Your browser is old and dusty. Try Google Chrome!

Details for slr0918

ORF slr0918
Accession NP_442396.1
Symbol
Category Protein modification and translation factors
Definition methionine aminopeptidase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -309 -323 -0.0987402 0.221
NP_440557.1_1 Reverse -370 -389 1.86774 0.245
NP_440795.1_7 Forward -377 -370 14.6904 0.0123
NP_440795.1_7 Reverse -370 -377 14.6904 0.0123
NP_442291.1_5 Forward -379 -363 -2.69473 0.225
NP_441453.1_4 Reverse -369 -377 16.539 0.00633
NP_441453.1_4 Forward -378 -370 16.539 0.00633
NP_441453.1_4 Forward -329 -321 4.34598 0.257
NP_441453.1_4 Reverse -320 -328 4.34598 0.257
NP_442151.1_6 Forward -378 -364 16.3225 0.0158
NP_442151.1_6 Reverse -369 -383 8.94771 0.162
NP_441818.1_1 Forward -377 -366 10.1862 0.232
NP_441818.1_6 Reverse -89 -103 9.43936 0.274
NP_440226.1_1 Forward -378 -359 9.83255 0.0687
NP_441465.1_3 Reverse -203 -222 14.5516 0.184
NP_440996.1_3 Reverse -356 -374 12.8022 0.221
NP_442744.1_8 Reverse -221 -240 6.4893 0.152
NP_443002.1_5 Reverse -309 -327 9.55647 0.286
NP_442173.1_1 Forward -377 -369 15.4574 0.00633
NP_442173.1_1 Reverse -370 -378 15.4574 0.00633
NP_442752.1_4 Forward -378 -371 13.8055 0.0199
NP_442752.1_4 Reverse -369 -376 13.8055 0.0199
NP_443027.1_4 Forward -380 -370 5.87989 0.294
NP_443027.1_4 Forward -331 -321 5.87989 0.294
NP_442975.1_10 Forward -382 -368 10.5204 0.0541
NP_442975.1_10 Reverse -365 -379 2.45727 0.274
NP_440784.1_7 Forward -377 -370 15.9687 0.0123
NP_440784.1_7 Reverse -370 -377 15.9687 0.0123
NP_441934.1_8 Reverse -84 -103 10.0292 0.292
NP_440061.1_9 Forward -232 -218 6.39049 0.248
NP_440110.1_8 Reverse -80 -99 -3.24547 0.29
NP_441476.1_5 Reverse -324 -343 -2.85214 0.231
NP_442062.1_8 Reverse -369 -379 19.4496 0.000558
NP_442062.1_8 Forward -378 -368 17.3846 0.00193
NP_442062.1_8 Reverse -320 -330 4.10993 0.232
NP_441859.1_3 Forward -330 -311 1.37531 0.287
NP_440304.1_4 Forward -380 -370 1.84832 0.299
NP_440304.1_4 Reverse -367 -377 1.84832 0.299
NP_442242.1_4 Forward -377 -370 14.3954 0.0124
NP_442242.1_4 Reverse -370 -377 14.3954 0.0124
NP_440044.1_8 Forward -377 -358 9.53756 0.0666
NP_441781.1_7 Reverse -334 -353 6.09597 0.186
NP_441352.1_2 Reverse -355 -374 2.94938 0.222
NP_441200.1_4 Reverse -206 -225 5.40766 0.294
NP_441208.1_9 Reverse -366 -380 4.52282 0.299
NP_441925.1_4 Forward -346 -327 -11.7026 0.253
NP_440856.1_4 Forward -266 -247 -3.14714 0.226
NP_441083.1_5 Forward -378 -368 20.3345 0.00053
NP_441083.1_5 Reverse -369 -379 11.3864 0.0159
NP_441434.1_7 Reverse -371 -385 9.2427 0.209
NP_441738.1_2 Forward -376 -369 15.28 0.0102
NP_441738.1_2 Reverse -371 -378 15.28 0.0102
NP_441558.1_5 Reverse -367 -386 14.0608 0.0523
NP_441558.1_5 Forward -319 -300 4.916 0.267
NP_441558.1_5 Forward -380 -361 3.83436 0.296
NP_441955.1_8 Reverse -314 -331 8.98696 0.258
NP_440209.1_1 Reverse -369 -377 18.1123 0.00295
NP_440209.1_1 Forward -378 -370 18.1123 0.00295
NP_442889.1_8 Forward -381 -367 20.8451 0.00339
NP_442889.1_8 Reverse -366 -380 3.14559 0.287
NP_441770.1_5 Forward -57 -38 -1.7705 0.277
NP_440178.1_7 Forward -379 -360 -22.3217 0.261
NP_440538.1_10 Forward -232 -213 11.6025 0.253
NP_441716.1_1 Forward -230 -216 17.5025 0.0264
NP_441716.1_1 Forward -378 -364 4.42448 0.256
NP_442111.1_4 Reverse -368 -382 9.34103 0.0609
NP_440906.1_5 Forward -377 -370 15.8704 0.0124
NP_440906.1_5 Reverse -370 -377 15.8704 0.0124
NP_440747.1_10 Reverse -366 -378 14.9853 0.00221
NP_440747.1_10 Forward -381 -369 5.34885 0.0141
NP_440747.1_10 Reverse -305 -317 -4.77924 0.117
NP_440747.1_10 Forward -320 -308 -12.4491 0.282
NP_441486.1_1 Reverse -366 -380 22.6157 0.00162
NP_441486.1_1 Forward -381 -367 14.1593 0.00654
NP_441014.1_10 Reverse -368 -387 0.686995 0.239
NP_441012.1_4 Reverse -316 -329 17.0305 0.137
NP_443018.1_3 Forward -377 -370 14.8871 0.0123
NP_443018.1_3 Reverse -370 -377 14.8871 0.0123
NP_443018.1_3 Forward -328 -321 12.5271 0.0523
NP_443018.1_3 Reverse -321 -328 12.5271 0.0523
NP_443018.1_3 Reverse -88 -95 9.38056 0.128
NP_441634.1_8 Reverse -367 -381 -3.04867 0.295
NP_441634.1_8 Forward -226 -212 -3.63866 0.295
NP_440376.1_1 Forward -378 -369 19.4693 0.000692
NP_440376.1_1 Reverse -369 -378 19.4693 0.000692
NP_441588.1_4 Forward -376 -366 18.1713 0.0143
NP_441588.1_4 Reverse -371 -381 14.238 0.0773
NP_442687.1_7 Forward -379 -369 15.8113 0.0125
NP_442687.1_7 Reverse -368 -378 8.92815 0.0994
NP_442687.1_7 Reverse -165 -175 4.0116 0.271
NP_442687.1_7 Forward -231 -221 3.71661 0.292
NP_442485.1_3 Forward -340 -321 -0.787193 0.253
NP_442485.1_3 Reverse -248 -267 -5.40875 0.291
NP_442946.1_7 Reverse -306 -321 11.9367 0.284
NP_441846.1_10 Reverse -250 -269 -21.9284 0.257
NP_441846.1_10 Reverse -261 -280 -22.0267 0.257
NP_442958.1_3 Forward -389 -370 -1.7705 0.29
