Your browser is old and dusty. Try Google Chrome!

Details for slr0904

ORF slr0904
Accession NP_442386.1
Symbol comM
Category Transformation
Definition competence protein ComM homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -363 -377 8.84938 0.083
NP_441061.1_2 Forward -371 -357 4.91614 0.142
NP_441061.1_2 Reverse -299 -313 -1.18038 0.252
NP_441061.1_2 Reverse -322 -336 -2.26202 0.287
NP_440694.1_6 Reverse -295 -314 5.80098 0.241
NP_440897.1_6 Reverse -327 -346 -3.93454 0.259
NP_441453.1_1 Reverse -320 -338 7.09821 0.221
NP_442151.1_6 Forward -336 -322 8.35772 0.175
NP_441818.1_1 Forward -377 -366 8.4163 0.295
NP_441818.1_9 Forward -392 -373 -3.3438 0.222
NP_441818.1_9 Forward -336 -317 -5.60541 0.254
NP_441098.1_3 Forward -197 -178 -6.02333 0.28
NP_442744.1_9 Reverse -174 -188 15.2592 0.266
NP_442655.1_10 Forward -339 -320 -11.0136 0.23
NP_443002.1_5 Forward -371 -353 12.0147 0.236
NP_442752.1_4 Forward -336 -329 10.5605 0.1
NP_443027.1_4 Reverse -372 -382 7.25653 0.24
NP_440784.1_7 Reverse -278 -285 4.26735 0.272
NP_441476.1_5 Reverse -358 -377 -3.93378 0.243
NP_440631.1_2 Forward -335 -316 10.8159 0.2
NP_440304.1_4 Reverse -178 -188 3.81494 0.292
NP_441781.1_7 Forward -320 -301 -2.26216 0.289
NP_439918.1_2 Reverse -351 -370 -3.14714 0.251
NP_441200.1_4 Reverse -241 -260 12.9791 0.172
NP_441594.1_6 Forward -380 -361 6.09597 0.196
NP_440229.1_4 Forward -61 -42 13.4708 0.204
NP_441082.1_10 Forward -89 -76 9.75405 0.242
NP_442726.1_1 Forward -283 -264 7.96426 0.288
NP_441083.1_5 Forward -320 -310 4.20827 0.153
NP_441558.1_5 Reverse -207 -226 4.32602 0.283
NP_442889.1_8 Reverse -164 -178 5.99717 0.207
NP_442889.1_8 Reverse -371 -385 5.80051 0.213
NP_440056.1_1 Forward -377 -358 8.45592 0.297
NP_442059.1_10 Forward -245 -226 10.8159 0.239
NP_442570.1_3 Reverse -354 -373 -6.68705 0.259
NP_441716.1_1 Forward -102 -88 10.4227 0.0956
NP_442634.1_4 Forward -338 -324 13.1759 0.0318
NP_440470.1_5 Forward -78 -59 16.1855 0.149
NP_440403.1_10 Reverse -348 -367 1.17943 0.291
NP_442848.1_4 Forward -128 -114 15.3392 0.214
NP_441634.1_8 Forward -332 -318 -1.5737 0.294
NP_440376.1_1 Forward -336 -327 2.85133 0.213
NP_442687.1_6 Reverse -106 -124 12.2122 0.175
NP_441846.1_10 Reverse -89 -108 -22.715 0.264
NP_442658.1_1 Reverse -202 -212 5.97777 0.242
