Your browser is old and dusty. Try Google Chrome!

Details for slr0881

ORF slr0881
Accession NP_440924.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -371 -352 -30.6798 0.291
NP_441453.1_4 Forward -196 -188 5.0343 0.209
NP_440259.1_4 Reverse -291 -305 10.7568 0.262
NP_440996.1_2 Forward -305 -296 15.241 0.248
NP_441816.1_7 Forward -299 -280 -1.08219 0.294
NP_442173.1_1 Forward -370 -362 6.01761 0.2
NP_439979.1_9 Forward -76 -58 8.96727 0.257
NP_442972.1_2 Forward -41 -27 13.7653 0.179
NP_440304.1_4 Forward -67 -57 3.32329 0.299
NP_441594.1_6 Forward -368 -349 2.26107 0.254
NP_439957.1_10 Forward -237 -227 16.2046 0.277
NP_442827.1_8 Reverse -212 -231 -0.787962 0.235
NP_442889.1_1 Forward -386 -367 -15.7335 0.298
NP_441713.1_1 Forward -365 -346 -16.7168 0.286
NP_440178.1_7 Reverse -268 -287 -13.3736 0.136
NP_442570.1_8 Reverse -324 -342 12.7038 0.179
NP_441716.1_1 Reverse -238 -252 2.94952 0.284
NP_441624.1_7 Reverse -57 -71 8.16106 0.24
NP_440747.1_10 Reverse -359 -371 -12.0557 0.199
NP_441130.1_10 Forward -93 -79 5.01447 0.251
NP_442850.1_4 Forward -235 -216 16.1257 0.208
NP_440403.1_10 Forward -74 -55 2.26107 0.279
NP_442848.1_4 Reverse -255 -269 8.45605 0.282
NP_443018.1_3 Forward -90 -83 9.38056 0.128
NP_441634.1_8 Reverse -80 -94 4.32615 0.13
NP_441857.1_6 Forward -249 -239 13.2547 0.288
NP_442687.1_7 Reverse -361 -371 3.81494 0.286
NP_442191.1_4 Forward -370 -356 16.2288 0.0423
NP_440642.1_10 Reverse -300 -314 6.0955 0.238
NP_440642.1_10 Reverse -60 -74 2.75226 0.277
NP_441950.1_7 Forward -134 -115 1.0811 0.175
NP_442496.1_5 Forward -294 -276 5.32902 0.288
NP_441414.1_9 Reverse -187 -206 -2.45882 0.117
NP_440184.1_1 Forward -117 -98 3.06757 0.243
NP_442836.1_10 Forward -249 -239 9.81313 0.269
NP_442685.1_7 Reverse -206 -223 18.7209 0.162
NP_439905.1_1 Forward -341 -328 8.57408 0.232
NP_442119.1_6 Forward -198 -179 5.60432 0.25
NP_440200.1_3 Reverse -324 -343 5.80098 0.298
NP_443055.1_3 Reverse -194 -213 12.6504 0.205
NP_443055.1_6 Forward -234 -216 -2.14486 0.29
NP_443055.1_6 Forward -378 -360 -2.43985 0.295
NP_440411.1_4 Reverse -164 -183 9.3409 0.181
NP_441916.1_10 Forward -243 -224 2.16274 0.251
NP_440206.1_4 Reverse -72 -91 -1.18128 0.29
NP_440345.1_3 Forward -51 -37 9.94278 0.297
NP_441079.1_7 Reverse -304 -323 -0.886293 0.2
NP_441058.2_6 Reverse -254 -273 12.5858 0.268
NP_441087.1_6 Reverse -56 -74 -2.83317 0.296
NP_440375.1_8 Forward -90 -71 0.982764 0.252
NP_441644.1_6 Forward -91 -81 11.1893 0.0538
NP_442215.1_2 Forward -275 -259 -3.8747 0.223
NP_442215.1_2 Forward -228 -212 -6.7263 0.278
NP_440253.1_2 Forward -371 -353 -2.14413 0.261
NP_440929.1_8 Forward -196 -187 4.91628 0.162
NP_440780.1_1 Forward -334 -315 18.7637 0.194
NP_440780.1_1 Forward -333 -314 15.2305 0.231
NP_442933.1_1 Reverse -292 -311 13.9891 0.223
NP_442933.1_1 Reverse -299 -318 13.7027 0.234
NP_442554.1_8 Reverse -83 -93 11.4848 0.0355
NP_441762.1_7 Reverse -186 -198 -7.53251 0.293
NP_442142.1_4 Forward -229 -216 2.87033 0.273
