Your browser is old and dusty. Try Google Chrome!

Details for slr0906

ORF slr0906
Accession NP_442388.1
Symbol psbB
Category Photosystem II
Definition photosystem II core light harvesting protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -281 -295 14.4542 0.0392
NP_441061.1_2 Forward -249 -235 9.5377 0.0722
NP_441061.1_2 Forward -282 -268 3.73617 0.16
NP_440795.1_7 Forward -282 -275 14.6904 0.0123
NP_440795.1_7 Reverse -275 -282 14.6904 0.0123
NP_441418.1_6 Reverse -274 -293 -19.5684 0.0906
NP_442291.1_5 Forward -284 -268 16.6765 0.0199
NP_442291.1_5 Reverse -273 -289 -4.07137 0.263
NP_441453.1_4 Reverse -274 -282 16.539 0.00633
NP_441453.1_4 Forward -283 -275 16.539 0.00633
NP_441623.1_1 Reverse -382 -400 -3.12744 0.256
NP_442151.1_6 Reverse -274 -288 18.2892 0.00782
NP_441818.1_1 Forward -282 -271 18.446 0.0046
NP_441818.1_1 Reverse -275 -286 8.51463 0.288
NP_440226.1_1 Forward -283 -264 4.52268 0.188
NP_441630.1_3 Reverse -266 -285 0.196116 0.283
NP_442655.1_1 Reverse -269 -288 12.7825 0.0847
NP_443002.1_5 Reverse -281 -299 7.98318 0.299
NP_442173.1_1 Forward -282 -274 15.4574 0.00633
NP_442173.1_1 Reverse -275 -283 15.4574 0.00633
NP_442752.1_4 Forward -283 -276 13.8055 0.0199
NP_442752.1_4 Reverse -274 -281 13.8055 0.0199
NP_442752.1_4 Reverse -345 -352 10.8555 0.0846
NP_442752.1_4 Reverse -204 -211 5.54565 0.194
NP_443027.1_4 Reverse -272 -282 11.0914 0.107
NP_442975.1_10 Forward -287 -273 11.307 0.0508
NP_440784.1_7 Forward -282 -275 15.9687 0.0123
NP_440784.1_7 Reverse -275 -282 15.9687 0.0123
NP_442861.1_4 Reverse -126 -145 -1.08295 0.297
NP_441337.1_1 Reverse -149 -168 17.994 0.12
NP_440061.1_9 Forward -356 -342 5.99717 0.264
NP_440061.1_9 Reverse -272 -286 5.50552 0.283
NP_442062.1_8 Reverse -274 -284 17.6796 0.00193
NP_442062.1_8 Forward -283 -273 17.3846 0.00193
NP_442974.1_10 Reverse -187 -206 20.4514 0.16
NP_441859.1_3 Forward -355 -336 1.6703 0.278
NP_440304.1_4 Forward -285 -275 9.91146 0.051
NP_440304.1_4 Reverse -272 -282 1.84832 0.299
NP_442242.1_4 Forward -282 -275 14.3954 0.0124
NP_442242.1_4 Reverse -275 -282 14.3954 0.0124
NP_441781.1_7 Reverse -274 -293 4.71934 0.186
NP_441781.1_7 Forward -220 -201 2.45773 0.206
NP_441208.1_9 Forward -286 -272 5.21113 0.275
NP_442196.1_10 Reverse -272 -291 15.2408 0.149
NP_442110.1_7 Reverse -274 -288 2.5562 0.222
NP_441083.1_5 Forward -283 -273 20.3345 0.00053
NP_441083.1_5 Reverse -274 -284 19.3512 0.000718
NP_441434.1_3 Forward -253 -234 0.0977854 0.222
NP_441434.1_7 Reverse -276 -290 4.62115 0.225
NP_441738.1_2 Forward -281 -274 15.28 0.0102
NP_441738.1_2 Reverse -276 -283 15.28 0.0102
NP_441558.1_5 Reverse -272 -291 10.1275 0.105
NP_440209.1_1 Reverse -274 -282 18.1123 0.00295
NP_440209.1_1 Forward -283 -275 18.1123 0.00295
NP_442136.1_1 Forward -177 -158 21.8289 0.072
NP_442889.1_8 Forward -286 -272 10.717 0.0797
NP_442889.1_8 Reverse -271 -285 4.91554 0.247
NP_440178.1_7 Forward -284 -265 -12.5869 0.121
NP_440178.1_7 Reverse -273 -292 -22.0267 0.249
NP_441989.1_1 Forward -110 -91 14.5524 0.259
NP_442570.1_3 Reverse -272 -291 -8.94866 0.294
NP_442445.1_1 Reverse -199 -218 17.7974 0.122
NP_441716.1_1 Forward -283 -269 8.45605 0.141
NP_442111.1_4 Reverse -273 -287 11.3077 0.0514
NP_441163.1_1 Reverse -273 -290 5.053 0.281
NP_440906.1_5 Forward -282 -275 15.8704 0.0124
NP_440906.1_5 Reverse -275 -282 15.8704 0.0124
NP_440747.1_10 Reverse -271 -283 16.8536 0.00143
NP_440747.1_10 Forward -286 -274 5.54551 0.0128
NP_440747.1_10 Reverse -201 -213 -12.0557 0.199
NP_441130.1_10 Forward -285 -271 8.25939 0.139
NP_441130.1_10 Reverse -272 -286 6.6861 0.181
NP_441486.1_1 Reverse -271 -285 15.4376 0.00596
NP_441486.1_1 Forward -286 -272 5.70279 0.0351
NP_440403.1_4 Reverse -265 -284 -8.65367 0.26
NP_440403.1_10 Forward -292 -273 7.96426 0.205
NP_440057.1_6 Forward -171 -152 11.75 0.289
NP_441014.1_5 Forward -255 -237 10.1472 0.267
NP_442848.1_1 Reverse -268 -282 -2.26202 0.263
NP_442848.1_5 Reverse -260 -278 0.412472 0.276
NP_443018.1_3 Forward -282 -275 14.8871 0.0123
NP_443018.1_3 Reverse -275 -282 14.8871 0.0123
NP_443018.1_3 Reverse -282 -289 9.38056 0.128
NP_441634.1_1 Forward -295 -276 -2.45882 0.275
NP_441634.1_8 Reverse -272 -286 5.01447 0.114
NP_440376.1_1 Forward -283 -274 19.4693 0.000692
NP_440376.1_1 Reverse -274 -283 19.4693 0.000692