NP_442658.1_1 Forward -288 -278 5.87944 0.246
NP_442782.1_2 Reverse -363 -377 0.392915 0.29
NP_441958.1_5 Forward -337 -327 -0.609952 0.215
NP_439905.1_5 Forward -197 -183 11.3077 0.288
NP_442690.1_1 Reverse -220 -239 -6.58872 0.168
NP_442690.1_1 Forward -78 -59 -9.047 0.192
NP_440138.1_6 Forward -376 -357 3.53858 0.242
NP_441099.1_5 Reverse -317 -336 -2.95047 0.129
NP_442567.1_3 Forward -223 -207 13.7265 0.238
NP_441646.1_1 Forward -219 -200 0.491109 0.251
NP_441398.1_5 Forward -280 -261 7.57094 0.258
NP_442870.1_1 Forward -396 -377 14.0608 0.139
NP_441916.1_10 Forward -310 -291 0.294447 0.286
NP_441041.1_4 Forward -398 -379 -0.590531 0.0958
NP_441041.1_4 Reverse -363 -382 -11.4069 0.246
NP_441041.1_4 Forward -336 -317 -12.3902 0.265
NP_441041.1_4 Forward -320 -301 -13.3736 0.285
NP_442396.1_5 Forward -15 -2 6.1158 0.254
NP_439966.1_7 Forward -288 -278 5.78111 0.209
NP_439966.1_9 Forward -395 -386 3.7363 0.253
NP_440289.1_2 Reverse -123 -136 -4.20895 0.283
NP_440437.1_1 Forward -359 -340 -3.93378 0.248
NP_443030.1_4 Reverse -377 -396 -6.78538 0.289
NP_441644.1_6 Reverse -327 -337 13.7459 0.0169
NP_441644.1_6 Forward -398 -388 5.28945 0.199
NP_442177.1_5 Reverse -354 -368 8.16106 0.286
NP_442029.1_6 Forward -319 -300 3.14605 0.283
NP_440929.1_8 Forward -398 -389 3.63797 0.214
NP_442554.1_8 Forward -335 -325 4.0116 0.2
NP_442142.1_4 Reverse -324 -337 2.67367 0.281
NP_442476.1_5 Forward -245 -226 12.2908 0.256
NP_440895.1_6 Forward -224 -211 8.37742 0.276
NP_443009.1_5 Forward -373 -362 3.49977 0.292
NP_440620.1_4 Reverse -59 -73 14.2399 0.272
NP_440464.1_10 Reverse -210 -220 11.8623 0.275
NP_442719.1_2 Reverse -60 -78 -8.24135 0.246
NP_441251.1_7 Forward -71 -58 11.3273 0.27
NP_440145.1_4 Reverse -328 -338 15.3192 0.219
NP_440038.1_4 Reverse -319 -338 0.491109 0.277
NP_440558.1_2 Forward -381 -362 17.8957 0.0626
NP_440558.1_2 Forward -216 -197 -0.787193 0.204
NP_440558.1_2 Forward -396 -377 -1.86883 0.218
NP_440558.1_2 Reverse -200 -219 -3.63879 0.237
NP_440558.1_2 Reverse -359 -378 -4.32711 0.244
NP_440558.1_2 Forward -375 -356 -6.49039 0.275
NP_440558.1_2 Reverse -365 -384 -6.98204 0.284
NP_442789.1_4 Forward -319 -300 -7.86702 0.299
NP_442419.1_2 Forward -283 -264 -3.63879 0.269
NP_441549.1_9 Forward -381 -363 -9.91228 0.265
NP_442645.1_2 Forward -380 -361 -8.65367 0.131
