Your browser is old and dusty. Try Google Chrome!

Details for slr0879

ORF slr0879
Accession NP_440920.1
Symbol
Category Amino acids and amines
Definition glycine decarboxylase complex H-protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -296 -310 18.7808 0.0177
NP_440557.1_1 Forward -24 -5 -0.688862 0.27
NP_441418.1_6 Reverse -295 -314 -21.6334 0.156
NP_441418.1_6 Reverse -47 -66 -29.1065 0.216
NP_441418.1_6 Forward -392 -373 -29.9915 0.249
NP_441418.1_6 Reverse -16 -35 -30.4831 0.28
NP_442538.1_1 Reverse -358 -377 17.4032 0.25
NP_441453.1_4 Reverse -295 -303 4.14932 0.264
NP_442151.1_6 Reverse -301 -315 5.50613 0.274
NP_441818.1_9 Reverse -51 -70 -8.85033 0.283
NP_441098.1_5 Reverse -291 -310 9.63589 0.284
NP_440150.1_6 Forward -307 -288 5.99764 0.229
NP_442744.1_8 Reverse -301 -320 -6.58872 0.297
NP_442655.1_2 Reverse -86 -105 4.62101 0.23
NP_443002.1_5 Forward -376 -358 8.6715 0.297
NP_442173.1_1 Reverse -193 -201 5.42762 0.207
NP_442752.1_4 Reverse -147 -154 5.44732 0.202
NP_443027.1_4 Reverse -175 -185 5.87989 0.294
NP_441225.1_4 Forward -308 -289 -11.6036 0.284
NP_441934.1_9 Forward -379 -360 16.2241 0.161
NP_440110.1_8 Forward -379 -360 -1.47551 0.241
NP_441054.1_4 Reverse -285 -303 -1.75081 0.208
NP_441145.1_1 Forward -305 -286 5.99764 0.254
NP_440878.1_9 Reverse -358 -377 -0.885524 0.221
NP_442062.1_8 Reverse -295 -305 12.3697 0.033
NP_442062.1_8 Reverse -147 -157 9.51814 0.0613
NP_442974.1_8 Forward -85 -66 16.2232 0.294
NP_440304.1_4 Forward -306 -296 6.96153 0.137
NP_440304.1_4 Reverse -14 -24 5.68323 0.196
NP_441492.1_1 Forward -169 -150 10.3242 0.182
NP_442207.1_5 Forward -73 -54 11.7008 0.249
NP_441208.1_9 Forward -337 -323 4.91614 0.282
NP_441594.1_6 Reverse -365 -384 12.5858 0.109
NP_441594.1_6 Forward -380 -361 0.0977854 0.293
NP_442742.1_1 Reverse -360 -379 12.4875 0.297
NP_442726.1_7 Forward -384 -366 -0.669169 0.262
NP_441925.1_4 Reverse -126 -145 -7.47443 0.195
NP_441925.1_4 Forward -303 -284 -12.4893 0.254
NP_441925.1_4 Forward -76 -57 -16.5208 0.284
NP_441772.1_6 Reverse -146 -165 20.1573 0.0172
NP_440856.1_7 Forward -395 -376 -4.81876 0.224
NP_440856.1_7 Forward -377 -358 -7.96535 0.261
NP_441083.1_5 Reverse -295 -305 0.668351 0.22
NP_441738.1_2 Forward -154 -147 10.2652 0.101
NP_441942.1_7 Forward -138 -119 10.9142 0.282
NP_442445.1_1 Reverse -296 -315 11.9958 0.266
NP_441716.1_1 Reverse -295 -309 14.4542 0.0689
NP_441163.1_1 Forward -384 -367 3.97136 0.297
NP_440481.1_6 Forward -348 -330 12.2122 0.294
NP_440343.1_3 Reverse -121 -139 10.3431 0.171
NP_440747.1_10 Forward -307 -295 -2.22263 0.026
NP_441486.1_1 Reverse -292 -306 7.47274 0.0344
NP_441880.2_10 Forward -303 -285 9.55725 0.234
NP_442634.1_2 Reverse -305 -324 -0.787193 0.297
NP_441695.1_4 Forward -64 -46 12.8022 0.22
NP_441014.1_8 Reverse -247 -266 2.65439 0.214
NP_441012.1_4 Forward -308 -295 13.294 0.217
NP_441012.1_4 Reverse -297 -310 6.50913 0.278
NP_443018.1_3 Reverse -296 -303 10.7572 0.0907
NP_443018.1_3 Forward -303 -296 4.56234 0.241
NP_441634.1_8 Forward -306 -292 3.73617 0.143
NP_441634.1_8 Forward -379 -365 1.96621 0.175
NP_441634.1_8 Reverse -275 -289 -0.393733 0.255
NP_441634.1_8 Forward -300 -286 -1.77037 0.295
NP_441634.1_8 Reverse -363 -377 -3.34366 0.295
NP_440376.1_1 Forward -304 -295 6.48957 0.0963
NP_440376.1_1 Reverse -295 -304 6.19458 0.109
NP_442687.1_7 Reverse -294 -304 4.60159 0.243
NP_442191.1_4 Forward -373 -359 15.9379 0.0454
NP_440066.1_5 Reverse -358 -377 8.06178 0.256
NP_442485.1_3 Reverse -363 -382 12.9791 0.105