NP_440376.1_1 Reverse -204 -213 11.3078 0.0259
NP_440376.1_1 Reverse -241 -250 3.34298 0.206
NP_441588.1_4 Reverse -276 -286 9.22315 0.14
NP_441588.1_4 Forward -281 -271 8.73149 0.14
NP_442687.1_7 Forward -284 -274 18.5646 0.0028
NP_442687.1_7 Reverse -273 -283 8.92815 0.0994
NP_442485.1_3 Forward -294 -275 -4.32711 0.28
NP_442658.1_1 Forward -285 -275 14.8275 0.0188
NP_442658.1_1 Reverse -272 -282 7.94438 0.199
NP_441855.2_4 Forward -291 -272 15.1147 0.135
NP_441414.1_9 Forward -283 -264 -7.86702 0.227
NP_442937.1_5 Reverse -269 -288 10.2259 0.168
NP_441958.1_5 Forward -284 -274 20.5312 0.000966
NP_441958.1_5 Reverse -273 -283 12.2714 0.00183
NP_441958.1_5 Reverse -203 -213 -0.511621 0.208
NP_442836.1_5 Forward -289 -270 12.0942 0.0822
NP_442836.1_5 Reverse -268 -287 3.14605 0.243
NP_443001.1_7 Reverse -275 -294 3.34271 0.279
NP_440984.1_7 Forward -288 -274 8.75105 0.137
NP_440984.1_7 Reverse -269 -283 5.60446 0.248
NP_441097.1_2 Forward -373 -356 5.84037 0.257
NP_439990.1_5 Forward -314 -301 9.45906 0.142
NP_441580.1_6 Forward -294 -275 5.99764 0.117
NP_440153.1_5 Forward -282 -268 7.66941 0.154
NP_441348.1_3 Reverse -295 -314 13.0775 0.138
NP_441099.1_5 Forward -293 -274 7.07928 0.0429
NP_441099.1_5 Reverse -264 -283 4.62101 0.0483
NP_442002.1_9 Forward -284 -277 14.1004 0.074
NP_441294.1_7 Forward -287 -273 19.1375 0.00332
NP_441294.1_7 Reverse -270 -284 13.2821 0.0711
NP_441646.1_1 Forward -257 -238 15.8307 0.0796
NP_441646.1_1 Reverse -236 -255 1.37609 0.231
NP_442438.1_10 Forward -288 -274 -0.787057 0.279
NP_442431.1_10 Reverse -330 -348 6.31233 0.194
NP_441000.1_6 Forward -284 -270 14.3559 0.0396
NP_442771.1_1 Forward -251 -233 -7.84733 0.173
NP_440147.1_4 Forward -285 -272 20.8655 0.0018
NP_440147.1_4 Reverse -272 -285 9.06573 0.0437
NP_441550.1_8 Forward -285 -275 17.6791 0.00754
NP_441550.1_8 Reverse -272 -282 15.1225 0.0132
NP_441916.1_7 Reverse -274 -284 16.893 0.00407
NP_441916.1_7 Forward -283 -273 10.3048 0.0261
NP_441916.1_10 Reverse -266 -285 3.04771 0.236
NP_441041.1_4 Reverse -274 -293 -11.0136 0.239
NP_441041.1_7 Forward -286 -274 21.314 0.00104
NP_441041.1_7 Reverse -271 -283 10.8188 0.0864
NP_442396.1_5 Reverse -368 -381 8.9674 0.139
NP_441725.1_5 Reverse -275 -285 11.7798 0.0247
NP_441725.1_5 Forward -282 -272 2.04498 0.115
NP_439966.1_7 Reverse -272 -282 15.3192 0.0152
NP_442941.1_3 Forward -282 -272 19.2529 0.00262
NP_442941.1_3 Reverse -275 -285 2.53664 0.14
NP_440289.1_2 Reverse -271 -284 15.4572 0.0107
NP_440289.1_2 Forward -286 -273 13.884 0.0123
NP_442281.1_1 Forward -288 -274 20.9434 0.00192
NP_442281.1_1 Reverse -269 -283 17.5018 0.00555
NP_441334.1_7 Forward -306 -287 -15.6352 0.275
NP_442256.1_2 Reverse -272 -290 -7.35568 0.214
NP_442256.1_2 Forward -285 -267 -9.61729 0.281
NP_440437.1_1 Forward -289 -270 4.81767 0.0958
NP_442012.1_5 Reverse -204 -223 2.3594 0.269
NP_442982.1_5 Reverse -290 -309 -2.65548 0.287
NP_441644.1_6 Forward -283 -273 17.3841 0.00127
NP_441644.1_6 Reverse -274 -284 15.7125 0.0048
NP_441644.1_6 Reverse -281 -291 8.23937 0.104
NP_441644.1_6 Forward -345 -335 5.09279 0.21
NP_441644.1_6 Forward -220 -210 3.71617 0.267
NP_442215.1_2 Reverse -272 -288 19.3314 0.00997
NP_442029.1_6 Reverse -295 -314 2.45773 0.296
NP_440253.1_2 Forward -283 -265 15.4571 0.0158
NP_440929.1_8 Forward -283 -274 19.2726 0.000701
NP_440929.1_8 Reverse -274 -283 19.2726 0.000701
NP_442933.1_10 Forward -283 -274 17.601 0.00325
NP_442933.1_10 Reverse -274 -283 17.601 0.00325
NP_441751.2_8 Forward -282 -268 13.9626 0.0133
NP_441751.2_8 Reverse -275 -289 -2.85201 0.134
NP_442554.1_8 Forward -282 -272 16.2046 0.0065
NP_442554.1_8 Reverse -275 -285 14.238 0.0144
NP_442554.1_8 Forward -289 -279 8.73149 0.0682
NP_441762.1_7 Forward -284 -272 1.80894 0.0735
NP_441762.1_7 Reverse -273 -285 0.333971 0.0747
NP_442142.1_4 Forward -286 -273 10.6384 0.0697
NP_442142.1_4 Reverse -303 -316 8.08184 0.124
NP_442142.1_4 Forward -293 -280 7.2952 0.143
NP_442142.1_4 Reverse -271 -284 5.52525 0.188
NP_442292.1_1 Forward -282 -273 18.486 0.00229
NP_442292.1_1 Reverse -275 -284 9.53783 0.0183
NP_442292.1_5 Reverse -270 -289 -0.197208 0.257
NP_440895.1_6 Reverse -330 -343 14.6706 0.202
NP_442381.1_8 Forward -286 -267 -15.0452 0.292
NP_443009.1_5 Reverse -273 -284 15.7911 0.0107
