064.1_4 Forward -261 -242 10.815 0.192
NP_441099.1_5 Reverse -60 -79 -12.0953 0.294
NP_441712.1_1 Forward -400 -381 10.5839 0.267
NP_441294.1_7 Forward -103 -89 13.0902 0.0747
NP_442438.1_10 Forward -104 -90 1.47456 0.194
NP_440147.1_1 Forward -105 -86 11.7992 0.185
NP_440147.1_6 Forward -59 -40 16.4207 0.238
NP_441041.1_4 Reverse -287 -306 -10.817 0.237
NP_441041.1_7 Reverse -274 -286 5.27969 0.265
NP_440736.1_6 Reverse -249 -268 14.3558 0.217
NP_442941.1_3 Forward -317 -307 -1.29827 0.297
NP_442941.1_3 Forward -98 -88 -1.29827 0.297
NP_440453.1_5 Forward -203 -185 14.4738 0.12
NP_441644.1_6 Forward -153 -143 6.0761 0.167
NP_441644.1_6 Forward -257 -247 3.61784 0.272
NP_440867.1_10 Reverse -188 -207 5.211 0.273
NP_442215.1_2 Forward -65 -49 1.73016 0.128
NP_442215.1_2 Forward -101 -85 0.0585348 0.157
NP_442029.1_6 Reverse -216 -235 10.0292 0.182
NP_442247.1_5 Forward -223 -209 17.3524 0.234
NP_442554.1_8 Forward -98 -88 4.50326 0.184
NP_442554.1_8 Reverse -249 -259 3.71661 0.215
NP_442554.1_8 Forward -256 -246 1.94665 0.288
NP_442554.1_9 Forward -276 -257 13.0738 0.279
NP_442142.1_4 Reverse -162 -175 7.59019 0.135
NP_442142.1_4 Forward -96 -83 6.41022 0.168
NP_442142.1_4 Forward -60 -47 5.52525 0.188
NP_442142.1_4 Reverse -263 -276 2.57534 0.286
NP_442292.1_1 Forward -98 -89 5.80125 0.129
NP_440919.1_7 Reverse -237 -255 10.1749 0.185
NP_440895.1_6 Reverse -84 -97 15.8506 0.147
NP_443009.1_5 Reverse -276 -287 4.97473 0.222
NP_443009.1_5 Reverse -89 -100 3.99143 0.268
NP_441371.1_3 Forward -176 -158 8.96727 0.277
NP_441448.1_1 Reverse -204 -223 5.60432 0.261
NP_440379.1_5 Reverse -239 -258 -4.52377 0.215
NP_441468.1_1 Reverse -91 -98 4.26735 0.246
NP_440286.1_2 Reverse -323 -336 15.6539 0.296
NP_441826.1_2 Reverse -84 -98 -4.62196 0.298
NP_442719.1_2 Forward -230 -212 -1.35821 0.175
NP_442719.1_2 Forward -251 -233 -9.42131 0.264
NP_441315.1_2 Forward -207 -189 16.6306 0.213
NP_440145.1_3 Forward -207 -188 -5.40875 0.267
NP_441445.1_1 Reverse -300 -319 0.884433 0.266
NP_441590.1_4 Forward -307 -288 3.14526 0.29
NP_441458.1_10 Reverse -239 -258 1.37609 0.29
NP_442397.1_1 Forward -169 -155 14.2126 0.291
NP_442397.1_5 Forward -195 -176 21.0414 0.177
NP_442397.1_9 Reverse -41 -60 3.93269 0.262
NP_442347.1_2 Forward -229 -220 4.0313 0.284
NP_442594.1_10 Reverse -120 -139 16.7149 0.12
NP_442594.1_10 Forward -231 -212 8.65176 0.28
NP_442590.1_10 Reverse -77 -96 7.37428 0.229
NP_442998.1_5 Reverse -18 -28 8.53483 0.261
NP_440899.1_8 Reverse -371 -390 -2.0655 0.221
NP_440256.1_1 Reverse -185 -204 -9.24366 0.275
NP_442526.1_5 Forward -273 -255 14.178 0.275
NP_441512.1_4 Forward -103 -84 8.94757 0.255