NP_442888.1_6 Forward -229 -210 11.7008 0.148
NP_440136.1_1 Forward -73 -57 13.6275 0.238
NP_440136.1_2 Reverse -278 -285 4.26735 0.218
NP_442590.1_3 Forward -89 -70 21.2389 0.0109
NP_442998.1_5 Reverse -54 -64 13.7464 0.157
NP_442998.1_5 Forward -69 -59 8.63316 0.261
NP_440899.1_1 Forward -302 -283 12.8967 0.145
NP_440899.1_8 Reverse -224 -243 -1.7705 0.212
NP_440256.1_1 Reverse -324 -343 -6.49039 0.213
NP_441957.1_1 Reverse -376 -395 12.1925 0.15
NP_441090.1_6 Forward -336 -322 11.2093 0.221
NP_440915.1_6 Forward -340 -326 -0.492064 0.197
NP_442069.1_4 Reverse -105 -124 3.14605 0.27
NP_440695.1_6 Forward -66 -52 10.1205 0.269
NP_442993.1_1 Forward -218 -202 -9.67623 0.19
NP_442386.1_2 Forward -265 -246 19.8909 0.0963
NP_442386.1_9 Forward -315 -306 10.7174 0.119
NP_442386.1_9 Reverse -362 -371 8.35743 0.201
NP_442386.1_9 Forward -366 -357 5.11253 0.266
NP_440168.1_9 Forward -394 -375 5.11266 0.227
NP_440327.1_6 Reverse -345 -364 13.3725 0.159
NP_440327.1_6 Reverse -351 -370 8.25926 0.222
NP_441027.1_1 Forward -68 -54 10.3237 0.291
NP_440586.1_8 Reverse -375 -382 10.7568 0.128
NP_440836.1_6 Reverse -28 -42 10.6193 0.242
NP_441803.1_2 Reverse -270 -289 5.70265 0.165
NP_442384.1_10 Forward -336 -323 3.85419 0.176
NP_441877.1_5 Forward -67 -48 -2.26216 0.298
NP_441877.1_6 Reverse -292 -311 14.0608 0.219
NP_441018.1_7 Reverse -359 -378 10.0292 0.218
NP_441689.1_5 Forward -191 -181 4.89613 0.286
NP_440562.1_10 Reverse -318 -336 12.2122 0.206
NP_440297.1_9 Reverse -364 -374 0.865012 0.282
NP_440937.1_5 Forward -399 -380 8.16093 0.287
NP_442553.1_4 Reverse -326 -345 8.06259 0.273
NP_443036.1_1 Reverse -238 -257 8.35677 0.294
NP_441759.1_10 Forward -188 -169 16.6174 0.253
NP_441469.1_8 Reverse -304 -313 5.89959 0.246
NP_440220.1_4 Forward -71 -52 5.99684 0.204
NP_441462.1_2 Forward -336 -326 -1.10161 0.281
NP_443062.1_1 Forward -383 -365 8.2534 0.157
NP_442204.1_1 Forward -340 -329 1.04198 0.281
NP_440783.1_5 Forward -313 -294 -6.68705 0.3
NP_440992.1_2 Forward -377 -358 13.7658 0.201
NP_442219.1_9 Reverse -306 -315 2.75299 0.233
NP_440436.1_4 Forward -371 -362 9.04574 0.092
NP_441336.1_3 Reverse -275 -289 16.1259 0.264
NP_441004.1_1 Reverse -357 -376 -11.8986 0.243
NP_442366.1_3 Forward -373 -355 1.19912 0.156
NP_441729.1_1 Reverse -364 -383 18.6823 0.128