NP_443009.1_5 Forward -284 -273 11.1696 0.066
NP_443009.1_5 Forward -310 -299 6.05637 0.177
NP_441865.1_3 Reverse -38 -56 12.5072 0.287
NP_441715.1_4 Forward -282 -272 17.3846 0.0106
NP_441198.1_8 Forward -285 -275 12.5877 0.12
NP_441198.1_8 Reverse -298 -308 12.2947 0.144
NP_441468.1_1 Forward -282 -275 15.8704 0.0124
NP_441468.1_1 Reverse -275 -282 15.8704 0.0124
NP_441015.1_10 Reverse -331 -350 -3.63879 0.19
NP_441015.1_10 Reverse -199 -218 -7.27704 0.265
NP_441673.1_1 Forward -283 -274 20.8459 0.000698
NP_441673.1_1 Reverse -274 -283 20.8459 0.000698
NP_441826.1_2 Forward -289 -275 15.5359 0.0196
NP_441826.1_2 Reverse -268 -282 4.12949 0.105
NP_441764.1_8 Forward -133 -123 11.3107 0.284
NP_441764.1_8 Forward -60 -50 11.1193 0.287
NP_442868.1_6 Reverse -272 -282 19.2529 0.00563
NP_442868.1_6 Forward -285 -275 9.12481 0.0539
NP_442719.1_2 Reverse -123 -141 -6.86472 0.23
NP_442719.1_2 Reverse -124 -142 -10.208 0.271
NP_441056.1_1 Reverse -274 -293 -0.787193 0.166
NP_441612.1_2 Forward -283 -273 8.54929 0.21
NP_442227.1_2 Forward -352 -333 7.17762 0.198
NP_442227.1_2 Forward -349 -330 -0.885524 0.26
NP_440789.1_1 Forward -176 -157 16.0265 0.191
NP_442808.1_1 Forward -284 -274 8.73102 0.0481
NP_442808.1_1 Reverse -273 -283 8.63269 0.0481
NP_440918.1_2 Forward -120 -101 17.2074 0.233
NP_440145.1_3 Reverse -264 -283 7.66927 0.0466
NP_442542.1_2 Forward -285 -272 10.934 0.117
NP_442050.1_5 Reverse -272 -282 14.3359 0.0206
NP_442050.1_5 Forward -285 -275 6.96107 0.27
NP_442903.1_2 Forward -65 -46 9.7875 0.165
NP_440558.1_2 Reverse -297 -316 -7.17871 0.289
NP_441518.1_3 Reverse -264 -283 -3.73712 0.114
NP_441518.1_3 Reverse -379 -398 -12.5869 0.263
NP_441878.1_6 Forward -284 -274 20.2362 0.0046
NP_441878.1_6 Reverse -273 -283 10.4031 0.0176
NP_441878.1_6 Forward -291 -281 0.668351 0.139
NP_441878.1_6 Forward -316 -306 -0.0199663 0.163
NP_441878.1_10 Reverse -178 -192 11.0127 0.289
NP_441036.1_8 Forward -284 -274 8.4365 0.174
NP_441036.1_8 Reverse -273 -283 8.33817 0.174
NP_441557.1_5 Forward -283 -274 19.9609 0.000699
NP_441557.1_5 Reverse -274 -283 19.9609 0.000699
NP_442066.2_4 Reverse -274 -293 -3.04881 0.215
NP_442066.2_9 Reverse -270 -283 8.47575 0.185
NP_442183.1_1 Forward -283 -269 7.76774 0.131
NP_442397.1_9 Reverse -274 -293 4.62101 0.254
NP_441459.1_2 Forward -209 -190 16.7157 0.193
NP_439980.1_1 Reverse -325 -344 15.9226 0.263
NP_441574.1_5 Forward -29 -10 9.43923 0.242
NP_441549.1_9 Reverse -237 -255 -4.11075 0.198
NP_442170.1_5 Forward -283 -264 0.392778 0.224
NP_442347.1_2 Forward -282 -273 12.4878 0.056
NP_442347.1_2 Reverse -275 -284 3.34298 0.284
NP_442645.1_2 Reverse -266 -285 -5.31042 0.0661
NP_442645.1_2 Reverse -298 -317 -15.0452 0.189
NP_442888.1_6 Reverse -263 -282 4.916 0.228
NP_441037.1_4 Forward -285 -275 17.3558 0.0127
NP_442594.1_8 Reverse -160 -179 3.14605 0.288
NP_442594.1_9 Forward -196 -177 7.57013 0.242
NP_441633.1_3 Reverse -272 -285 12.9006 0.0192
NP_441633.1_3 Forward -356 -343 -4.40561 0.195
NP_441633.1_3 Forward -285 -272 -5.97891 0.236
NP_440136.1_2 Forward -282 -275 15.9687 0.0123
NP_440136.1_2 Reverse -275 -282 15.9687 0.0123
NP_442590.1_10 Reverse -274 -293 16.4207 0.113
NP_442998.1_5 Forward -134 -124 8.92815 0.26
NP_442998.1_10 Forward -281 -274 15.5754 0.0102
NP_442998.1_10 Reverse -276 -283 15.5754 0.0102
NP_440899.1_2 Forward -294 -275 13.9616 0.0996
NP_440299.1_1 Forward -287 -274 10.8351 0.0529
NP_440299.1_1 Reverse -270 -283 2.37867 0.291
NP_441799.1_1 Forward -287 -273 7.96378 0.128
NP_441799.1_1 Reverse -270 -284 4.71887 0.238
NP_441007.1_10 Forward -288 -275 0.904263 0.212
NP_441007.1_10 Reverse -269 -282 0.412608 0.23
NP_442201.1_10 Forward -294 -275 -12.6852 0.268
NP_442333.2_5 Forward -294 -275 -3.04881 0.214
NP_440256.1_1 Reverse -271 -290 3.04771 0.0575
NP_440256.1_1 Reverse -81 -100 -9.44032 0.28
NP_440087.1_1 Reverse -265 -284 -6.98204 0.263
NP_441512.1_4 Forward -308 -289 10.9142 0.237
NP_441559.1_8 Forward -314 -300 -4.13031 0.217
NP_440915.1_6 Reverse -270 -284 9.5377 0.0406
NP_440915.1_6 Forward -287 -273 6.29277 0.0828
NP_442452.1_3 Reverse -325 -344 15.8307 0.0828
NP_440748.1_5 Forward -313 -294 3.04771 0.21
NP_441494.1_6 Forward -254 -241 7.88576 0.246
NP_442993.1_1 Forward -283 -267 -7.41462 0.146