NP_441715.1_4 Forward -370 -360 5.5849 0.197
NP_441715.1_4 Forward -380 -370 5.28991 0.216
NP_440183.1_1 Forward -214 -195 7.7676 0.259
NP_441015.1_10 Forward -76 -57 -8.752 0.277
NP_441673.1_1 Forward -196 -187 -8.06341 0.254
NP_441426.1_6 Reverse -208 -227 18.9773 0.0727
NP_441764.1_1 Forward -117 -98 14.0608 0.116
NP_441764.1_4 Forward -119 -102 17.3345 0.0666
NP_442019.1_8 Reverse -52 -71 9.53756 0.224
NP_442227.1_2 Reverse -234 -253 -1.37718 0.262
NP_442227.1_2 Reverse -58 -77 -1.96717 0.269
NP_440789.1_1 Reverse -100 -119 14.4533 0.285
NP_441911.1_10 Forward -241 -222 12.126 0.21
NP_442808.1_1 Forward -197 -187 5.87944 0.137
NP_440031.1_10 Reverse -71 -90 4.03102 0.256
NP_440145.1_3 Forward -225 -206 -6.1954 0.292
NP_441498.1_3 Reverse -46 -64 8.6715 0.214
NP_442789.1_4 Forward -76 -57 -5.31042 0.269
NP_440923.1_1 Reverse -99 -117 28.1409 0.0000449
NP_440614.1_2 Forward -228 -209 17.7974 0.0586
NP_441445.1_8 Reverse -259 -278 -1.7705 0.24
NP_440084.1_8 Reverse -316 -330 9.36983 0.29
NP_442347.1_2 Reverse -242 -251 4.62128 0.274
NP_441037.1_4 Reverse -9 -19 6.34312 0.267
NP_442594.1_8 Reverse -331 -350 2.16274 0.295
NP_441633.1_3 Reverse -80 -93 -6.2739 0.242
NP_441633.1_3 Reverse -360 -373 -6.96221 0.283
NP_442998.1_5 Forward -74 -64 7.94484 0.278
NP_442998.1_10 Reverse -189 -196 3.97235 0.297
NP_440299.1_1 Reverse -358 -371 2.57534 0.284
NP_441449.1_8 Forward -264 -245 14.4695 0.24
NP_440709.1_2 Reverse -103 -117 23.5 0.000895
NP_442283.1_7 Reverse -145 -164 15.7324 0.255
NP_441559.1_8 Reverse -357 -371 5.60446 0.0879
NP_440997.1_6 Forward -195 -176 18.0924 0.0808
NP_441179.1_9 Forward -228 -218 12.9592 0.272
NP_441939.1_2 Reverse -193 -212 21.0423 0.086
NP_441199.1_7 Forward -120 -101 10.3242 0.136
NP_442993.1_1 Reverse -362 -378 -1.90808 0.103
NP_442993.1_1 Reverse -220 -236 -12.3312 0.27
NP_440677.1_1 Reverse -353 -372 9.14423 0.187
NP_442386.1_9 Forward -92 -83 8.35743 0.201
NP_441340.1_9 Forward -307 -297 8.15881 0.256
NP_442327.1_3 Forward -185 -166 7.20922 0.26
NP_441297.1_4 Reverse -251 -270 15.9291 0.0734
NP_443028.1_4 Forward -333 -314 12.672 0.252
NP_442240.1_2 Reverse -207 -226 -12.4886 0.163
NP_440586.1_8 Forward -228 -221 5.64364 0.297
NP_440027.1_3 Reverse -151 -169 3.36165 0.273
NP_440027.1_4 Reverse -91 -110 6.63086 0.178
NP_440451.1_10 Reverse -72 -91 8.35677 0.264
NP_441138.1_7 Forward -296 -282 18.8791 0.205
NP_442368.1_10 Reverse -78 -97 16.2241 0.237
NP_442384.1_10 Forward -226 -213 1.29759 0.263
NP_442572.1_1 Reverse -218 -237 6.98095 0.254
NP_442262.1_10 Forward -90 -83 9.47889 0.187
NP_442832.1_3 Reverse -217 -236 13.5691 0.248
NP_441965.1_7 Reverse -63 -82 11.8967 0.285
NP_442280.1_10 Reverse -229 -247 11.0063 0.213
NP_440999.1_9 Reverse -358 -372 6.58777 0.0964
NP_442512.1_5 Forward -336 -317 10.2259 0.25
NP_441543.1_2 Reverse -188 -197 7.37455 0.127
NP_442845.1_2 Forward -226 -212 3.34284 0.294
NP_442710.1_7 Forward -322 -303 -4.53167 0.272
NP_440071.1_6 Forward -252 -238 14.8714 0.241