NP_442206.1_1 Forward -102 -83 -12.0953 0.226
NP_442206.1_10 Forward -398 -383 9.22301 0.167
NP_441966.1_7 Reverse -317 -336 14.5516 0.0947
NP_441668.1_5 Forward -170 -151 8.55425 0.232
NP_442689.1_8 Forward -74 -57 -3.5994 0.251
NP_441051.1_1 Forward -398 -388 17.9746 0.292
NP_441409.1_6 Reverse -321 -340 -7.57203 0.153
NP_440432.1_9 Reverse -328 -343 -1.00341 0.167
NP_441150.1_6 Forward -375 -356 14.7483 0.251
NP_441124.1_5 Reverse -54 -64 16.1594 0.188
NP_442450.1_5 Reverse -275 -285 6.8632 0.151
NP_440954.1_1 Forward -336 -317 -8.06369 0.289
NP_442006.1_2 Forward -249 -232 -16.1858 0.243
NP_442006.1_2 Reverse -269 -286 -16.4808 0.254
NP_442006.1_2 Reverse -84 -101 -18.644 0.294
NP_441570.1_1 Forward -25 -7 -10.9939 0.184
NP_440078.1_4 Reverse -352 -371 13.4708 0.19
NP_442443.1_1 Forward -285 -266 -6.49039 0.294
NP_441732.1_2 Forward -324 -308 -17.7394 0.292
NP_442489.1_7 Forward -336 -327 -1.6719 0.235
NP_442079.1_7 Forward -335 -316 0.58944 0.277
NP_441659.2_8 Reverse -327 -337 5.97822 0.0909
NP_441659.2_8 Reverse -209 -219 1.16001 0.248
NP_442913.1_10 Reverse -268 -287 -4.13045 0.227
NP_441040.1_2 Forward -220 -201 -11.8003 0.255
NP_442008.1_2 Reverse -200 -219 9.0459 0.188
NP_440250.1_4 Forward -77 -58 7.07848 0.248
NP_441653.1_3 Forward -386 -372 17.6992 0.166
NP_442073.1_8 Reverse -379 -398 7.96345 0.284
NP_440875.1_9 Reverse -386 -396 8.76138 0.233
NP_440875.1_9 Reverse -95 -105 7.59334 0.255
NP_440590.1_4 Reverse -363 -376 0.117615 0.169
NP_441239.1_9 Reverse -361 -373 5.54551 0.217
NP_441239.1_9 Forward -400 -388 5.44718 0.221
NP_441009.1_4 Reverse -363 -382 10.4225 0.27
NP_440156.1_4 Forward -65 -55 11.9759 0.176
NP_442044.1_1 Reverse -363 -382 -7.96535 0.236
NP_441769.1_8 Forward -254 -235 13.8641 0.267
NP_440833.1_6 Forward -242 -228 13.9619 0.157
NP_440212.1_9 Forward -194 -175 12.1904 0.14
NP_440212.1_9 Reverse -175 -194 8.05774 0.146
NP_441526.1_6 Forward -316 -297 4.22769 0.271
NP_441617.1_6 Forward -65 -46 -5.60541 0.274
NP_442809.1_6 Forward -244 -225 0.0977854 0.295
NP_441249.1_8 Forward -336 -317 5.89931 0.247
NP_441848.1_4 Reverse -49 -65 16.0494 0.151
NP_441084.1_6 Reverse -207 -221 15.2585 0.0931
NP_442039.1_4 Forward -285 -278 9.47889 0.145
NP_441811.1_8 Forward -389 -375 10.521 0.219
NP_442679.1_1 Reverse -165 -184 -4.22878 0.274