NP_440677.1_1 Forward -292 -273 9.53756 0.185
NP_442386.1_9 Reverse -273 -282 13.8639 0.0289
NP_442386.1_9 Reverse -280 -289 8.35743 0.201
NP_442386.1_9 Forward -71 -62 7.47246 0.219
NP_442386.1_9 Forward -284 -275 6.39082 0.219
NP_441750.1_4 Forward -302 -283 7.27595 0.159
NP_441340.1_5 Forward -282 -275 15.6737 0.0124
NP_441340.1_5 Reverse -275 -282 15.6737 0.0124
NP_442484.1_2 Forward -294 -275 7.17762 0.156
NP_440168.1_9 Reverse -272 -291 -3.73712 0.296
NP_441027.1_1 Forward -80 -66 12.782 0.27
NP_440586.1_2 Reverse -337 -356 18.584 0.182
NP_440586.1_8 Forward -282 -275 13.2151 0.026
NP_440586.1_8 Reverse -275 -282 13.2151 0.026
NP_442251.1_6 Forward -282 -275 15.2804 0.0124
NP_442251.1_6 Reverse -275 -282 15.2804 0.0124
NP_440684.1_9 Reverse -268 -282 12.4876 0.168
NP_440684.1_9 Forward -289 -275 9.73436 0.216
NP_441262.1_3 Reverse -274 -281 14.7888 0.0223
NP_441262.1_3 Forward -283 -276 14.7888 0.0223
NP_443051.1_1 Forward -284 -275 18.0926 0.00402
NP_443051.1_1 Reverse -273 -282 10.4228 0.00754
NP_441657.1_5 Forward -300 -281 -1.86883 0.298
NP_440439.1_1 Reverse -271 -284 3.95252 0.108
NP_440439.1_1 Reverse -201 -214 -0.0790467 0.207
NP_440372.1_2 Forward -282 -275 16.3621 0.0124
NP_440372.1_2 Reverse -275 -282 16.3621 0.0124
NP_442511.1_2 Reverse -292 -311 14.4981 0.23
NP_441803.1_2 Reverse -269 -288 3.24438 0.194
NP_440139.1_1 Reverse -268 -287 9.04509 0.105
NP_440139.1_1 Forward -296 -277 1.6703 0.252
NP_441572.1_3 Reverse -277 -296 6.29264 0.261
NP_441572.1_7 Forward -289 -270 -0.000545616 0.176
NP_440267.1_2 Reverse -269 -283 12.2903 0.125
NP_442384.1_10 Reverse -274 -287 10.639 0.0428
NP_442384.1_10 Forward -283 -270 4.54251 0.153
NP_442384.1_10 Forward -213 -200 2.08423 0.237
NP_442262.1_10 Forward -282 -275 14.1988 0.0123
NP_442262.1_10 Reverse -275 -282 14.1988 0.0123
NP_442262.1_10 Reverse -282 -289 9.47889 0.187
NP_441689.1_5 Reverse -272 -282 5.78111 0.197
NP_440344.1_10 Forward -290 -273 8.39697 0.011
NP_440531.1_6 Forward -291 -272 1.67108 0.17
NP_442910.1_1 Forward -290 -271 -5.11376 0.254
NP_441965.1_3 Forward -293 -274 -1.37718 0.283
NP_440297.1_9 Reverse -275 -285 9.61647 0.0917
NP_440297.1_9 Forward -282 -272 -0.118297 0.282
NP_441592.1_4 Forward -283 -264 -1.67217 0.257
NP_441896.1_1 Forward -176 -157 19.2715 0.0528
NP_440999.1_9 Forward -287 -273 4.32615 0.116
NP_440999.1_9 Reverse -270 -284 -0.688726 0.214
NP_440888.1_2 Forward -283 -269 14.7486 0.0152
NP_440803.1_3 Forward -253 -234 3.93269 0.286
NP_440052.1_5 Forward -294 -275 1.27776 0.165
NP_439969.1_3 Forward -288 -269 8.45592 0.126
NP_442277.1_7 Forward -62 -46 8.41009 0.178
NP_442033.1_10 Forward -252 -233 -11.9969 0.261
NP_440575.1_8 Forward -324 -305 -6.88371 0.297
NP_441543.1_2 Forward -282 -273 16.9127 0.00359
NP_441543.1_2 Reverse -275 -284 9.34117 0.0818
NP_442845.1_2 Forward -289 -275 5.40779 0.233
NP_442845.1_2 Reverse -268 -282 3.93283 0.272
NP_441469.1_8 Forward -284 -275 13.3727 0.073
NP_441469.1_8 Reverse -273 -282 6.48957 0.227
NP_443064.1_6 Reverse -274 -284 13.8273 0.0796
NP_443064.1_6 Forward -283 -273 12.5669 0.0796
NP_442578.1_7 Forward -282 -275 14.5921 0.026
NP_442578.1_7 Reverse -275 -282 14.5921 0.026
NP_441462.1_2 Reverse -274 -284 20.1379 0.000967
NP_441462.1_2 Forward -283 -273 11.5831 0.00406
NP_441621.1_7 Forward -294 -280 -5.01529 0.248
NP_443062.1_1 Forward -283 -265 6.69328 0.194
NP_443062.1_6 Reverse -266 -285 0.786102 0.288
NP_441560.1_10 Forward -291 -272 6.78429 0.287
NP_440516.1_8 Forward -283 -274 16.9127 0.00442
NP_440516.1_8 Reverse -274 -283 16.9127 0.00442
NP_442428.1_5 Forward -282 -275 15.8704 0.0124
NP_442428.1_5 Reverse -275 -282 15.8704 0.0124
NP_441867.1_2 Forward -258 -239 -14.5535 0.288
NP_440673.1_2 Forward -293 -274 8.24345 0.275
NP_440673.1_3 Forward -281 -274 12.4288 0.0426
NP_440673.1_3 Reverse -276 -283 12.4288 0.0426
NP_440673.1_7 Forward -294 -275 8.06259 0.137
NP_441052.1_2 Forward -283 -273 19.9412 0.00106
NP_441052.1_2 Reverse -274 -284 10.4031 0.0285
NP_441052.1_2 Reverse -243 -253 3.12662 0.184
NP_440992.1_2 Forward -295 -276 9.3409 0.273
NP_442219.1_9 Forward -282 -273 17.7976 0.00718
NP_442219.1_9 Reverse -275 -284 8.25953 0.0681
NP_440436.1_4 Forward -282 -273 17.2072 0.00233
NP_440436.1_4 Reverse -275 -284 15.9289 0.00508
NP_441884.1_9 Reverse -271 -290 -22.8133 0.284