NP_441559.1_8 Forward -290 -276 3.93283 0.136
NP_440915.1_6 Forward -178 -164 3.04785 0.109
NP_440997.1_6 Forward -356 -337 8.65258 0.266
NP_441464.1_8 Reverse -96 -110 9.34103 0.192
NP_442386.1_10 Forward -137 -124 5.23083 0.262
NP_441750.1_4 Forward -60 -41 3.6377 0.231
NP_441750.1_7 Forward -110 -100 13.2547 0.274
NP_442506.1_2 Forward -301 -282 8.65258 0.269
NP_441160.1_5 Forward -268 -249 -6.49039 0.288
NP_440586.1_8 Forward -98 -91 9.28187 0.164
NP_440586.1_8 Reverse -255 -262 7.1186 0.272
NP_440192.1_4 Reverse -211 -230 10.0767 0.254
NP_440684.1_9 Forward -266 -252 7.9644 0.246
NP_440027.1_3 Forward -153 -135 4.54162 0.257
NP_439937.1_9 Forward -235 -218 -17.1697 0.294
NP_442294.1_3 Forward -32 -18 11.7987 0.297
NP_440926.1_5 Forward -262 -243 8.06259 0.274
NP_441803.1_2 Forward -56 -37 2.3594 0.213
NP_441572.1_7 Reverse -84 -103 -0.000545616 0.176
NP_442384.1_10 Forward -296 -283 10.5407 0.0439
NP_442384.1_10 Reverse -90 -103 4.73917 0.148
NP_442384.1_10 Reverse -159 -172 0.60927 0.286
NP_441877.1_7 Forward -202 -183 2.35861 0.23
NP_441018.1_7 Reverse -283 -302 13.2741 0.139
NP_441018.1_7 Forward -261 -242 6.39097 0.289
NP_440282.1_10 Forward -300 -281 2.85105 0.147
NP_441335.1_8 Reverse -202 -221 11.3075 0.204
NP_442126.1_10 Forward -360 -341 19.6656 0.148
NP_440297.1_9 Reverse -243 -253 1.35667 0.282
NP_440297.1_9 Forward -256 -246 0.0783647 0.282
NP_440297.1_9 Reverse -91 -101 -0.511621 0.289
NP_440350.1_5 Forward -277 -258 0.491109 0.162
NP_442280.1_10 Reverse -184 -202 5.74663 0.283
NP_442280.1_10 Reverse -134 -152 5.16222 0.29
NP_442280.1_10 Reverse -178 -196 5.06482 0.291
NP_440999.1_2 Reverse -243 -262 13.2741 0.177
NP_441759.1_8 Forward -157 -138 11.6017 0.211
NP_441543.1_2 Forward -98 -89 11.6028 0.0504
NP_442845.1_2 Reverse -84 -98 4.32615 0.261
NP_441469.1_8 Forward -100 -91 11.9961 0.136
NP_442578.1_7 Forward -337 -330 6.72562 0.18
NP_440710.1_1 Forward -86 -68 -1.75081 0.185
NP_440519.1_8 Forward -329 -313 2.51681 0.261
NP_440519.1_8 Forward -338 -322 1.04184 0.294
NP_442204.1_1 Reverse -86 -97 7.82682 0.112
NP_441560.1_3 Forward -205 -187 7.09898 0.28
NP_440516.1_6 Forward -57 -43 10.717 0.226
NP_442428.1_5 Reverse -91 -98 11.4455 0.062
NP_442120.1_10 Reverse -176 -195 -11.7019 0.264
NP_440673.1_2 Reverse -232 -251 9.90183 0.228
NP_440673.1_3 Forward -55 -48 8.98723 0.203
NP_441052.1_2 Forward -99 -89 5.28991 0.124
NP_442219.1_8 Reverse -211 -230 6.23444 0.3
NP_440436.1_4 Forward -56 -47 8.75075 0.0995
NP_440436.1_4 Reverse -166 -175 7.76745 0.124
NP_440436.1_4 Forward -98 -89 4.7192 0.244
NP_441884.1_9 Forward -302 -283 -20.5517 0.194
NP_440314.1_9 Forward -229 -210 -10.4236 0.298