NP_442837.1_3 Forward -285 -278 9.38056 0.132
NP_440160.1_2 Reverse -203 -222 -8.85033 0.291
NP_442471.1_3 Reverse -193 -212 21.0931 0.0524
NP_441011.1_8 Forward -335 -326 6.78456 0.184
NP_442101.1_10 Forward -344 -325 -6.09707 0.183
NP_442533.1_1 Forward -339 -320 -17.6018 0.291
NP_442533.1_6 Reverse -327 -336 11.9961 0.0343
NP_442232.1_3 Reverse -196 -215 -10.0303 0.266
NP_442597.1_9 Reverse -178 -197 18.3276 0.226
NP_441028.1_6 Forward -61 -51 4.89613 0.275
NP_440116.1_5 Forward -129 -112 3.97208 0.222
NP_440116.1_8 Forward -285 -266 -8.45701 0.253
NP_441869.1_5 Forward -201 -184 19.0167 0.232
NP_001035870.1_3 Reverse -351 -370 -3.54046 0.278
NP_442674.1_3 Reverse -159 -178 3.34192 0.294
NP_441479.1_5 Reverse -352 -371 17.8957 0.177
NP_440886.1_7 Reverse -326 -336 5.87944 0.158
NP_441808.1_8 Forward -395 -376 8.75091 0.259
NP_442022.1_4 Forward -392 -373 6.68596 0.27
NP_442264.1_2 Forward -387 -370 8.59364 0.211
NP_440387.1_5 Reverse -296 -315 11.807 0.263
NP_440855.1_5 Forward -214 -195 2.06362 0.295
NP_441431.1_3 Reverse -270 -289 2.45773 0.283
NP_441521.1_9 Reverse -85 -103 15.6538 0.276
NP_440358.1_8 Reverse -240 -259 1.96607 0.246
NP_439988.1_3 Reverse -352 -366 6.48943 0.278
NP_442930.1_1 Forward -65 -55 13.3526 0.239
NP_442930.1_1 Reverse -58 -68 13.0576 0.239
NP_442867.1_8 Reverse -232 -251 8.45592 0.233
NP_440457.1_1 Forward -307 -295 5.54551 0.141
NP_440213.1_5 Forward -188 -169 9.83255 0.264
NP_440554.1_4 Reverse -328 -338 2.33998 0.267
NP_440649.2_5 Forward -378 -359 11.6025 0.232
NP_442341.1_9 Forward -288 -274 7.17714 0.204
NP_442451.1_2 Forward -298 -279 -5.70374 0.226
NP_439962.1_4 Forward -286 -267 2.55606 0.197
NP_442495.1_5 Reverse -352 -371 7.7676 0.291
NP_441105.1_3 Reverse -352 -371 -0.983855 0.145
NP_440216.1_1 Reverse -327 -341 2.85119 0.0284
NP_440216.1_9 Reverse -169 -178 6.78456 0.289
NP_440172.1_1 Reverse -327 -337 2.14332 0.283
NP_440172.1_1 Reverse -180 -190 1.94665 0.29
NP_440198.1_10 Forward -394 -375 7.7676 0.296
NP_442379.1_10 Forward -142 -125 1.31714 0.223
NP_442417.1_5 Forward -314 -300 4.42448 0.299
NP_442046.1_8 Forward -377 -358 10.3242 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCGCCGCTGGCATTGATTTTGATGGCAGTGCCATTCCCGAAGCCAAGCTGGAACTCTATCATCAGGTGATGGGCTTGGAAGCAGGTCGGCAACGCAGTGGGGTCAGTAATACCATGCGCTCCCGCATTGTCCGCATTGGAGCCAAACATATTGTCCAGGCAGAACTAGACCAAAAATTAATTGACGCTGGCTTTGCACCCCTCAAGGATAAAGAAATTGCTTTTTTCTATGGCGCTAAGTAGGCTACTTTGCGTCTGAGCAGAGTAGCTATCTTGCCTCTTGGCTAACTAAGCCCACAGTCCATTGTCACCCTGCAGAGTTTGGGACCTTTAGTGAAAATTTTCCCATGTTATCTTGATAGGTAAAATCAGGCTAGGTGAACTGAGTTTGTGGGTCGACT