NP_441884.1_9 Forward -357 -338 -23.01 0.284
NP_441884.1_9 Forward -286 -267 -25.3699 0.29
NP_440314.1_9 Forward -282 -263 -4.13045 0.201
NP_440314.1_9 Reverse -275 -294 -6.68705 0.231
NP_442907.1_9 Reverse -211 -230 -6.49039 0.289
NP_441719.1_4 Forward -282 -275 16.3621 0.0124
NP_441719.1_4 Reverse -275 -282 16.3621 0.0124
NP_441733.1_10 Reverse -271 -284 8.08242 0.143
NP_441004.1_1 Reverse -327 -346 -12.5869 0.247
NP_442366.1_3 Forward -284 -266 1.59244 0.146
NP_442366.1_5 Forward -286 -276 14.8275 0.0375
NP_440296.1_6 Reverse -41 -59 16.4266 0.283
NP_441115.1_4 Reverse -178 -196 7.3932 0.286
NP_440328.1_4 Forward -289 -270 4.52268 0.164
NP_443054.1_2 Reverse -272 -286 16.2242 0.0579
NP_442430.1_10 Reverse -264 -283 9.83173 0.277
NP_442308.1_4 Reverse -268 -287 0.58944 0.275
NP_441851.1_10 Forward -284 -274 17.4829 0.0027
NP_441851.1_10 Reverse -273 -283 15.8113 0.00552
NP_442208.1_5 Forward -297 -278 -2.75381 0.252
NP_442622.1_8 Reverse -274 -292 -18.4671 0.222
NP_442622.1_8 Forward -283 -265 -19.1554 0.296
NP_442856.1_7 Forward -292 -273 5.99764 0.13
NP_442515.1_1 Forward -284 -270 9.63603 0.0614
NP_442515.1_1 Reverse -273 -287 -2.06536 0.268
NP_441396.1_5 Reverse -337 -346 8.75118 0.21
NP_441046.1_2 Reverse -295 -314 -2.16383 0.295
NP_440338.1_4 Forward -56 -37 4.12856 0.298
NP_441349.1_10 Reverse -264 -283 -0.0988766 0.0928
NP_441409.1_6 Forward -289 -270 -8.94866 0.178
NP_442314.1_1 Reverse -188 -206 -5.29072 0.272
NP_440432.1_9 Forward -282 -267 6.37141 0.0477
NP_440432.1_9 Reverse -275 -290 -0.511758 0.164
NP_442843.1_1 Reverse -275 -294 1.0811 0.17
NP_440431.1_4 Forward -62 -43 -9.88384 0.294
NP_442450.1_5 Forward -285 -275 17.3846 0.0267
NP_440588.1_2 Reverse -272 -291 -0.688862 0.152
NP_440588.1_2 Forward -299 -280 -6.68705 0.289
NP_443047.1_7 Forward -364 -345 5.40766 0.245
NP_443047.1_7 Forward -282 -263 4.12936 0.271
NP_441570.1_1 Reverse -274 -292 -8.04399 0.101
NP_440078.1_10 Reverse -300 -319 2.94938 0.269
NP_441078.1_4 Forward -283 -274 19.6659 0.0007
NP_441078.1_4 Reverse -274 -283 19.6659 0.0007
NP_441078.1_4 Forward -213 -204 5.70292 0.111
NP_440526.1_3 Reverse -275 -286 10.9729 0.0646
NP_440526.1_3 Forward -282 -271 10.2846 0.0646
NP_441432.1_8 Reverse -273 -282 16.8143 0.00595
NP_441432.1_8 Forward -284 -275 8.35786 0.0755
NP_441432.1_8 Reverse -210 -219 2.85133 0.281
NP_442320.1_8 Reverse -268 -282 3.73617 0.0578
NP_442320.1_8 Forward -289 -275 -3.54032 0.124
NP_441732.1_2 Forward -287 -271 -6.7263 0.0495
NP_440497.1_2 Reverse -275 -294 5.80098 0.28
NP_442003.1_4 Reverse -275 -294 9.53756 0.3
NP_440760.1_1 Reverse -274 -293 5.60432 0.0121
NP_440760.1_1 Forward -283 -264 -13.0786 0.0976
NP_442797.1_7 Forward -291 -273 0.609134 0.272
NP_440199.1_10 Reverse -271 -281 7.25653 0.231
NP_442353.1_4 Forward -289 -270 -0.886293 0.293
NP_440913.1_1 Reverse -272 -290 6.41066 0.228
NP_442489.1_7 Forward -283 -274 20.1576 0.000695
NP_442489.1_7 Reverse -274 -283 20.1576 0.000695
NP_440559.1_1 Forward -282 -273 17.4043 0.00658
NP_440559.1_1 Reverse -275 -284 17.306 0.00658
NP_441659.2_8 Reverse -274 -284 19.3512 0.000966
NP_441659.2_8 Forward -283 -273 18.1713 0.00133
NP_442913.1_9 Forward -289 -270 6.39097 0.296
NP_442913.1_10 Forward -292 -273 12.1925 0.0397
NP_442913.1_10 Reverse -291 -310 9.0459 0.0462
NP_441040.1_5 Reverse -276 -295 3.73603 0.268
NP_440442.1_3 Reverse -288 -302 14.2576 0.287
NP_441185.1_7 Forward -294 -275 12.3892 0.298
NP_442346.1_5 Forward -284 -274 17.9746 0.00128
NP_442346.1_5 Reverse -273 -283 16.6963 0.00248
NP_440459.1_2 Reverse -272 -289 16.5584 0.092
NP_440459.1_2 Forward -292 -275 15.8701 0.106
NP_440459.1_2 Reverse -297 -314 11.7402 0.166
NP_440459.1_7 Reverse -293 -307 15.9015 0.226
NP_441653.1_2 Forward -294 -275 6.23536 0.235
NP_441653.1_2 Reverse -263 -282 3.14308 0.274
NP_441653.1_3 Forward -272 -258 14.2576 0.265
NP_440010.1_10 Reverse -333 -352 3.53937 0.254
NP_442603.1_7 Reverse -289 -303 5.70218 0.277
NP_442603.1_9 Reverse -279 -297 15.0638 0.173
NP_441888.1_7 Reverse -269 -283 2.2612 0.225
NP_441948.1_4 Forward -290 -272 -2.3408 0.163
NP_441833.1_4 Forward -282 -275 15.9687 0.0124
NP_441833.1_4 Reverse -275 -282 15.9687 0.0124
NP_441895.1_3 Forward -293 -274 -17.1101 0.289
NP_442060.1_5 Forward -296 -277 22.0256 0.0764