NP_442658.1_1 Forward -380 -370 15.9091 0.00966
NP_442658.1_1 Reverse -367 -377 6.76441 0.214
NP_442658.1_1 Forward -331 -321 5.97777 0.242
NP_442198.1_3 Reverse -360 -379 10.1275 0.221
NP_442198.1_7 Forward -332 -313 10.815 0.228
NP_440141.1_4 Reverse -269 -288 -10.7186 0.298
NP_440141.1_8 Reverse -320 -339 4.916 0.278
NP_442782.1_2 Reverse -251 -265 9.93102 0.192
NP_442782.1_2 Reverse -210 -224 0.196253 0.293
NP_441414.1_9 Reverse -369 -388 16.8141 0.00979
NP_441414.1_9 Forward -378 -359 -4.32711 0.152
NP_441487.1_9 Forward -379 -360 8.65258 0.102
NP_441256.1_8 Reverse -213 -232 4.22769 0.272
NP_442937.1_5 Reverse -364 -383 11.5042 0.136
NP_441958.1_5 Forward -379 -369 12.2714 0.00183
NP_441958.1_5 Reverse -368 -378 12.2714 0.00183
NP_441127.1_1 Forward -207 -193 8.06273 0.3
NP_439905.1_1 Reverse -370 -383 10.4424 0.216
NP_440984.1_7 Forward -383 -369 21.0424 0.00311
NP_440984.1_7 Reverse -364 -378 5.21113 0.265
NP_441162.1_3 Reverse -340 -359 12.9791 0.181
NP_439990.1_5 Reverse -364 -377 9.95071 0.128
NP_442911.1_2 Forward -388 -369 -4.6221 0.138
NP_442911.1_2 Reverse -359 -378 -8.85033 0.244
NP_440153.1_8 Forward -230 -217 4.34585 0.202
NP_440369.1_5 Reverse -308 -327 10.5209 0.27
NP_442064.1_1 Forward -286 -267 -13.5702 0.293
NP_443055.1_6 Reverse -361 -379 3.55831 0.195
NP_440993.1_3 Forward -237 -218 3.53858 0.181
NP_441099.1_5 Reverse -359 -378 -11.0136 0.27
NP_441099.1_5 Forward -327 -308 -11.3086 0.276
NP_442002.1_9 Forward -379 -372 10.7572 0.185
NP_440809.1_9 Reverse -360 -378 -7.84733 0.225
NP_441294.1_7 Reverse -365 -379 9.25063 0.256
NP_441292.1_2 Reverse -254 -273 -6.1954 0.241
NP_441000.1_6 Forward -379 -365 3.63784 0.108
NP_440147.1_4 Forward -380 -367 12.704 0.0326
NP_440147.1_4 Reverse -367 -380 10.1474 0.0355
NP_440147.1_4 Reverse -306 -319 3.85419 0.179
NP_440147.1_4 Forward -232 -219 0.215946 0.261
NP_441175.1_7 Reverse -369 -388 5.99764 0.265
NP_441550.1_8 Reverse -367 -377 14.6309 0.0132
NP_441550.1_8 Forward -380 -370 8.3377 0.124
NP_441916.1_7 Reverse -369 -379 18.4663 0.00144
NP_441916.1_7 Forward -378 -368 10.3048 0.0261
NP_441916.1_7 Reverse -320 -330 4.50326 0.174
NP_441916.1_7 Forward -329 -319 2.92996 0.235
NP_441916.1_10 Forward -325 -306 1.37609 0.264
NP_440465.1_10 Reverse -263 -282 1.17943 0.283
NP_441041.1_4 Forward -378 -359 0.196116 0.0899
NP_441041.1_4 Reverse -369 -388 -9.34199 0.215
NP_441041.1_4 Forward -329 -310 -10.6203 0.235
NP_441041.1_7 Reverse -366 -378 11.8878 0.0689
NP_441041.1_7 Forward -381 -369 9.55551 0.109
NP_442396.1_1 Forward -306 -288 20.8653 0.0941
NP_442396.1_2 Forward -126 -107 21.7297 0.157
NP_442396.1_5 Forward -382 -369 18.8988 0.0167
NP_442004.1_6 Reverse -215 -229 2.35953 0.266
NP_441725.1_5 Forward -377 -367 2.04498 0.115
NP_441725.1_5 Reverse -370 -380 2.04498 0.115
NP_441725.1_5 Forward -328 -318 0.176696 0.206
NP_439966.1_7 Forward -380 -370 9.91099 0.0968
NP_439966.1_7 Reverse -367 -377 7.25606 0.15
NP_439966.1_7 Forward -221 -211 4.20782 0.285
NP_439966.1_9 Forward -380 -371 0.884706 0.253
NP_442941.1_3 Forward -377 -367 11.0914 0.0116
NP_442941.1_3 Reverse -370 -380 2.63497 0.14
NP_440289.1_2 Forward -381 -368 3.06754 0.0811
NP_440289.1_2 Reverse -366 -379 -2.144 0.251
NP_440260.1_8 Forward -290 -272 -1.25915 0.232
NP_442281.1_1 Forward -383 -369 11.1104 0.0507
NP_442281.1_1 Reverse -364 -378 9.83206 0.0661
NP_442281.1_1 Reverse -315 -329 3.53891 0.228
NP_442281.1_1 Forward -48 -34 3.44058 0.231
NP_442281.1_1 Forward -334 -320 2.94893 0.249
NP_440018.1_3 Reverse -139 -158 9.63589 0.192
NP_442575.1_8 Reverse -266 -285 1.0811 0.222
NP_441058.2_6 Reverse -84 -103 12.1925 0.268
NP_441087.1_6 Forward -281 -263 -2.63651 0.296
NP_440498.1_1 Forward -387 -369 -1.35749 0.223
NP_441644.1_6 Forward -378 -368 17.3841 0.00127
NP_441644.1_6 Reverse -369 -379 10.1076 0.0628
NP_441644.1_6 Forward -230 -220 4.10949 0.249
NP_441644.1_6 Reverse -221 -231 3.42118 0.282
NP_442215.1_2 Reverse -336 -352 11.4649 0.0394
NP_442215.1_2 Forward -380 -364 7.53169 0.0679
NP_442215.1_2 Reverse -367 -383 7.13836 0.0694
NP_442215.1_2 Forward -283 -267 3.40179 0.0967
NP_442029.1_6 Forward -322 -303 5.89931 0.248
NP_442029.1_6 Reverse -353 -372 4.81767 0.261
NP_442029.1_6 Reverse -245 -264 4.32602 0.271
NP_442247.1_8 Reverse -367 -381 8.65272 0.266
NP_440253.1_2 Forward -378 -360 2.77242 0.131
NP_440929.1_8 Forward -378 -369 19.2726 0.000701
NP_440929.1_8 Reverse -369 -378 19.2726 0.000701
NP_442933.1_10 Forward -378 -369 17.601 0.00325
NP_442933.1_10 Reverse -369 -378 17.601 0.00325
NP_442933.1_10 Reverse -320 -329 4.42462 0.246
NP_442933.1_10 Forward -329 -320 4.42462 0.246
NP_441751.2_8 Forward -377 -363 -4.7203 0.179
NP_442926.1_3 Reverse -309 -328 7.96426 0.173
NP_442926.1_3 Reverse -321 -340 1.96607 0.296