NP_440577.1_2 Reverse -36 -55 15.7324 0.203
NP_442366.1_3 Reverse -241 -259 -4.50408 0.272
NP_442139.1_7 Forward -262 -243 8.25926 0.267
NP_442206.1_1 Forward -162 -143 -12.3902 0.228
NP_441851.1_10 Reverse -89 -99 4.79825 0.247
NP_442208.1_5 Forward -206 -187 -9.14533 0.292
NP_442856.1_7 Forward -317 -298 -5.9004 0.289
NP_441668.1_4 Reverse -233 -252 1.27776 0.218
NP_442515.1_1 Reverse -308 -322 -1.37704 0.253
NP_441396.1_1 Forward -108 -89 -1.67217 0.27
NP_441349.1_10 Reverse -299 -318 5.01433 0.0477
NP_442843.1_1 Forward -332 -313 -1.96717 0.202
NP_442843.1_1 Forward -196 -177 -11.7019 0.291
NP_440474.1_8 Reverse -91 -105 3.93223 0.296
NP_441124.1_5 Forward -246 -236 13.9631 0.215
NP_440431.1_3 Reverse -247 -266 -1.47551 0.156
NP_442006.1_2 Forward -206 -189 -17.3657 0.274
NP_440483.1_1 Forward -179 -160 -8.752 0.295
NP_441570.1_1 Reverse -159 -177 0.412472 0.0394
NP_441570.1_1 Reverse -42 -60 -13.9439 0.225
NP_441539.1_1 Reverse -386 -400 11.1104 0.285
NP_441432.1_8 Forward -198 -189 5.60459 0.147
NP_441432.1_8 Reverse -89 -98 4.22796 0.235
NP_441732.1_5 Reverse -13 -27 9.73436 0.291
NP_440759.1_6 Forward -198 -179 -0.000545616 0.284
NP_440578.1_4 Reverse -36 -55 16.1257 0.247
NP_440578.1_7 Forward -289 -270 15.8299 0.198
NP_442298.1_10 Reverse -249 -268 11.1109 0.244
NP_443011.1_4 Forward -273 -254 9.73422 0.217
NP_441072.1_2 Reverse -79 -98 10.6192 0.199
NP_442400.1_10 Reverse -261 -274 7.9876 0.281
NP_442489.1_2 Reverse -37 -56 2.45773 0.262
NP_442489.1_7 Reverse -90 -99 -1.6719 0.235
NP_441659.2_8 Forward -257 -247 2.83163 0.187
NP_440426.1_7 Reverse -94 -113 6.4893 0.207
NP_441800.1_3 Reverse -282 -300 4.6407 0.289
NP_442346.1_5 Reverse -89 -99 10.2065 0.103
NP_442346.1_5 Forward -258 -248 9.61647 0.118
NP_440545.1_3 Reverse -86 -103 4.95539 0.0658
NP_440545.1_3 Forward -261 -244 -3.40274 0.203
NP_441856.1_1 Reverse -78 -97 12.3892 0.162
NP_440010.1_4 Forward -61 -42 2.85027 0.222
NP_440010.1_10 Forward -165 -146 9.93088 0.209
NP_442137.1_6 Reverse -58 -77 16.1257 0.0443
NP_440847.1_3 Reverse -325 -339 13.077 0.224
NP_440847.1_3 Forward -222 -208 11.4053 0.263
NP_441168.1_6 Forward -87 -68 17.109 0.234
NP_440170.1_5 Forward -261 -242 3.93269 0.282
NP_441895.1_10 Forward -330 -311 -27.8282 0.299
NP_442796.1_9 Forward -204 -185 17.3057 0.0856
NP_440671.1_4 Reverse -84 -98 5.50613 0.281
NP_440204.1_7 Reverse -305 -323 14.0805 0.239
NP_442199.1_5 Reverse -240 -259 -5.60541 0.251
NP_442723.1_1 Forward -240 -221 6.78348 0.276
NP_442021.1_3 Reverse -215 -234 -6.1954 0.257
NP_441813.1_7 Reverse -314 -328 9.34041 0.256
NP_441239.1_9 Forward -101 -89 4.16888 0.26
NP_441239.1_9 Reverse -246 -258 3.2839 0.289