NP_442162.1_9 Forward -282 -275 16.2637 0.0124
NP_442162.1_9 Reverse -275 -282 16.2637 0.0124
NP_440671.1_1 Reverse -157 -176 7.94944 0.205
NP_440671.1_4 Forward -289 -275 8.06273 0.204
NP_440671.1_4 Forward -304 -290 7.17775 0.226
NP_440671.1_4 Reverse -268 -282 7.07942 0.227
NP_440671.1_6 Reverse -272 -291 11.5033 0.246
NP_441973.1_6 Forward -168 -150 15.1834 0.27
NP_440772.1_8 Reverse -268 -287 8.55425 0.259
NP_442140.1_3 Reverse -275 -285 13.5497 0.0542
NP_442140.1_3 Forward -282 -272 10.3048 0.0902
NP_442140.1_3 Reverse -282 -292 6.46988 0.168
NP_442140.1_3 Forward -303 -293 4.40493 0.243
NP_442723.1_1 Reverse -270 -289 1.27698 0.298
NP_440875.1_9 Reverse -297 -307 10.7081 0.201
NP_440875.1_9 Forward -281 -271 7.69067 0.255
NP_441813.1_5 Reverse -272 -282 18.1713 0.00743
NP_441813.1_5 Forward -285 -275 8.82982 0.0367
NP_440590.1_4 Reverse -275 -288 10.8357 0.0239
NP_440590.1_4 Reverse -205 -218 6.21414 0.0583
NP_440590.1_4 Forward -282 -269 4.14919 0.0632
NP_440590.1_4 Reverse -301 -314 -5.97891 0.296
NP_440567.1_1 Reverse -275 -289 11.996 0.0258
NP_442497.1_10 Reverse -275 -284 19.8626 0.00532
NP_442497.1_10 Forward -282 -273 10.4228 0.0087
NP_440821.1_4 Forward -285 -275 10.9931 0.0146
NP_440821.1_4 Reverse -272 -282 9.41981 0.0286
NP_440227.1_6 Forward -173 -159 14.2399 0.28
NP_441239.1_9 Forward -285 -273 10.7571 0.0723
NP_441239.1_9 Reverse -272 -284 8.79043 0.122
NP_441239.1_9 Reverse -298 -310 8.6921 0.125
NP_441239.1_9 Forward -292 -280 5.25052 0.223
NP_441239.1_9 Reverse -279 -291 5.15219 0.227
NP_441892.1_1 Forward -292 -275 15.4768 0.03
NP_442044.1_1 Reverse -281 -300 -7.57203 0.224
NP_442270.1_9 Forward -294 -275 -8.06369 0.216
NP_442643.1_5 Forward -90 -71 -5.21209 0.293
NP_441017.1_6 Reverse -270 -284 11.2087 0.273
NP_442772.1_1 Reverse -156 -175 24.0805 0.0197
NP_442083.1_9 Forward -265 -246 18.4857 0.163
NP_442138.1_10 Forward -283 -264 11.2092 0.0359
NP_442052.1_8 Forward -285 -275 12.7631 0.253
NP_440546.1_4 Reverse -274 -284 12.8578 0.0572
NP_440546.1_4 Forward -283 -273 10.046 0.109
NP_440546.1_4 Reverse -281 -291 9.17338 0.151
NP_440546.1_4 Forward -290 -280 7.91294 0.214
NP_442041.1_5 Reverse -289 -308 4.916 0.233
NP_440462.1_6 Reverse -272 -282 9.61647 0.0429
NP_440462.1_6 Forward -285 -275 1.455 0.294
NP_440868.1_4 Reverse -270 -282 7.80712 0.0637
NP_440374.1_1 Forward -140 -121 10.5209 0.292
NP_440653.1_10 Reverse -205 -224 3.14605 0.285
NP_440696.1_6 Forward -295 -276 5.01433 0.285
NP_442039.1_4 Forward -282 -275 15.1821 0.0124
NP_442039.1_4 Reverse -275 -282 15.1821 0.0124
NP_441926.1_3 Forward -283 -267 16.5781 0.0428
NP_440825.1_7 Reverse -275 -285 11.8361 0.2
NP_442837.1_3 Forward -282 -275 15.7721 0.0124
NP_442837.1_3 Reverse -275 -282 15.7721 0.0124
NP_440160.1_9 Reverse -274 -293 10.7175 0.231
NP_442053.1_1 Forward -283 -274 18.3876 0.0007
NP_442053.1_1 Reverse -274 -283 18.3876 0.0007
NP_440505.1_3 Reverse -272 -282 18.3679 0.00213
NP_440505.1_3 Reverse -202 -212 13.353 0.0331
NP_441701.1_3 Reverse -201 -218 9.28195 0.245
NP_441252.1_6 Reverse -370 -377 11.6422 0.288
NP_441203.1_1 Reverse -275 -294 -19.5684 0.297
NP_441408.2_7 Reverse -272 -291 -5.31042 0.292
NP_440914.1_1 Forward -283 -273 17.5935 0.000537
NP_440914.1_1 Reverse -274 -284 8.51751 0.186
NP_441011.1_8 Reverse -275 -284 14.356 0.0249
NP_441011.1_8 Forward -282 -273 8.25953 0.144
NP_442533.1_1 Forward -267 -248 -2.0655 0.14
NP_442533.1_1 Reverse -339 -358 -10.227 0.231
NP_442533.1_1 Reverse -333 -352 -14.8485 0.247
NP_442533.1_6 Forward -283 -274 17.2076 0.00137
NP_442533.1_6 Reverse -274 -283 17.2076 0.00137
NP_442533.1_6 Forward -213 -204 4.91628 0.165
NP_442533.1_6 Reverse -281 -290 4.22796 0.186
NP_442533.1_6 Reverse -306 -315 4.12963 0.191
NP_442541.1_10 Forward -208 -194 8.25877 0.222
NP_440263.1_3 Reverse -293 -312 1.96607 0.294
NP_442229.1_1 Reverse -272 -286 8.16044 0.184
NP_443016.1_1 Reverse -275 -294 -8.35868 0.298
NP_441482.1_7 Forward -289 -275 -8.35854 0.193
NP_441482.1_7 Forward -187 -173 -10.5218 0.209
NP_441482.1_7 Reverse -268 -282 -12.0951 0.29
NP_439944.1_9 Forward -282 -272 10.5014 0.0887
NP_439944.1_9 Reverse -275 -285 8.82982 0.101
NP_441697.1_5 Reverse -41 -60 -6.06416 0.232
NP_441697.1_5 Reverse -39 -58 -10.1703 0.278
NP_441028.1_6 Forward -350 -340 5.97777 0.234