NP_442554.1_8 Forward -377 -367 15.3197 0.00882
NP_442554.1_8 Reverse -370 -380 13.2547 0.0187
NP_442554.1_8 Forward -229 -219 6.37155 0.12
NP_442554.1_8 Forward -95 -85 6.37155 0.12
NP_442554.1_8 Forward -328 -318 3.02829 0.245
NP_442554.1_8 Forward -316 -306 2.43831 0.272
NP_442554.1_8 Reverse -321 -331 2.33998 0.274
NP_441762.1_7 Reverse -368 -380 10.1671 0.0142
NP_441762.1_7 Forward -379 -367 9.57708 0.0142
NP_442142.1_4 Reverse -366 -379 13.49 0.0348
NP_442142.1_4 Reverse -317 -330 7.78685 0.13
NP_442142.1_4 Forward -381 -368 4.64028 0.214
NP_442292.1_1 Forward -377 -368 18.486 0.00229
NP_442292.1_1 Reverse -370 -379 9.63616 0.0183
NP_442476.1_6 Reverse -370 -384 12.291 0.0509
NP_440895.1_6 Reverse -363 -376 11.4257 0.202
NP_443009.1_5 Reverse -368 -379 18.3477 0.00265
NP_443009.1_5 Reverse -319 -330 3.8931 0.274
NP_442301.1_8 Reverse -96 -115 11.9958 0.231
NP_441715.1_4 Reverse -370 -380 9.41981 0.097
NP_441715.1_4 Forward -377 -367 7.94484 0.107
NP_441715.1_4 Reverse -77 -87 4.20827 0.292
NP_441448.1_1 Reverse -255 -274 8.06259 0.21
NP_440183.1_9 Reverse -322 -341 -11.2103 0.25
NP_440379.1_5 Reverse -335 -354 -9.53865 0.264
NP_440464.1_10 Forward -377 -367 13.0082 0.169
NP_441468.1_1 Forward -377 -370 15.8704 0.0124
NP_441468.1_1 Reverse -370 -377 15.8704 0.0124
NP_441468.1_1 Reverse -321 -328 3.97235 0.277
NP_441468.1_1 Forward -328 -321 3.97235 0.277
NP_441020.2_6 Reverse -367 -384 11.4452 0.12
NP_441020.2_6 Reverse -259 -276 5.64371 0.293
NP_441015.1_8 Reverse -265 -284 9.63589 0.24
NP_441673.1_1 Forward -378 -369 20.8459 0.000698
NP_441673.1_1 Reverse -369 -378 20.8459 0.000698
NP_441956.1_9 Forward -324 -305 12.1925 0.166
NP_441637.1_8 Forward -294 -277 13.3135 0.197
NP_442490.1_9 Reverse -212 -231 -8.85033 0.295
NP_442868.1_6 Reverse -367 -377 9.81313 0.038
NP_442868.1_6 Forward -380 -370 0.865012 0.205
NP_441612.1_2 Forward -378 -368 8.54929 0.21
NP_442427.1_7 Reverse -56 -75 10.1275 0.239
NP_442808.1_1 Forward -379 -369 18.4657 0.00201
NP_442808.1_1 Reverse -368 -378 8.63269 0.0481
NP_442808.1_1 Forward -360 -350 4.50281 0.197
NP_440145.1_3 Reverse -359 -378 6.68596 0.0509
NP_442820.1_3 Forward -287 -277 18.7607 0.159
NP_442542.1_2 Reverse -263 -276 4.93583 0.29
NP_442050.1_1 Reverse -250 -269 15.2408 0.187
NP_442050.1_5 Reverse -367 -377 7.64939 0.243
NP_440558.1_2 Reverse -305 -324 -0.000545616 0.197
NP_440558.1_2 Reverse -326 -345 -7.67036 0.298
NP_441878.1_6 Forward -379 -369 10.4031 0.0176
NP_441878.1_6 Reverse -368 -378 10.4031 0.0176
NP_441878.1_6 Reverse -319 -329 0.668351 0.139
NP_441878.1_6 Reverse -220 -230 0.668351 0.139
NP_441878.1_6 Forward -231 -221 0.57002 0.14
NP_441878.1_6 Forward -318 -308 -7.49312 0.231
NP_441036.1_8 Forward -379 -369 17.7779 0.000554
NP_441036.1_8 Reverse -368 -378 8.33817 0.174
NP_441557.1_5 Forward -378 -369 19.9609 0.000699
NP_441557.1_5 Reverse -369 -378 19.9609 0.000699
NP_441445.1_1 Reverse -360 -379 19.469 0.0276
NP_441445.1_1 Reverse -212 -231 1.76941 0.247
NP_441590.1_4 Forward -279 -260 5.70185 0.27
NP_442066.2_9 Forward -382 -369 11.4257 0.154
NP_442777.1_1 Forward -336 -317 5.99684 0.27
NP_440738.1_5 Reverse -270 -289 1.67108 0.289
NP_442241.1_2 Reverse -342 -361 4.52268 0.216
NP_440101.1_3 Reverse -261 -280 1.0811 0.284
NP_440101.1_5 Forward -237 -218 0.58944 0.29
NP_441458.1_10 Forward -332 -313 8.45592 0.186
NP_442183.1_1 Reverse -369 -383 5.1128 0.231
NP_441574.1_1 Forward -341 -322 -2.55715 0.226
NP_442494.1_7 Forward -352 -333 0.196116 0.246
NP_442444.1_6 Reverse -93 -111 16.8865 0.165
NP_442347.1_2 Forward -377 -368 12.4878 0.056
NP_442347.1_2 Reverse -370 -379 11.1111 0.056
NP_442645.1_2 Reverse -361 -380 -2.95047 0.0487
NP_442645.1_2 Reverse -213 -232 -4.91709 0.0635
NP_442645.1_2 Forward -386 -367 -12.9802 0.144
NP_442645.1_2 Reverse -300 -319 -17.7001 0.261
NP_441037.1_4 Forward -380 -370 14.7245 0.028
NP_441037.1_4 Reverse -367 -377 7.9999 0.237
NP_442594.1_8 Reverse -203 -222 10.0292 0.184
NP_441633.1_3 Reverse -367 -380 8.57408 0.0377
NP_441633.1_3 Forward -380 -367 3.46087 0.0699
NP_440136.1_2 Forward -377 -370 15.9687 0.0123
NP_440136.1_2 Reverse -370 -377 15.9687 0.0123
NP_442998.1_5 Reverse -277 -287 9.51814 0.238
NP_442998.1_5 Reverse -20 -30 9.32148 0.243
NP_442998.1_10 Forward -376 -369 15.5754 0.0102
NP_442998.1_10 Reverse -371 -378 15.5754 0.0102
NP_440899.1_5 Forward -98 -79 2.75272 0.283
NP_440299.1_1 Forward -382 -369 10.8351 0.0529
NP_440299.1_1 Reverse -316 -329 4.93527 0.193
NP_440299.1_1 Reverse -304 -317 4.83694 0.197
NP_440299.1_1 Reverse -365 -378 4.44361 0.207
NP_441799.1_1 Reverse -365 -379 16.1252 0.0153
NP_441799.1_1 Forward -382 -368 14.5519 0.0228
NP_441799.1_1 Reverse -217 -231 4.22722 0.261
NP_440640.1_6 Reverse -197 -216 0.786102 0.267
NP_441007.1_5 Reverse -321 -340 12.7825 0.203