NP_441951.1_9 Forward -76 -57 -1.47551 0.295
NP_440156.1_4 Forward -161 -151 9.22267 0.208
NP_441892.1_1 Reverse -81 -98 3.97208 0.117
NP_442643.1_3 Reverse -271 -290 0.58944 0.205
NP_442629.1_3 Forward -328 -309 6.09597 0.272
NP_440833.1_6 Forward -224 -210 17.6985 0.134
NP_442216.1_4 Forward -220 -212 8.1805 0.255
NP_441782.1_7 Forward -140 -121 21.3373 0.0919
NP_440546.1_4 Forward -174 -164 9.56122 0.131
NP_441230.1_5 Forward -62 -43 13.1758 0.0635
NP_442465.1_9 Forward -196 -182 8.45605 0.298
NP_442340.1_3 Forward -55 -36 0.884433 0.15
NP_441497.1_3 Forward -252 -233 -10.227 0.294
NP_441497.1_3 Forward -198 -179 -10.6203 0.294
NP_442499.1_1 Forward -161 -142 4.62101 0.23
NP_440374.1_1 Forward -377 -358 10.2259 0.292
NP_442479.1_9 Reverse -234 -253 -6.09707 0.266
NP_442402.1_4 Reverse -321 -340 -8.26108 0.278
NP_441848.1_4 Reverse -226 -242 8.98304 0.288
NP_440696.1_3 Reverse -188 -206 -2.63579 0.278
NP_441811.1_8 Reverse -84 -98 6.19444 0.283
NP_440825.1_6 Reverse -204 -223 7.37428 0.285
NP_440505.1_3 Forward -132 -122 4.89658 0.257
NP_442360.1_5 Forward -20 -10 12.6647 0.298
NP_441408.2_7 Forward -199 -180 1.86774 0.215
NP_440914.1_1 Forward -197 -187 9.10306 0.186
NP_442533.1_6 Forward -99 -90 5.11294 0.155
NP_442533.1_6 Reverse -248 -257 4.0313 0.194
NP_442541.1_10 Reverse -188 -202 2.75226 0.254
NP_442232.1_3 Reverse -66 -85 0.491109 0.142
NP_442322.1_4 Forward -299 -282 -9.49991 0.295
NP_439944.1_8 Forward -207 -188 14.2574 0.238
NP_442269.1_10 Forward -173 -154 2.45773 0.276
NP_441028.1_6 Reverse -330 -340 3.8145 0.281
NP_441527.1_4 Forward -204 -185 -1.00309 0.146
NP_440007.1_9 Reverse -245 -259 4.32615 0.267
NP_440007.1_9 Reverse -86 -100 1.57289 0.285
NP_441420.1_1 Reverse -95 -114 0.392778 0.214
NP_439903.1_6 Forward -60 -41 0.883656 0.256
NP_442588.1_6 Forward -293 -274 3.34271 0.219
NP_442674.1_3 Reverse -82 -101 12.585 0.174
NP_441479.1_1 Forward -329 -310 8.84924 0.231
NP_441705.1_3 Reverse -207 -226 -6.09707 0.291
NP_440886.1_7 Forward -100 -90 8.04271 0.0805
NP_439899.1_1 Reverse -229 -247 4.28466 0.268
NP_441427.1_6 Reverse -185 -203 9.55725 0.264
NP_440841.1_4 Reverse -46 -65 -4.91709 0.196
NP_442842.1_4 Forward -296 -277 1.17943 0.291
NP_442211.1_3 Forward -53 -34 7.86106 0.275
NP_442794.1_1 Reverse -86 -98 17.1486 0.0232
NP_442467.1_6 Forward -54 -35 14.4533 0.171
NP_441431.1_3 Reverse -214 -233 3.53937 0.265
NP_441431.1_3 Forward -137 -118 2.65439 0.282
NP_442805.1_5 Forward -233 -214 2.6536 0.246
NP_441510.2_2 Forward -85 -66 3.04693 0.272
NP_441311.1_4 Reverse -345 -362 7.11867 0.298
NP_442930.1_1 Reverse -20 -30 10.4026 0.276
NP_442867.1_8 Forward -76 -57 10.8159 0.206