NP_440116.1_8 Reverse -275 -294 2.55606 0.0873
NP_441527.1_4 Forward -145 -126 -12.1756 0.285
NP_440115.1_6 Reverse -271 -281 6.8632 0.167
NP_440007.1_9 Forward -287 -273 3.63784 0.268
NP_440007.1_9 Forward -313 -299 0.786239 0.29
NP_441972.1_5 Reverse -275 -294 8.35759 0.0748
NP_441106.1_1 Forward -284 -275 9.73449 0.0311
NP_441106.1_1 Reverse -273 -282 9.63616 0.0311
NP_441420.1_1 Reverse -273 -292 1.86774 0.17
NP_439903.1_6 Forward -223 -204 8.94676 0.131
NP_439903.1_6 Reverse -271 -290 2.6536 0.222
NP_439903.1_6 Forward -324 -305 1.6703 0.241
NP_442588.1_6 Forward -280 -261 -2.55715 0.294
NP_441286.1_1 Reverse -273 -285 15.4769 0.00418
NP_441286.1_1 Forward -284 -272 3.48056 0.0467
NP_442674.1_3 Forward -291 -272 3.9319 0.294
NP_440670.1_8 Forward -283 -274 18.3876 0.000699
NP_440670.1_8 Reverse -274 -283 18.3876 0.000699
NP_441479.1_1 Forward -196 -177 6.29264 0.298
NP_440886.1_7 Forward -346 -336 11.6809 0.0805
NP_440886.1_7 Forward -284 -274 8.04271 0.0805
NP_440886.1_7 Reverse -273 -283 7.94438 0.0805
NP_440886.1_7 Reverse -280 -290 5.19112 0.194
NP_440886.1_7 Forward -214 -204 3.42118 0.282
NP_440828.1_4 Forward -305 -286 -4.42619 0.246
NP_442614.1_2 Reverse -281 -295 8.35772 0.255
NP_442614.1_2 Reverse -274 -288 5.99778 0.295
NP_442072.1_9 Forward -284 -266 -1.65248 0.0316
NP_442072.1_9 Reverse -273 -291 -12.4689 0.0852
NP_442072.1_9 Reverse -344 -362 -22.6953 0.253
NP_442072.1_9 Forward -291 -273 -23.187 0.284
NP_440907.2_8 Reverse -275 -285 16.2041 0.0161
NP_441021.1_1 Forward -282 -263 1.86774 0.083
NP_441021.1_1 Reverse -275 -294 -2.45882 0.139
NP_441021.1_8 Forward -288 -270 5.32902 0.215
NP_441463.1_5 Forward -284 -270 12.4876 0.188
NP_441626.1_2 Forward -282 -275 15.7721 0.0124
NP_441626.1_2 Reverse -275 -282 15.7721 0.0124
NP_441988.1_5 Reverse -261 -280 10.7175 0.274
NP_442794.1_1 Forward -217 -205 4.75886 0.249
NP_442794.1_1 Forward -287 -275 2.98891 0.286
NP_442615.1_1 Reverse -265 -283 -5.58572 0.217
NP_441962.1_4 Forward -288 -269 -12.8819 0.265
NP_440387.1_1 Forward -283 -267 -0.826444 0.142
NP_440387.1_1 Reverse -204 -220 -5.54633 0.238
NP_440387.1_1 Forward -252 -236 -5.93965 0.258
NP_441431.1_2 Forward -293 -279 12.0937 0.128
NP_441431.1_2 Reverse -271 -285 9.14375 0.192
NP_441488.1_7 Reverse -339 -358 8.75091 0.121
NP_441488.1_8 Forward -288 -274 10.6187 0.146
NP_441993.1_1 Forward -289 -270 15.2983 0.0747
NP_441993.1_1 Reverse -274 -293 4.67549 0.215
NP_440814.1_4 Forward -190 -171 -7.67036 0.221
NP_440814.1_4 Forward -292 -273 -11.5053 0.225
NP_440467.1_3 Reverse -275 -294 12.2328 0.246
NP_440114.1_10 Forward -283 -269 10.1277 0.153
NP_440114.1_10 Reverse -274 -288 8.94771 0.19
NP_440114.1_10 Forward -290 -276 8.45605 0.202
NP_441817.1_10 Forward -285 -266 13.5691 0.199
NP_440766.1_5 Forward -135 -123 11.189 0.267
NP_439988.1_3 Forward -294 -280 9.14437 0.249
NP_441237.1_2 Reverse -188 -207 12.1925 0.287
NP_441237.1_9 Reverse -275 -285 17.188 0.00445
NP_442930.1_1 Forward -161 -151 17.3841 0.19
NP_439910.1_2 Reverse -266 -283 -12.0559 0.0788
NP_439910.1_2 Forward -362 -345 -22.5773 0.267
NP_440457.1_1 Forward -287 -275 8.10212 0.101
NP_440457.1_1 Forward -294 -282 0.23564 0.25
NP_440457.1_1 Reverse -270 -282 -0.649339 0.271
NP_440798.1_6 Reverse -275 -288 5.23083 0.14
NP_441984.1_3 Reverse -270 -288 12.6055 0.163
NP_441332.1_6 Forward -346 -336 12.3244 0.234
NP_442509.1_9 Reverse -274 -284 17.3841 0.00128
NP_442509.1_9 Forward -283 -273 8.14104 0.192
NP_442784.1_3 Reverse -287 -306 14.7491 0.264
NP_442514.1_5 Forward -221 -202 0.785326 0.178
NP_440554.1_4 Forward -282 -272 8.92815 0.0646
NP_442862.1_3 Reverse -154 -171 6.23369 0.267
NP_441885.1_5 Forward -283 -273 20.9245 0.000538
NP_441885.1_5 Reverse -274 -284 11.3864 0.00668
NP_441885.1_5 Forward -250 -240 5.68323 0.0666
NP_441885.1_5 Reverse -204 -214 -0.806614 0.228
NP_442112.1_8 Forward -255 -236 17.6007 0.231
NP_441428.1_8 Forward -257 -238 3.24438 0.251
NP_442341.1_7 Reverse -273 -287 16.8142 0.0155
NP_442341.1_9 Reverse -272 -286 11.5037 0.125
NP_442341.1_9 Forward -298 -284 4.52221 0.299
NP_441756.1_5 Forward -287 -268 -5.01543 0.298
NP_441173.1_9 Forward -73 -65 13.1954 0.184
NP_439906.1_5 Forward -250 -231 16.9124 0.147
NP_440423.1_6 Forward -291 -272 -1.96717 0.126
NP_443000.1_7 Reverse -272 -282 19.9412 0.00223