NP_441007.1_10 Forward -383 -370 1.59258 0.203
NP_442201.1_10 Reverse -358 -377 -12.6852 0.268
NP_442201.1_10 Forward -389 -370 -13.8652 0.278
NP_440256.1_1 Reverse -366 -385 0.687771 0.0814
NP_440256.1_1 Reverse -317 -336 -0.197208 0.0907
NP_440256.1_1 Reverse -305 -324 -8.26035 0.256
NP_441559.1_8 Forward -264 -250 -4.7203 0.236
NP_441559.1_8 Forward -100 -86 -7.17857 0.287
NP_440915.1_6 Reverse -206 -220 -3.24533 0.292
NP_442855.1_3 Forward -326 -307 11.7992 0.257
NP_441179.1_9 Forward -331 -321 13.6475 0.246
NP_441296.1_9 Forward -224 -211 11.4251 0.232
NP_440717.1_3 Forward -218 -204 6.68548 0.298
NP_441464.1_1 Forward -337 -318 10.3242 0.24
NP_441464.1_8 Forward -378 -364 5.89945 0.248
NP_440787.1_5 Forward -386 -372 16.7159 0.174
NP_441939.1_3 Reverse -370 -389 9.24257 0.151
NP_442993.1_1 Forward -378 -362 -8.0046 0.151
NP_442386.1_9 Forward -379 -370 15.7322 0.0144
NP_442386.1_9 Reverse -368 -377 13.8639 0.0289
NP_442386.1_9 Forward -330 -321 13.1756 0.0406
NP_440570.1_5 Forward -327 -308 13.0775 0.123
NP_441750.1_4 Forward -341 -322 8.55425 0.159
NP_441340.1_5 Forward -377 -370 15.6737 0.0124
NP_441340.1_5 Reverse -370 -377 15.6737 0.0124
NP_441340.1_5 Reverse -321 -328 4.07068 0.239
NP_441340.1_5 Forward -328 -321 4.07068 0.239
NP_440186.1_5 Forward -75 -56 18.289 0.261
NP_440327.1_6 Reverse -199 -218 3.14605 0.285
NP_442240.1_1 Forward -282 -263 11.2084 0.192
NP_442714.1_4 Forward -395 -376 18.289 0.0913
NP_441160.1_5 Reverse -358 -377 -6.29373 0.288
NP_440211.1_4 Forward -396 -386 15.123 0.237
NP_440211.1_4 Reverse -355 -365 14.9263 0.258
NP_440586.1_8 Forward -377 -370 13.2151 0.026
NP_440586.1_8 Reverse -370 -377 13.2151 0.026
NP_440586.1_8 Forward -328 -321 7.61025 0.227
NP_440586.1_8 Reverse -321 -328 7.61025 0.227
NP_442251.1_6 Forward -377 -370 15.2804 0.0124
NP_442251.1_6 Reverse -370 -377 15.2804 0.0124
NP_440192.1_4 Forward -292 -273 10.4648 0.237
NP_440684.1_9 Reverse -212 -226 9.34103 0.221
NP_441262.1_3 Reverse -369 -376 14.7888 0.0223
NP_441262.1_3 Forward -378 -371 14.7888 0.0223
NP_440027.1_3 Forward -230 -212 2.18168 0.292
NP_440027.1_8 Forward -223 -204 7.96345 0.252
NP_440027.1_8 Reverse -305 -324 5.99684 0.279
NP_440027.1_8 Reverse -342 -361 4.81688 0.285
NP_443051.1_1 Reverse -368 -377 10.4228 0.00754
NP_443051.1_1 Forward -379 -370 10.4228 0.00754
NP_439937.1_9 Forward -275 -258 -15.7931 0.287
NP_439937.1_9 Forward -379 -362 -16.4814 0.287
NP_439937.1_9 Forward -231 -214 -17.3663 0.298
NP_441595.1_5 Reverse -321 -339 3.65739 0.295
NP_442239.1_8 Reverse -205 -224 8.45592 0.249
NP_439943.1_7 Reverse -292 -311 1.96607 0.299
NP_440372.1_2 Forward -377 -370 16.3621 0.0124
NP_440372.1_2 Reverse -370 -377 16.3621 0.0124
NP_440171.1_3 Reverse -247 -266 3.04771 0.284
NP_440316.1_10 Reverse -243 -253 10.8948 0.218
NP_440316.1_10 Reverse -203 -213 8.63316 0.239
NP_442148.1_1 Forward -113 -94 12.2908 0.294
NP_441803.1_2 Forward -383 -364 1.86774 0.223
NP_440139.1_1 Forward -335 -316 9.63507 0.097
NP_442384.1_10 Reverse -369 -382 14.1789 0.0163
NP_442384.1_10 Forward -378 -365 1.10092 0.268
NP_442384.1_10 Reverse -221 -234 0.314277 0.294
NP_442384.1_10 Forward -230 -217 0.215946 0.297
NP_442235.1_3 Reverse -365 -384 5.211 0.224
NP_442262.1_7 Reverse -367 -386 20.7691 0.16
NP_442262.1_10 Forward -377 -370 14.1988 0.0123
NP_442262.1_10 Reverse -370 -377 14.1988 0.0123
NP_442262.1_10 Forward -328 -321 10.4622 0.145
NP_442262.1_10 Reverse -321 -328 10.4622 0.145
NP_442262.1_10 Reverse -88 -95 9.47889 0.187
NP_441689.1_5 Reverse -367 -377 5.78111 0.197
NP_440344.1_10 Reverse -362 -379 -0.551145 0.0435
NP_440531.1_6 Reverse -361 -380 -4.03212 0.273
NP_440531.1_8 Reverse -261 -280 7.27595 0.23
NP_442910.1_1 Reverse -362 -381 -8.35868 0.291
NP_441640.1_8 Forward -328 -309 -3.14714 0.249
NP_442693.1_7 Reverse -307 -326 11.1109 0.227
NP_440297.1_9 Forward -328 -318 10.5014 0.0917
NP_440297.1_9 Forward -95 -85 0.176696 0.282
NP_440297.1_9 Forward -377 -367 -0.118297 0.282
NP_440297.1_9 Reverse -370 -380 -0.118297 0.282
NP_442280.1_10 Forward -358 -340 7.30503 0.268
NP_442280.1_10 Forward -223 -205 5.94143 0.28
NP_440999.1_9 Forward -382 -368 2.16287 0.154
NP_440888.1_2 Reverse -308 -322 12.9786 0.0354
NP_440888.1_2 Forward -259 -245 10.2254 0.1
NP_440888.1_2 Reverse -369 -383 8.84875 0.145
NP_440888.1_2 Forward -378 -364 8.65209 0.152
NP_440888.1_2 Forward -230 -216 6.78381 0.22
NP_440052.1_5 Forward -389 -370 -0.295539 0.189
NP_442277.1_4 Forward -255 -236 1.17865 0.286
NP_442033.1_10 Forward -262 -243 -9.73531 0.221
NP_441543.1_2 Reverse -370 -379 18.486 0.00236
NP_441543.1_2 Forward -377 -368 16.9127 0.00359
NP_441543.1_3 Forward -222 -208 11.602 0.181
NP_442845.1_2 Reverse -363 -377 9.2427 0.178
NP_442845.1_2 Reverse -215 -229 4.22782 0.264