NP_442867.1_8 Reverse -190 -209 4.916 0.277
NP_440801.1_8 Forward -231 -212 8.55425 0.142
NP_440801.1_9 Reverse -186 -200 17.4893 0.227
NP_440801.1_9 Reverse -240 -254 14.8714 0.232
NP_440473.1_3 Reverse -282 -301 16.1257 0.248
NP_440081.1_4 Reverse -228 -247 15.6514 0.231
NP_440524.1_2 Forward -55 -36 -3.63879 0.27
NP_442514.1_5 Reverse -163 -182 -9.73604 0.298
NP_440448.1_4 Forward -371 -352 10.0292 0.225
NP_442862.1_3 Reverse -370 -387 5.05372 0.28
NP_441885.1_5 Reverse -221 -231 -1.78992 0.284
NP_440478.1_9 Forward -101 -82 7.7676 0.28
NP_442341.1_7 Forward -100 -86 5.1128 0.167
NP_442341.1_7 Reverse -286 -300 2.06454 0.271
NP_442341.1_9 Forward -101 -87 10.6187 0.133
NP_441756.1_5 Reverse -334 -353 -5.21209 0.299
NP_440507.2_3 Forward -60 -41 10.7167 0.202
NP_440507.2_3 Forward -327 -308 7.86512 0.268
NP_440091.1_1 Forward -103 -91 4.5622 0.138
NP_441902.1_3 Forward -16 -6 14.9252 0.205
NP_441207.1_7 Reverse -260 -274 10.1267 0.269
NP_440149.1_8 Forward -57 -38 0.687771 0.134
NP_440149.1_8 Reverse -159 -178 -0.000545616 0.143
NP_441105.1_3 Reverse -237 -256 -0.885524 0.143
NP_441105.1_3 Forward -68 -49 -6.98204 0.243
NP_441105.1_3 Reverse -63 -82 -9.34199 0.288
NP_440216.1_9 Forward -195 -186 6.78456 0.289
NP_440172.1_1 Reverse -48 -58 2.7333 0.268
NP_442015.1_10 Reverse -86 -99 5.03416 0.154
NP_442015.1_10 Forward -103 -90 -0.570702 0.272
NP_442015.1_10 Forward -300 -287 -0.669033 0.277
NP_441177.1_2 Forward -161 -142 19.3698 0.147
NP_442116.1_2 Forward -91 -72 18.1898 0.156
NP_442564.1_10 Reverse -10 -24 8.25939 0.296
NP_440988.1_4 Reverse -205 -224 7.47261 0.295
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGAAAAACTGGTCAAAGTCACCGAAGAATGTCTACGCCTAGGCATTGAAGCAGTTAAACCCGGCGGTAAAATTGGTGATATTGGGGCCGCCATTCAAAGCCACGCTGAAGCCCAGGGATTTTCCGTTGTTCGTGATTTTGTTGGCCACGGCATTAGCAAAATTTTCCATACCGCTCCCCAAATTCCCCATTATGGCAAAGCAGGCAAAGGCAAAAGATTACGCCCAGGGATGGTGTTTACCATTGAGCCCATGATCAATGAAGGCACCTGGGAAGCGGTATTACTAGATGATGGTTGGACTGCCATCACCAAGGACGGTAAGCTCTCCGCCCAGTTTGAGCACACCATTGCCGTCACTGAAGATGGAGTGGAAATTTTGACCCTAGGGGAGTAAATACG

CDS

GTGAAAAGTTGGCAAATCGAACTTTTATACGACGGTGAATGTCCCCTTTGTCTGAGGGAAGTTAATTTTCTCCGTAGTAAAGACCAGGGCCGGGGCTTAGTTAACTTTGTGGACATTGCTCAGCCGGACTACAATCCCCTAGACCATGGCGGTGTCAGTTTTGAGGATGCCATGGCCCGTATCCATGGGGTGAAGGCTGACGGCAGTGTGGTAAAAAATGTGGCCGTTTTCCGAGAAGTTTACGAAATTCTCGGTATCGGCTGGCTATATGCTCCCACCCGTTGGCCCATTATCGGACCCTTGGTGGATAGAATTTACGACTTTTGGGCCGATCTCCGTTTGAGCTGGACTGGGCGGTCAAGCCTAGCGGAAATCCTTGCCCAGCGGGAAAAGGGAATGTGTGCCACCGATGGTTGTGCATTGCCGGTTACCAGTGGTGTTGAGGGTAAGCCCTAG

Protein

MKSWQIELLYDGECPLCLREVNFLRSKDQGRGLVNFVDIAQPDYNPLDHGGVSFEDAMARIHGVKADGSVVKNVAVFREVYEILGIGWLYAPTRWPIIGPLVDRIYDFWADLRLSWTGRSSLAEILAQREKGMCATDGCALPVTSGVEGKP