NP_440220.1_4 Reverse -55 -74 -3.24622 0.285
NP_443062.1_1 Forward -91 -73 5.6207 0.224
NP_443062.1_6 Forward -379 -360 5.40766 0.204
NP_440255.1_8 Forward -273 -254 14.7221 0.28
NP_442080.1_8 Forward -211 -192 7.7676 0.244
NP_441443.1_10 Reverse -78 -96 0.0184138 0.293
NP_440673.1_3 Reverse -208 -215 8.98723 0.203
NP_440673.1_3 Reverse -58 -65 6.23397 0.283
NP_441052.1_2 Forward -226 -216 1.74999 0.229
NP_442864.1_7 Reverse -333 -351 6.50899 0.274
NP_441004.1_1 Reverse -334 -353 -15.5368 0.275
NP_440129.1_10 Reverse -355 -369 3.63784 0.191
NP_440296.1_10 Forward -362 -343 -3.04881 0.209
NP_442206.1_1 Forward -100 -81 -12.9802 0.241
NP_441228.1_3 Reverse -240 -259 17.994 0.091
NP_443054.1_2 Reverse -201 -215 0.786239 0.254
NP_441851.1_10 Forward -197 -187 4.3066 0.277
NP_441982.1_6 Forward -75 -66 14.2042 0.274
NP_441982.1_6 Reverse -192 -201 11.4349 0.288
NP_440463.1_8 Reverse -55 -74 7.79033 0.264
NP_441477.1_10 Reverse -210 -228 4.73903 0.201
NP_441124.1_5 Reverse -310 -320 12.6262 0.216
NP_439950.1_1 Forward -360 -351 16.126 0.145
NP_441003.1_9 Forward -257 -238 11.4058 0.213
NP_441078.1_4 Reverse -187 -196 -1.27858 0.246
NP_441078.1_4 Forward -196 -187 -2.06522 0.295
NP_442729.1_5 Reverse -262 -272 7.55152 0.29
NP_442729.1_7 Reverse -61 -79 7.29564 0.276
NP_442388.1_3 Forward -232 -213 14.0608 0.152
NP_441432.1_8 Forward -66 -57 2.75299 0.287
NP_441333.1_1 Reverse -319 -329 13.4012 0.217
NP_442815.1_2 Forward -76 -58 4.34571 0.243
NP_440760.1_1 Reverse -187 -206 -23.305 0.293
NP_442797.1_6 Reverse -58 -77 7.25546 0.294
NP_442489.1_7 Forward -371 -362 -1.57357 0.213
NP_442763.1_8 Reverse -249 -268 1.0811 0.283
NP_441659.2_8 Forward -91 -81 -0.118297 0.287
NP_441800.1_7 Reverse -114 -132 -2.3408 0.263
NP_442346.1_5 Reverse -216 -226 10.0098 0.11
NP_442346.1_5 Forward -216 -206 5.09324 0.262
NP_440352.1_5 Forward -316 -297 17.6199 0.0679
NP_440486.1_4 Forward -90 -72 -4.40575 0.248
NP_440486.1_6 Forward -99 -80 10.8159 0.216
NP_440250.1_4 Reverse -311 -330 3.24359 0.272
NP_441888.1_7 Reverse -357 -371 1.96621 0.232
NP_441948.1_4 Reverse -330 -348 -3.32411 0.19
NP_440170.1_1 Reverse -209 -228 17.5024 0.0234
NP_442140.1_3 Forward -228 -218 5.97822 0.189
NP_442140.1_3 Forward -90 -80 4.40493 0.243
NP_442140.1_3 Reverse -83 -93 3.42162 0.297
NP_440590.1_4 Forward -249 -236 -1.849 0.23
NP_440590.1_7 Forward -205 -191 14.5526 0.266
NP_441239.1_9 Forward -93 -81 10.7571 0.0723
NP_442568.1_8 Forward -295 -281 12.4876 0.257
NP_441508.1_1 Forward -116 -97 18.7269 0.0922
NP_442083.1_9 Forward -251 -232 13.4708 0.163
NP_440833.1_6 Forward -275 -261 7.27547 0.282
NP_442899.1_4 Forward -322 -306 9.10428 0.232
NP_440868.1_4 Reverse -216 -228 1.21895 0.19
NP_441879.1_1 Reverse -66 -85 1.86774 0.237
NP_440270.1_6 Forward -277 -258 7.27595 0.282
NP_441868.1_4 Reverse -331 -345 18.2892 0.166
NP_442402.1_1 Reverse -290 -309 8.25926 0.278
NP_442402.1_4 Reverse -290 -309 -9.04772 0.285
NP_441848.1_4 Forward -312 -296 12.7072 0.199