CDS

ATGTTAGCAAGGGTTTGGAGTGCTTCCCTGTTGGGCATTGATGCCATTAAGGTCGGGGTAGAAGTAGACGTTTCCGCTGGGCTTCCGGCGATCGCCGTGGTGGGGCTACCAGATACGGCAGTGCAGGAATCCAGGGAACGGGTCAAGGCGGCGTTAAAGAATGCGGGCTTTGCTTTCCCCGTGCGGCGCATTGTCATTAATCTCACCCCGGCCGATTTACGTAAAGAAGGCCCCAGCTTTGACTTACCCATTGGCATTGGCATCCTGGCCGCATCGGAGCAGGTGGATGCCCAACTATTGGGAGATTATTTGTTTTTAGGGGAAATGTCCCTGGATGGCAGTTTACGGGCGATCGCCGGTGTTCTTCCCATTGCGGCCACAGCGCAAAAAATGGGCTTAGCAGGCATAGTGGTACCGTCGGGCAACGCCTTGGAAGCCTCCGTGGTGCAGGGCTTAAAAGTCTATGGCTTCGACCACATTAAAGAAGTGGTGGACTTTCTCGGAGCACCGGAAAAATTTACCCCAGTTAATGCCCAGGATGCCAAGCAACAGTGGAACACCTCCCTGCCTTGTTTGGATTTGAAAGATGTGAAAGGGCAATCCCATGGCCGGAGAGCCTTAGAAATTGCCGCCGCCGGAGGCCATAACTTGATTTTTGTCGGCCCACCAGGCAGTGGGAAAACCATGTTGGCTCGCCGTTTGCCTGGTATCTTGCCGCCGCTCCAATTTGAAGAAGCGTTGGAAGTGTCCCAAGTCCATTCTGTGGCAGGGTTACTGAAAGAACGGGGACAATTAATCCGTCAGCGTCCTTTTCGCAGTCCCCACCATTCCGCCTCTGGTCCTTCCCTAGTGGGAGGGGGGAGTTTTCCTCGGCCGGGGGAAATTTCCTTGGCCCATCGGGGGGTTTTGTTTTTAGATGAACTGACAGAATTTAAACGCAATGTGTTGGAATTTTTGCGTCAACCCTTGGAGGACGGGCACGTTACCATTTCCCGCACCAAGCAAACCATCATGTTCCCAGCCCAATTTACCCTGATTGCCAGCACCAATCCCTGTCCCTGTGGTTATTTTGGCGATCCCATTCAAGCCTGTTCCTGTTCTCCTCGCCAGAGGGAAATGTATTGGTCTAAGCTTTCTGGCCCTTTGATGGACCGCATTGATCTACAGGTGGCAGTTAACCGTCTTAAGCCAGAGGAAATGACTAGCCAAGGCCAGGGAGAAAGTTCAGAACCAGTGCGGCAAAGAGTAGCCAAGGCCAGGGCCATGGCGATCGCCAGATTTAGTAAAGATGCAAAAATTAGTTGTAATGCCGAAATGCAGGCAGGGCAATTGCGTCAATTTTGTCACTTGGATGAAAACTGCCGTCAACTGCTGGAAGGAGCGATCAAAAAACTGGGGCTCTCCGCCCGGGCCATGGACCGCATTTTGAAAGTATCCCGCACCATCGCTGACCTAGGGCGATCGGAGCATATCCAAGCATCTCATCTGGCGGAAGCTATTCAATACCGCACCCTAGATAGGTTCACTTAA

Protein

MLARVWSASLLGIDAIKVGVEVDVSAGLPAIAVVGLPDTAVQESRERVKAALKNAGFAFPVRRIVINLTPADLRKEGPSFDLPIGIGILAASEQVDAQLLGDYLFLGEMSLDGSLRAIAGVLPIAATAQKMGLAGIVVPSGNALEASVVQGLKVYGFDHIKEVVDFLGAPEKFTPVNAQDAKQQWNTSLPCLDLKDVKGQSHGRRALEIAAAGGHNLIFVGPPGSGKTMLARRLPGILPPLQFEEALEVSQVHSVAGLLKERGQLIRQRPFRSPHHSASGPSLVGGGSFPRPGEISLAHRGVLFLDELTEFKRNVLEFLRQPLEDGHVTISRTKQTIMFPAQFTLIASTNPCPCGYFGDPIQACSCSPRQREMYWSKLSGPLMDRIDLQVAVNRLKPEEMTSQGQGESSEPVRQRVAKARAMAIARFSKDAKISCNAEMQAGQLRQFCHLDENCRQLLEGAIKKLGLSARAMDRILKVSRTIADLGRSEHIQASHLAEAIQYRTLDRFT