NP_441551.1_5 Forward -333 -317 5.85938 0.293
NP_441178.1_4 Forward -277 -258 15.7324 0.156
NP_440982.1_1 Forward -359 -340 10.3234 0.212
NP_441469.1_8 Forward -379 -370 16.126 0.00797
NP_441469.1_8 Reverse -368 -377 6.48957 0.227
NP_441469.1_8 Forward -330 -321 5.60459 0.258
NP_443064.1_6 Forward -378 -368 12.5669 0.0796
NP_442337.1_6 Reverse -325 -344 13.544 0.251
NP_442578.1_7 Forward -377 -370 14.5921 0.026
NP_442578.1_7 Reverse -370 -377 14.5921 0.026
NP_440710.1_1 Forward -278 -260 -8.24065 0.261
NP_440071.1_1 Reverse -337 -354 9.47787 0.259
NP_440071.1_6 Forward -300 -286 13.417 0.278
NP_441462.1_2 Forward -378 -368 11.5831 0.00406
NP_441462.1_2 Reverse -369 -379 11.5831 0.00406
NP_443062.1_1 Forward -378 -360 13.4213 0.0627
NP_443062.1_1 Forward -329 -311 3.86557 0.282
NP_443062.1_6 Reverse -361 -380 3.34271 0.239
NP_443062.1_6 Reverse -312 -331 2.85105 0.247
NP_441601.1_2 Reverse -363 -382 -0.688862 0.219
NP_440519.1_3 Forward -82 -63 9.53756 0.276
NP_442204.1_1 Reverse -346 -357 3.59859 0.266
NP_440516.1_8 Forward -378 -369 16.9127 0.00442
NP_440516.1_8 Reverse -369 -378 16.9127 0.00442
NP_442428.1_5 Forward -377 -370 15.8704 0.0124
NP_442428.1_5 Reverse -370 -377 15.8704 0.0124
NP_442428.1_5 Forward -328 -321 4.36568 0.271
NP_442428.1_5 Reverse -321 -328 4.36568 0.271
NP_440818.1_1 Reverse -269 -288 -3.63879 0.276
NP_440618.1_1 Reverse -259 -278 -8.35868 0.282
NP_440673.1_2 Reverse -211 -230 11.5602 0.171
NP_440673.1_2 Forward -388 -369 9.41407 0.245
NP_440673.1_3 Forward -376 -369 12.4288 0.0426
NP_440673.1_3 Reverse -371 -378 12.4288 0.0426
NP_441052.1_2 Forward -378 -368 19.9412 0.00106
NP_441052.1_2 Forward -230 -220 11.4848 0.0285
NP_441052.1_2 Reverse -369 -379 10.5014 0.0285
NP_441052.1_2 Reverse -221 -231 1.25834 0.249
NP_442219.1_9 Forward -377 -368 17.7976 0.00718
NP_442219.1_9 Reverse -370 -379 8.35786 0.0681
NP_440436.1_4 Reverse -370 -379 18.1905 0.00233
NP_440436.1_4 Forward -377 -368 17.2072 0.00233
NP_440436.1_4 Reverse -321 -330 4.42421 0.265
NP_440314.1_9 Forward -377 -358 6.29264 0.0608
NP_440577.1_2 Forward -355 -336 11.3075 0.277
NP_441719.1_4 Forward -377 -370 16.3621 0.0124
NP_441719.1_4 Reverse -370 -377 16.3621 0.0124
NP_441733.1_10 Reverse -366 -379 9.85238 0.106
NP_441733.1_10 Reverse -247 -260 4.93583 0.236
NP_441004.1_1 Forward -323 -304 -3.24547 0.155
NP_441004.1_1 Reverse -245 -264 -3.73712 0.162
NP_441004.1_1 Reverse -260 -279 -8.45701 0.2
NP_441004.1_1 Reverse -160 -179 -17.8968 0.295
NP_441004.1_2 Forward -328 -309 4.03102 0.198
NP_441004.1_4 Reverse -163 -173 8.82982 0.263
NP_441004.1_5 Reverse -162 -176 17.6008 0.183
NP_441004.1_5 Reverse -262 -276 8.55439 0.274
NP_442813.1_4 Forward -162 -143 -9.14533 0.299
NP_442366.1_3 Forward -379 -361 2.77242 0.123
NP_442366.1_5 Reverse -366 -376 14.8275 0.0375
NP_442366.1_5 Forward -381 -371 13.3526 0.0775
NP_440296.1_10 Reverse -95 -114 -14.5535 0.27
NP_441115.1_4 Forward -330 -312 9.85146 0.198
NP_442694.1_4 Forward -289 -280 13.3727 0.225
NP_442206.1_1 Forward -275 -256 -12.9802 0.241
NP_443054.1_2 Forward -380 -366 2.06454 0.245
NP_443054.1_2 Reverse -367 -381 1.76955 0.245
NP_441966.1_7 Reverse -310 -329 -0.984623 0.268
NP_441966.1_8 Reverse -314 -332 -5.58572 0.261
NP_441851.1_10 Forward -379 -369 16.008 0.00552
NP_441851.1_10 Reverse -368 -378 15.8113 0.00552
NP_442622.1_1 Reverse -319 -338 -11.2103 0.257
NP_441668.1_4 Forward -157 -138 -0.787193 0.262
NP_442515.1_1 Reverse -368 -382 6.6861 0.0975
NP_441046.1_2 Reverse -358 -377 8.45592 0.221
NP_441046.1_2 Reverse -210 -229 2.26107 0.241
NP_441349.1_10 Reverse -359 -378 8.16093 0.0281
NP_442314.1_1 Forward -340 -322 -4.70074 0.272
NP_440432.1_9 Reverse -321 -336 2.33984 0.12
NP_440432.1_9 Forward -377 -362 -2.67504 0.175
NP_440432.1_9 Reverse -370 -385 -3.95334 0.194
NP_442843.1_1 Reverse -321 -340 17.3057 0.0745
NP_442843.1_1 Reverse -258 -277 -10.9153 0.282
NP_439960.1_3 Forward -347 -328 0.786102 0.263
NP_441477.1_10 Reverse -214 -232 3.95239 0.21
NP_440431.1_3 Forward -330 -311 -5.40875 0.181
NP_442450.1_5 Reverse -367 -377 7.55152 0.13
NP_442450.1_5 Forward -380 -370 7.55152 0.13
NP_439950.1_1 Reverse -356 -365 17.306 0.145
NP_440040.1_6 Reverse -343 -362 8.94757 0.181
NP_442006.1_2 Forward -338 -321 -17.5624 0.279
NP_442006.1_2 Forward -97 -80 -17.9557 0.285
NP_440483.1_1 Reverse -345 -364 -4.03212 0.218
NP_441078.1_4 Forward -378 -369 19.6659 0.0007
NP_441078.1_4 Reverse -369 -378 19.6659 0.0007
NP_441078.1_4 Reverse -221 -230 -1.47524 0.266
NP_441078.1_4 Forward -317 -308 -1.57357 0.266
NP_441078.1_4 Forward -230 -221 -1.77023 0.266
NP_442729.1_8 Forward -382 -369 10.344 0.125
NP_442388.1_3 Forward -108 -89 5.40766 0.282
NP_442348.1_2 Forward -290 -281 16.0277 0.113
NP_440526.1_3 Forward -377 -366 10.2846 0.0646