NP_443000.1_7 Forward -285 -275 2.04498 0.226
NP_440507.2_3 Forward -261 -242 12.9783 0.145
NP_441842.1_10 Forward -290 -276 7.47274 0.257
NP_440275.1_3 Reverse -272 -282 15.123 0.0182
NP_440275.1_3 Forward -285 -275 9.91146 0.046
NP_440091.1_1 Reverse -270 -282 8.88877 0.0567
NP_443060.1_5 Forward -291 -272 11.5033 0.16
NP_442451.1_2 Forward -291 -272 -9.44032 0.259
NP_439962.1_4 Reverse -287 -306 -3.04881 0.245
NP_439962.1_4 Forward -208 -189 -4.32711 0.269
NP_442495.1_4 Reverse -225 -235 12.6647 0.218
NP_441105.1_3 Reverse -263 -282 -0.0988766 0.132
NP_441105.1_3 Forward -199 -180 -3.24547 0.175
NP_441105.1_3 Reverse -269 -288 -9.83364 0.297
NP_440216.1_1 Reverse -274 -288 8.35772 0.0061
NP_440216.1_1 Forward -283 -269 7.9644 0.00737
NP_440172.1_1 Reverse -274 -284 16.303 0.00854
NP_440172.1_1 Forward -283 -273 15.0247 0.00945
NP_440172.1_1 Reverse -281 -291 1.94665 0.29
NP_442015.1_10 Forward -287 -274 12.2123 0.0372
NP_442015.1_10 Reverse -270 -283 2.87088 0.187
NP_441226.1_7 Forward -282 -275 14.4934 0.0123
NP_441226.1_7 Reverse -275 -282 14.4934 0.0123
NP_441226.1_7 Forward -69 -62 8.29857 0.205
NP_441111.1_7 Forward -282 -274 18.7023 0.00294
NP_441111.1_7 Reverse -275 -283 18.7023 0.00294
NP_442379.1_10 Reverse -267 -284 8.29864 0.102
NP_441766.1_2 Forward -283 -274 17.5026 0.00297
NP_441766.1_2 Reverse -274 -283 17.5026 0.00297
NP_440416.1_9 Forward -220 -201 -20.3551 0.284
NP_443052.1_8 Forward -364 -345 -7.67036 0.162
NP_443052.1_8 Reverse -347 -366 -9.14533 0.186
NP_443052.1_8 Forward -262 -243 -12.9802 0.27
NP_441135.1_3 Reverse -298 -317 10.0292 0.266
NP_442154.1_1 Forward -260 -242 -19.3521 0.298
NP_440261.1_5 Reverse -275 -288 -0.669033 0.0655
NP_440261.1_5 Forward -282 -269 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTGGAATCCGCACTTTGGAGTATTCCCCAAACTGATGAATTCAGCTTCGCTCACCCCCATCATCAGGTCAGCAACAAAAGTGTAGTCCCTGGCCATTCCATCGTGGCCGCGCCATGGGCGATCGCCAGTTTCTTATGGGAGCAAGGTGGGGCTAACCGCACCGTCCCTAGGTCATTCAAGCCCTTTGCCTATCCCCTGGACAGCTTGCAGAAATCCTGGCCGCTCGTTACAATCCTTCAAAATATTCTCACTTTGTAAGGGATAATGGATAAAACTTGACTCTGTCTGTCTTGTTCGGTTAACACAACCTATAGACAAGGGTTTTATTTACCCAACGCAGAATAAAAATTAAAACGTCTTTAAGACACAAAACACTATTCGTTACTAGAAGGAGCGTCA

CDS

ATGGGACTACCTTGGTATCGCGTTCATACAGTTGTCCTGAATGATCCAGGGCGACTCATCTCTGTCCATTTAATGCACACTGCCCTAGTGGCTGGCTGGGCTGGATCTATGGCTCTCTATGAGTTGGCCATTTTTGACTCCAGCGATGCTGTGCTTAACCCCATGTGGCGGCAAGGCATGTTTGTTTTGCCCTTCATGGCCCGCCTCGGTGTCACCAGTTCCTGGAATGGCTGGAGCGTCACCGGAGAAACTGGTTTGGATCCCGGTTTCTGGTCCTTTGAAGGGGTAGCTGCTGCCCACATCGTTCTATCTGGTCTGTTGTTCCTAGCCGCCGTATGGCACTGGGTATTTTGGGACCTGGAATTATTTGTTGACCCCCGTACCGGTGAATCCGCATTGGATTTGCCCAAAATGTTTGGTATTCACCTCTTCTTGTCTGGTTTGCTCTGCTTCGGTTTTGGTGCTTTCCACCTCACCGGCGTTTGGGGCCCTGGCATGTGGGTATCCGACCCCTATGGTCTGACGGGCCACGTACAGCCAGTGGCACCGGAATGGGGACCAGCTGGCTTTAACCCGTTTAACCCCGGTGGGGTAGTGGCTCACCACATTGCTGCTGGTATTGTCGGTATCATTGCCGGTCTTTTCCACCTTACGGTACGGCCCCCTGAGCGCTTGTATAAAGCCCTCCGCATGGGGAATATTGAGACCGTATTGTCCAGTAGTATTGCCGCTGTATTTTTTGCCGCTTTCGTCGTGGCCGGTACCATGTGGTACGGTAATGCCACCACCCCCATCGAACTCTTTGGCCCCACCCGTTATCAGTGGGATAAGGGTTATTTTCAAGAAGAAATCCAACGCCGGGTTGATAGCCAGTTAGCAGAAGGAGCTTCCCTATCTGAAGCCTGGTCCACCATCCCTGAAAAGTTGGCTTTCTACGATTACGTCGGTAACAGCCCCGCTAAAGGTGGTTTGTTTCGTACCGGTGCTATGAACAGTGGTGATGGCATTGCCCAGGAATGGATTGGTCACCCCATATTCAAAGACAAAGAAGGTCGGGAACTGGAGGTACGGCGTATGCCTAACTTCTTTGAAACTTTCCCCGTCATCATGACCGATGCGGATGGTGTAGTCCGGGCGGATATTCCCTTCCGTCGTTCCGAGTCTAAATTCAGTGTGGAACAAACCGGTGTTACCGTCAGCTTCTACGGTGGTGCTTTAGACGGCCAGACCTTCAGCAATCCCAGTGATGTGAAGAAGTTTGCCCGGAAAGCTCAGTTGGGTGAAGGCTTCGACTTCGATACGGAAACCTTCAACTCTGATGGTGTATTCCGCACCAGTCCCCGGGGTTGGTTTACCTTTGGCCACGCTGTCTTTGCCTTGCTCTTCTTCTTTGGTCACATCTGGCATGGTTCCCGGACTCTGTTCCGTGACGTATTTGCTGGGGTTGATCCTGGTTTGGAAGAACAAGTGGAATTTGGTGTGTTTGCTAAGGTTGGTGACCTTTCCACCCGGAAAGAAGCCTAG

Protein

MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIFDSSDAVLNPMWRQGMFVLPFMARLGVTSSWNGWSVTGETGLDPGFWSFEGVAAAHIVLSGLLFLAAVWHWVFWDLELFVDPRTGESALDLPKMFGIHLFLSGLLCFGFGAFHLTGVWGPGMWVSDPYGLTGHVQPVAPEWGPAGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVRPPERLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDKGYFQEEIQRRVDSQLAEGASLSEAWSTIPEKLAFYDYVGNSPAKGGLFRTGAMNSGDGIAQEWIGHPIFKDKEGRELEVRRMPNFFETFPVIMTDADGVVRADIPFRRSESKFSVEQTGVTVSFYGGALDGQTFSNPSDVKKFARKAQLGEGFDFDTETFNSDGVFRTSPRGWFTFGHAVFALLFFFGHIWHGSRTLFRDVFAGVDPGLEEQVEFGVFAKVGDLSTRKEA