NP_439942.1_2 Reverse -157 -176 12.3079 0.271
NP_442358.1_6 Forward -70 -52 14.9655 0.129
NP_441053.1_8 Reverse -284 -303 20.1573 0.0391
NP_440805.1_8 Forward -181 -162 8.75091 0.269
NP_440160.1_1 Forward -121 -102 12.8303 0.205
NP_440351.1_8 Reverse -199 -217 5.72234 0.266
NP_442533.1_6 Forward -91 -82 4.22796 0.186
NP_442533.1_6 Reverse -217 -226 4.12963 0.191
NP_442202.1_6 Forward -331 -312 0.884433 0.265
NP_441527.1_4 Forward -248 -229 -6.7326 0.224
NP_441527.1_7 Reverse -51 -70 15.7316 0.227
NP_440115.1_6 Forward -218 -208 7.25653 0.152
NP_441972.1_5 Reverse -351 -370 -8.85033 0.272
NP_441106.1_3 Reverse -98 -117 9.83255 0.296
NP_441815.1_6 Reverse -351 -370 1.86696 0.24
NP_001035870.1_3 Reverse -71 -90 -4.13045 0.278
NP_440886.1_7 Reverse -361 -371 12.3692 0.0805
NP_442614.1_2 Forward -196 -182 10.0294 0.235
NP_440404.1_9 Forward -307 -288 7.87766 0.263
NP_439999.1_3 Reverse -186 -205 22.3197 0.0195
NP_441626.1_2 Forward -195 -188 5.05399 0.238
NP_442209.1_6 Forward -272 -253 17.0107 0.185
NP_441962.1_4 Reverse -77 -96 -10.227 0.224
NP_440814.1_8 Forward -77 -58 2.3594 0.269
NP_442805.1_5 Reverse -352 -371 -3.34455 0.262
NP_441510.2_7 Forward -226 -212 13.4703 0.28
NP_440293.1_3 Reverse -75 -94 -6.68705 0.291
NP_439988.1_10 Forward -85 -66 12.3837 0.213
NP_442743.1_1 Reverse -62 -81 8.94676 0.262
NP_441496.1_1 Reverse -291 -305 15.5768 0.265
NP_442514.1_5 Forward -274 -255 -2.95123 0.222
NP_442514.1_5 Reverse -249 -268 -7.17944 0.275
NP_441275.1_1 Reverse -99 -117 20.177 0.0059
NP_442341.1_7 Reverse -361 -375 3.04785 0.237
NP_440552.1_8 Reverse -102 -119 9.79232 0.287
NP_443060.1_5 Reverse -209 -228 6.78348 0.235
NP_442638.1_3 Forward -327 -308 10.074 0.298
NP_441122.1_1 Reverse -213 -228 10.5996 0.238
NP_441122.1_1 Reverse -78 -93 4.01147 0.28
NP_441105.1_3 Reverse -199 -218 -8.06369 0.265
NP_440216.1_9 Forward -89 -80 15.4377 0.132
NP_440216.1_9 Forward -309 -300 6.09625 0.289
NP_440249.1_2 Reverse -169 -179 13.9425 0.29
NP_441485.1_8 Reverse -206 -225 18.3873 0.125
NP_441111.1_7 Reverse -188 -196 -0.668896 0.274
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGTAGCCCAATCAAGTCTTGAGATTAACGGAGGTTGCCGGGGAGATTTACTACAGGTACCCCAGGCCAGAAAACCTAAAAAATTTAGGAACTATGGAAAAATTACAGAATGCCGAAGAAGTGAAGTACACCTTGCCCAGAGACAAGCTCGAGGATCAGGGCAGAGGAAAAACCGATCATGGCCAAGCGACCATTCCAGTTTTCGGCGAAAGCAGTGAATCCAAATTTAGAGTTTTCGTTGTTCATGGTTAAGAATGTAATTACGAGCTGGGAGGGTTGTCTATGTAAATAAATGTAACAGAGTATTGCGCCCATGGCAAGTCTGTGGTGAAAAAGGCAACGGGAGGATAATGTTAGGCTCAAACAGAACAGAAGTGACTAACCTTCGGAGAACAAGGCA

CDS

ATGTTGGCCCTAATTTTGGCGATCGCCCTGTTGTGGGGCTTGATCTGGTGGGCTAGGCGTAGATCAGGTCGGAAAATTGCCTGGAGCAGAGGCCGTCGTCATTCATCAGGTTTCAAGCAGGCCATCCAAGCTTCCCGCCCAACATCACCCAGGGTGCCCGGTAAGTTACGGCGGGATCTAATTCGTATTGCGGGCAATGCCCAGGTAGCGGAAAGACTGGTAACCAATCTACGGGCCAAACATCCTGATCGCCCGGAGCACTGGTATTGGGAAAAGGCAATTTTTGACCTGGAGCGCGATCGCCATTATTAG

Protein

MLALILAIALLWGLIWWARRRSGRKIAWSRGRRHSSGFKQAIQASRPTSPRVPGKLRRDLIRIAGNAQVAERLVTNLRAKHPDRPEHWYWEKAIFDLERDRHY