NP_441432.1_8 Reverse -368 -377 16.8143 0.00595
NP_441432.1_8 Forward -379 -370 8.25953 0.0755
NP_441432.1_8 Forward -318 -309 5.3096 0.17
NP_441432.1_8 Reverse -220 -229 3.14632 0.259
NP_441333.1_1 Reverse -382 -392 11.4946 0.247
NP_442320.1_8 Reverse -363 -377 6.19444 0.029
NP_442320.1_8 Forward -384 -370 -3.24533 0.113
NP_442344.1_7 Reverse -370 -389 1.96607 0.0647
NP_441732.1_2 Forward -382 -366 -16.7561 0.195
NP_440497.1_2 Forward -358 -339 6.98095 0.249
NP_440290.1_1 Forward -396 -387 17.3727 0.21
NP_440760.1_1 Reverse -369 -388 -11.2103 0.0851
NP_440199.1_10 Reverse -366 -376 7.25653 0.231
NP_440578.1_4 Forward -355 -336 11.6025 0.247
NP_440578.1_10 Forward -289 -270 12.2908 0.246
NP_442407.1_2 Reverse -194 -213 22.2214 0.0514
NP_441072.1_2 Reverse -358 -377 9.3409 0.219
NP_440713.1_4 Forward -354 -335 5.99764 0.198
NP_440713.1_4 Reverse -340 -359 1.76941 0.279
NP_442489.1_7 Forward -378 -369 20.1576 0.000695
NP_442489.1_7 Reverse -369 -378 20.1576 0.000695
NP_442489.1_7 Forward -317 -308 -1.57357 0.213
NP_442489.1_7 Reverse -221 -230 -1.6719 0.235
NP_442489.1_7 Forward -230 -221 -1.77023 0.247
NP_442489.1_7 Reverse -308 -317 -2.06522 0.288
NP_440565.1_7 Reverse -244 -263 -0.295539 0.256
NP_442079.1_7 Forward -328 -309 11.7992 0.0939
NP_442079.1_7 Reverse -321 -340 3.14605 0.212
NP_440559.1_1 Forward -377 -368 17.4043 0.00658
NP_440559.1_1 Reverse -370 -379 8.75118 0.0586
NP_441659.2_8 Forward -378 -368 18.1713 0.00133
NP_441659.2_8 Reverse -369 -379 11.9764 0.0147
NP_441040.1_2 Forward -283 -264 -8.94866 0.236
NP_441040.1_5 Forward -383 -364 2.45773 0.282
NP_441040.1_5 Reverse -303 -322 1.96607 0.295
NP_440708.1_6 Forward -357 -338 -10.1286 0.277
NP_441800.1_3 Forward -328 -310 11.9172 0.266
NP_442776.1_8 Forward -385 -366 13.3716 0.266
NP_441185.1_2 Forward -331 -312 3.14605 0.285
NP_442346.1_5 Reverse -368 -378 16.6963 0.00248
NP_442346.1_5 Reverse -319 -329 13.353 0.0261
NP_442346.1_5 Reverse -220 -230 11.3864 0.0681
NP_442346.1_5 Forward -379 -369 9.02648 0.118
NP_442346.1_5 Forward -330 -320 4.40493 0.29
NP_440352.1_5 Reverse -267 -286 10.125 0.278
NP_440545.1_3 Reverse -365 -382 -7.04099 0.295
NP_440743.1_8 Forward -377 -358 15.8299 0.215
NP_440459.1_2 Reverse -367 -384 9.38028 0.229
NP_440459.1_2 Reverse -263 -280 8.00365 0.272
NP_440459.1_2 Reverse -360 -377 7.41366 0.291
NP_440459.1_2 Reverse -136 -153 7.217 0.299
NP_441653.1_2 Forward -328 -309 4.20605 0.26
NP_442551.1_4 Reverse -219 -234 5.19144 0.241
NP_442875.1_8 Forward -205 -186 14.8474 0.147
NP_441585.1_5 Forward -296 -277 -1.47628 0.298
NP_441888.1_7 Forward -334 -320 10.0294 0.131
NP_441888.1_7 Forward -48 -34 1.47456 0.249
NP_441833.1_4 Forward -377 -370 15.9687 0.0124
NP_441833.1_4 Reverse -370 -377 15.9687 0.0124
NP_441895.1_2 Reverse -340 -359 -26.5499 0.24
NP_441895.1_2 Reverse -341 -360 -26.7466 0.247
NP_442699.1_8 Reverse -270 -289 25.3688 0.000693
NP_442162.1_8 Forward -265 -246 2.55606 0.263
NP_442162.1_9 Forward -377 -370 16.2637 0.0124
NP_442162.1_9 Reverse -370 -377 16.2637 0.0124
NP_440671.1_4 Reverse -314 -328 4.91614 0.3
NP_441973.1_1 Forward -156 -141 0.27489 0.235
NP_441973.1_1 Forward -119 -104 -7.49326 0.293
NP_442140.1_3 Reverse -370 -380 16.2046 0.0255
NP_442140.1_3 Forward -377 -367 12.2714 0.0632
NP_442140.1_3 Reverse -321 -331 9.12481 0.111
NP_442140.1_3 Reverse -88 -98 9.12481 0.111
NP_441609.1_1 Forward -205 -186 -1.86883 0.275
NP_441813.1_5 Forward -380 -370 9.91146 0.021
NP_441813.1_5 Reverse -367 -377 8.63316 0.0367
NP_440590.1_4 Forward -377 -364 11.3273 0.0209
NP_440590.1_4 Reverse -370 -383 8.57408 0.0435
NP_440567.1_1 Reverse -370 -384 5.40779 0.103
NP_440567.1_1 Forward -377 -363 -0.0987402 0.264
NP_442497.1_10 Forward -377 -368 10.4228 0.0087
NP_442497.1_10 Reverse -370 -379 10.4228 0.0087
NP_440821.1_4 Forward -380 -370 10.2065 0.0163
NP_440821.1_4 Reverse -367 -377 9.41981 0.0286
NP_441239.1_9 Forward -380 -368 12.3303 0.0477
NP_441239.1_9 Forward -331 -319 12.1337 0.0494
NP_441239.1_9 Reverse -318 -330 8.6921 0.125
NP_441239.1_9 Reverse -264 -276 8.00379 0.145
NP_441239.1_9 Reverse -367 -379 5.93884 0.202
NP_441239.1_9 Forward -98 -86 3.67722 0.279
NP_441009.1_4 Forward -329 -310 13.0775 0.219
NP_441892.1_1 Forward -98 -81 -4.77938 0.268
NP_442643.1_5 Reverse -372 -391 -2.26216 0.277
NP_442216.1_4 Forward -365 -357 17.6202 0.23
NP_442809.1_6 Reverse -266 -285 0.884433 0.277
NP_440546.1_4 Forward -329 -319 13.0517 0.0572
NP_440546.1_4 Reverse -320 -330 12.0821 0.0679
NP_440546.1_4 Reverse -369 -379 11.8882 0.0679
NP_440546.1_4 Forward -378 -368 10.046 0.109
NP_440546.1_4 Forward -43 -33 7.91294 0.214
NP_440546.1_7 Reverse -87 -97 14.238 0.279
NP_441509.1_10 Forward -117 -98 15.5349 0.295
NP_440462.1_6 Forward -380 -370 9.02648 0.0498
NP_440462.1_6 Reverse -367 -377 1.35667 0.294
NP_442465.1_9 Reverse -23 -37 10.4227 0.291
NP_440868.1_4 Forward -382 -370 10.6587 0.0364
NP_440868.1_4 Reverse -365 -377 5.93884 0.0879
NP_440868.1_6 Reverse -194 -213 13.0775 0.257
NP_441582.1_5 Forward -380 -361 4.12856 0.241
NP_441582.1_5 Reverse -367 -386 2.55527 0.293
NP_441474.1_1 Forward -222 -203 0.490334 0.255
NP_442402.1_4 Forward -374 -355 5.2102 0.144
NP_442402.1_4 Forward -266 -247 -4.03287 0.22
NP_442402.1_10 Forward -29 -19 13.1559 0.204
NP_442402.1_10 Forward -256 -246 11.091 0.269
NP_442258.1_9 Reverse -270 -289 19.9598 0.0828
NP_441084.1_6 Reverse -318 -332 12.9315 0.152
NP_440696.1_3 Reverse -262 -280 4.44404 0.198
NP_442039.1_4 Forward -377 -370 15.1821 0.0124
NP_442039.1_4 Reverse -370 -377 15.1821 0.0124
NP_440825.1_7 Forward -377 -367 12.9096 0.152
NP_440825.1_7 Reverse -370 -380 12.4217 0.155
NP_442837.1_3 Forward -377 -370 15.7721 0.0124
NP_442837.1_3 Reverse -370 -377 15.7721 0.0124
NP_440160.1_2 Forward -226 -207 -2.45882 0.245
NP_440160.1_7 Reverse -308 -327 13.0775 0.224
NP_440160.1_9 Reverse -265 -284 14.9458 0.204
NP_442053.1_1 Forward -378 -369 18.3876 0.0007
NP_442053.1_1 Reverse -369 -378 18.3876 0.0007
NP_440505.1_3 Reverse -367 -377 9.22315 0.122
NP_440505.1_3 Forward -380 -370 6.76487 0.169
NP_441701.1_3 Reverse -98 -115 8.00365 0.254
NP_441959.1_10 Reverse -249 -267 20.5868 0.125
NP_442456.1_5 Reverse -266 -284 7.98396 0.26
NP_440914.1_1 Forward -378 -368 17.5935 0.000537
NP_440914.1_1 Reverse -369 -379 8.6151 0.186
NP_441011.1_8 Reverse -370 -379 16.9127 0.00602
NP_441011.1_8 Forward -377 -368 8.25953 0.144
NP_441011.1_8 Reverse -321 -330 5.01461 0.289
NP_442533.1_1 Reverse -244 -263 -0.295539 0.14
NP_442533.1_1 Reverse -245 -264 -17.2085 0.281
NP_442533.1_6 Forward -378 -369 17.2076 0.00137
NP_442533.1_6 Reverse -369 -378 17.2076 0.00137
NP_442533.1_6 Reverse -221 -230 13.9627 0.0155
NP_442533.1_6 Forward -230 -221 6.68623 0.105
NP_442533.1_6 Forward -329 -320 4.71961 0.177
NP_442533.1_6 Reverse -320 -329 4.71961 0.177
NP_442533.1_6 Reverse -335 -344 2.458 0.255
NP_442533.1_6 Reverse -272 -281 1.86802 0.284
NP_442541.1_10 Reverse -308 -322 3.14559 0.254
NP_442541.1_10 Forward -230 -216 2.94893 0.254
NP_442232.1_3 Reverse -258 -277 -4.42544 0.163
NP_442232.1_3 Reverse -246 -265 -7.08038 0.194
NP_442322.1_4 Forward -227 -210 0.0381458 0.21
NP_442229.1_1 Forward -380 -366 11.1104 0.18
NP_442229.1_1 Reverse -367 -381 8.84875 0.184
NP_441482.1_7 Forward -384 -370 -10.7185 0.213
NP_439944.1_9 Forward -377 -367 10.5014 0.0887
NP_441028.1_6 Forward -284 -274 5.78111 0.243
NP_442202.1_10 Reverse -86 -100 4.12949 0.278
NP_442664.1_3 Reverse -322 -336 11.8976 0.249
NP_440116.1_8 Forward -377 -358 -4.81876 0.18
NP_440116.1_8 Forward -328 -309 -8.85033 0.261
NP_439965.1_2 Forward -361 -342 7.66927 0.257
NP_441059.1_2 Reverse -250 -269 -4.91709 0.245
NP_441602.1_3 Forward -280 -261 4.42435 0.153
NP_441602.1_3 Reverse -245 -264 -2.85214 0.239
NP_441972.1_5 Forward -377 -358 -4.6221 0.211
NP_441972.1_5 Reverse -81 -100 -7.4737 0.249
NP_441106.1_1 Forward -379 -370 18.191 0.0028
NP_441106.1_1 Reverse -368 -377 9.63616 0.0311
NP_441106.1_1 Forward -330 -321 4.32629 0.227
NP_442249.1_9 Reverse -69 -88 13.5691 0.281
NP_441286.1_1 Reverse -368 -380 6.03717 0.0258
NP_441286.1_1 Forward -379 -367 3.38223 0.0467
NP_442674.1_3 Forward -331 -312 19.8614 0.141
NP_440670.1_8 Forward -378 -369 18.3876 0.000699
NP_440670.1_8 Reverse -369 -378 18.3876 0.000699
NP_440670.1_8 Reverse -265 -274 3.53964 0.257
NP_440886.1_7 Forward -379 -369 17.7774 0.0011
NP_440886.1_7 Forward -360 -350 9.616 0.0805
NP_440886.1_7 Reverse -368 -378 7.94438 0.0805
NP_440828.1_1 Forward -222 -203 2.6536 0.231
NP_440460.1_10 Reverse -307 -326 16.4207 0.234
NP_441399.1_10 Reverse -247 -266 12.7825 0.258
NP_442072.1_9 Reverse -368 -386 -4.11075 0.041
NP_442072.1_9 Forward -379 -361 -20.532 0.204
NP_442213.1_5 Forward -354 -335 4.32602 0.231
NP_440907.2_8 Reverse -370 -380 14.2375 0.0312
NP_440907.2_8 Forward -377 -367 7.64939 0.117
NP_441021.1_1 Reverse -309 -328 8.55425 0.0482
NP_442459.1_7 Forward -42 -23 -0.885524 0.277
NP_441463.1_3 Forward -164 -145 -8.85033 0.274
NP_441463.1_3 Reverse -359 -378 -9.73531 0.284
NP_441626.1_2 Forward -377 -370 15.7721 0.0124
NP_441626.1_2 Reverse -370 -377 15.7721 0.0124
NP_442238.1_3 Forward -323 -304 5.80098 0.254
NP_442794.1_1 Forward -321 -309 10.7571 0.0721
NP_442794.1_1 Reverse -365 -377 2.69391 0.286
NP_442615.1_1 Reverse -360 -378 12.8022 0.0126
NP_442615.1_1 Forward -387 -369 11.8189 0.0163
NP_441962.1_4 Reverse -216 -235 -9.24366 0.215
NP_441962.1_4 Forward -343 -324 -10.1286 0.224
NP_440387.1_1 Reverse -369 -385 12.4482 0.0122
NP_440855.1_5 Forward -325 -306 3.73524 0.287
NP_441431.1_2 Forward -99 -85 11.5037 0.136
NP_441431.1_2 Forward -381 -367 8.16044 0.222
NP_441431.1_2 Reverse -366 -380 5.99717 0.281
NP_441488.1_8 Forward -115 -101 9.14375 0.168
NP_441836.1_2 Forward -236 -217 -3.93378 0.247
NP_441836.1_2 Reverse -209 -228 -5.31042 0.277
NP_441836.1_2 Reverse -106 -125 -6.09707 0.291
NP_440814.1_4 Reverse -360 -379 -12.0953 0.229
NP_440467.1_3 Forward -328 -309 13.4048 0.197
NP_440467.1_3 Forward -274 -255 11.0609 0.284
NP_440467.1_8 Forward -341 -322 12.7825 0.204
NP_440114.1_10 Reverse -369 -383 11.111 0.125
NP_440114.1_10 Forward -378 -364 7.9644 0.219
NP_442698.1_10 Reverse -217 -236 14.0608 0.231
NP_440287.1_6 Reverse -360 -379 0.0977854 0.298
NP_440293.1_3 Reverse -203 -222 -2.65548 0.241
NP_441237.1_9 Forward -377 -367 14.828 0.0242
NP_442743.1_4 Reverse -238 -257 -5.50708 0.263
NP_439910.1_2 Reverse -361 -378 6.23369 0.0159
NP_439910.1_2 Forward -386 -369 -13.5308 0.162
NP_442278.1_3 Reverse -64 -82 13.741 0.256
NP_440798.1_6 Reverse -370 -383 5.91914 0.14
NP_440798.1_6 Forward -95 -82 0.412608 0.267
NP_441801.1_4 Forward -217 -207 12.3697 0.201
NP_440942.1_9 Reverse -270 -289 10.815 0.174
NP_440142.1_7 Forward -95 -76 5.50599 0.287
NP_441332.1_6 Forward -360 -350 14.1639 0.158
NP_441332.1_6 Reverse -339 -349 11.0659 0.277
NP_441436.1_2 Reverse -247 -266 -1.57384 0.28
NP_441436.1_8 Reverse -250 -269 11.0125 0.262
NP_440473.1_9 Reverse -85 -104 -9.44032 0.26
NP_442509.1_9 Reverse -369 -379 16.2041 0.00739
NP_442509.1_9 Forward -378 -368 8.14104 0.192
NP_440554.1_4 Reverse -370 -380 7.35486 0.103
NP_440554.1_4 Reverse -321 -331 5.87989 0.129
NP_441885.1_5 Forward -378 -368 20.9245 0.000538
NP_441885.1_5 Reverse -369 -379 11.4848 0.00668
NP_441885.1_5 Reverse -335 -345 -1.59326 0.273
NP_440478.1_9 Reverse -312 -331 8.35759 0.27
NP_442341.1_7 Reverse -368 -382 15.3392 0.0229
NP_442341.1_7 Forward -379 -365 8.35772 0.0881
NP_442341.1_7 Reverse -220 -234 4.52282 0.188
NP_442341.1_7 Reverse -196 -210 1.96621 0.274
NP_442341.1_9 Forward -380 -366 16.0269 0.0394
NP_441173.1_9 Reverse -58 -66 12.9004 0.206
NP_443000.1_7 Reverse -367 -377 10.3048 0.0345
NP_443000.1_7 Forward -380 -370 1.94665 0.226
NP_440275.1_3 Forward -380 -370 8.33817 0.0602
NP_440275.1_3 Reverse -367 -377 8.04317 0.0602
NP_440091.1_1 Reverse -365 -377 8.88877 0.0567
NP_441105.1_3 Forward -286 -267 -6.68705 0.239
NP_441105.1_3 Forward -328 -309 -9.63698 0.292
NP_442373.1_10 Reverse -308 -327 9.93088 0.13
NP_440216.1_1 Reverse -369 -383 7.37441 0.00942
NP_440216.1_1 Forward -378 -364 -1.67204 0.0355
NP_440172.1_1 Forward -378 -368 15.0247 0.00945
NP_440172.1_1 Reverse -369 -379 8.73149 0.0586
NP_442015.1_10 Forward -382 -369 1.69091 0.204
NP_442015.1_10 Reverse -365 -378 1.59258 0.204
NP_441226.1_7 Forward -377 -370 14.4934 0.0123
NP_441226.1_7 Reverse -370 -377 14.4934 0.0123
NP_441111.1_7 Forward -377 -369 18.7023 0.00294
NP_441111.1_7 Reverse -370 -378 18.7023 0.00294
NP_441766.1_2 Forward -378 -369 17.5026 0.00297
NP_441766.1_2 Reverse -369 -378 17.5026 0.00297
NP_442417.1_5 Reverse -369 -383 8.84938 0.145
NP_440416.1_9 Forward -282 -263 -1.57384 0.0652
NP_443052.1_8 Reverse -359 -378 -1.96717 0.085
NP_442154.1_1 Reverse -321 -339 1.10079 0.0962
NP_442226.1_8 Reverse -387 -397 14.1397 0.26
NP_440261.1_5 Reverse -370 -383 -0.865694 0.0655
NP_440261.1_5 Forward -377 -364 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTCTGACAAAATTAAACTTTCGGCGATCGCCAATTAATTCCCCCATCCTCTGGGTAGGGGCCGCCAATCCAGCCATGGCTCTGGAAATGGCCAAGCATTTACGAGAACAGGGCATTTTTGCCCCGGCCATTCGTCCCCCCACGGTTCCCCACAGTCGAATACGTTTTTCGGTCATGGCCACCCACTCCCCAGGGCACATTGACCAACTATTAGAAGTACTGGACCACTATTACCCCAATTAGAGTTGCCTTTGACGGTGCATAGTTGTCAGTCTCCCTACTTACCCCTTGAACATCACATCCCCGCCATGGGACAGTGAACTCAGTAGAGGTTTTGGTTAAACTGAAAGTGAAACCAGCCATATCTTTTGATTTTTCACAGTAAGAGTAAGCATTATCA

CDS

ATGGGCGACACTATTACCCTCCTTTCCCGCCGAGAAATAGAAAAAATGCGGCAGGCGGGCCAACTAGCGGCGGCCCTACTTGATCACCTAGCGCCAATGGTGCAACCGGGCATAACTACCCTAGAGCTGAATGACGAAGCGGAAAAATGGACGAAAGCCCACGGAGCCATCAGCGCCCCCCTTGGTTATAACGGTTTCCCCAAGTCTATTTGCACCAGCATCAATGAAGTTATCTGCCATGGCATTCCCCACCGCAAACGGGTATTGCAGGCAGGAGACATCATCAACGTTGACGTTACCCCCATTGTGGACGGCTACCATGGCGACTGTTCCCGCACCTTTTTTGTCGGTACTCCCAGCCCAGTGGCAGAAAAACTGGTCAAAGTCACCGAAGAATGTCTACGCCTAGGCATTGAAGCAGTTAAACCCGGCGGTAAAATTGGTGATATTGGGGCCGCCATTCAAAGCCACGCTGAAGCCCAGGGATTTTCCGTTGTTCGTGATTTTGTTGGCCACGGCATTAGCAAAATTTTCCATACCGCTCCCCAAATTCCCCATTATGGCAAAGCAGGCAAAGGCAAAAGATTACGCCCAGGGATGGTGTTTACCATTGAGCCCATGATCAATGAAGGCACCTGGGAAGCGGTATTACTAGATGATGGTTGGACTGCCATCACCAAGGACGGTAAGCTCTCCGCCCAGTTTGAGCACACCATTGCCGTCACTGAAGATGGAGTGGAAATTTTGACCCTAGGGGAGTAA

Protein

MGDTITLLSRREIEKMRQAGQLAAALLDHLAPMVQPGITTLELNDEAEKWTKAHGAISAPLGYNGFPKSICTSINEVICHGIPHRKRVLQAGDIINVDVTPIVDGYHGDCSRTFFVGTPSPVAEKLVKVTEECLRLGIEAVKPGGKIGDIGAAIQSHAEAQGFSVVRDFVGHGISKIFHTAPQIPHYGKAGKGKRLRPGMVFTIEPMINEGTWEAVLLDDGWTAITKDGKLSAQFEHTIAVTEDGVEILTLGE