NP_442485.1_3 Reverse -372 -391 9.14423 0.123
NP_442485.1_3 Reverse -290 -309 -0.885524 0.254
NP_440042.1_2 Reverse -201 -220 0.392778 0.213
NP_442766.1_6 Reverse -363 -377 17.6002 0.239
NP_441422.1_7 Reverse -360 -377 -2.61609 0.218
NP_440141.1_4 Reverse -292 -311 -5.31042 0.296
NP_440141.1_8 Reverse -280 -299 9.24257 0.227
NP_440141.1_8 Reverse -359 -378 8.55425 0.23
NP_440141.1_8 Reverse -368 -387 5.50599 0.273
NP_442782.1_2 Reverse -16 -30 7.37441 0.202
NP_442782.1_2 Reverse -53 -67 1.17956 0.282
NP_442496.1_5 Forward -255 -237 6.01734 0.285
NP_440607.1_5 Reverse -44 -63 -0.787193 0.279
NP_441256.1_1 Reverse -292 -311 -7.67036 0.239
NP_442937.1_5 Reverse -369 -388 9.0459 0.204
NP_441127.1_1 Reverse -365 -379 15.5359 0.114
NP_440203.1_5 Reverse -298 -308 15.7125 0.0611
NP_443001.1_7 Forward -316 -297 10.3242 0.166
NP_441097.1_2 Forward -366 -349 5.15205 0.269
NP_442911.1_2 Forward -314 -295 -5.50708 0.16
NP_442911.1_2 Reverse -261 -280 -7.17871 0.202
NP_441580.1_6 Reverse -363 -382 -6.49039 0.235
NP_440153.1_8 Forward -377 -364 -2.144 0.235
NP_442064.1_4 Reverse -291 -310 4.42355 0.287
NP_443055.1_6 Forward -294 -276 3.16499 0.2
NP_443055.1_6 Reverse -326 -344 2.77167 0.203
NP_443055.1_6 Reverse -348 -366 -1.84987 0.284
NP_440993.1_4 Reverse -295 -312 8.7903 0.216
NP_440827.1_3 Reverse -249 -268 13.1758 0.226
NP_441348.1_7 Reverse -53 -72 6.98095 0.289
NP_441294.1_7 Reverse -307 -321 10.5945 0.181
NP_441646.1_1 Forward -311 -292 0.58944 0.247
NP_442438.1_10 Reverse -296 -310 5.40779 0.134
NP_440147.1_1 Reverse -289 -308 5.50599 0.254
NP_441550.1_8 Forward -203 -193 5.87944 0.224
NP_441916.1_7 Forward -304 -294 5.97822 0.111
NP_441916.1_10 Reverse -293 -312 -0.000545616 0.294
NP_441041.1_4 Forward -310 -291 -10.522 0.233
NP_441041.1_4 Reverse -41 -60 -11.4069 0.246
NP_441041.1_4 Forward -304 -285 -13.8652 0.297
NP_441547.1_2 Forward -315 -297 6.60732 0.215
NP_441725.1_5 Reverse -296 -306 7.15819 0.103
NP_441725.1_8 Reverse -364 -383 8.65258 0.273
NP_439966.1_7 Reverse -293 -303 4.99446 0.248
NP_442941.1_3 Reverse -296 -306 0.275027 0.222
NP_440983.1_5 Reverse -356 -375 -0.787193 0.228
NP_440983.1_5 Forward -310 -291 -6.1954 0.276
NP_440260.1_8 Reverse -292 -310 4.34571 0.154
NP_442281.1_1 Forward -309 -295 11.7987 0.0437
NP_441079.1_1 Forward -335 -316 21.2389 0.0887
NP_441644.1_6 Reverse -295 -305 11.6809 0.0448
NP_442215.1_2 Forward -319 -303 13.4315 0.0232
NP_442215.1_2 Reverse -293 -309 3.10679 0.102
NP_442215.1_2 Forward -313 -297 -3.77637 0.222
NP_442215.1_2 Forward -114 -98 -4.07137 0.227
NP_442177.1_5 Forward -21 -7 9.14437 0.247
NP_442029.1_6 Forward -217 -198 6.88262 0.232
NP_440253.1_2 Reverse -277 -295 0.0191479 0.198
NP_442933.1_10 Forward -304 -295 4.52295 0.24
NP_441751.2_8 Reverse -296 -310 -1.96703 0.132
NP_442554.1_8 Reverse -296 -306 5.5849 0.145
NP_442554.1_8 Forward -303 -293 3.61828 0.218
NP_442554.1_8 Reverse -302 -312 3.61828 0.218
NP_441762.1_7 Reverse -364 -376 -5.07423 0.187
NP_442142.1_4 Forward -307 -294 7.88518 0.127
NP_442142.1_4 Reverse -292 -305 4.24695 0.227
NP_442292.1_1 Reverse -296 -305 5.70292 0.135
NP_442292.1_5 Forward -321 -302 0.491109 0.257
NP_440919.1_1 Forward -322 -303 -6.1954 0.258
NP_441711.1_4 Forward -279 -260 2.26107 0.294
NP_443009.1_5 Forward -305 -294 7.72798 0.122
NP_442301.1_2 Reverse -364 -383 7.66846 0.245
NP_440357.1_3 Reverse -365 -384 6.39097 0.237
NP_440357.1_3 Forward -345 -326 -1.27885 0.299
NP_441448.1_2 Reverse -303 -322 0.883656 0.216
NP_440379.1_5 Forward -377 -358 0.392778 0.172
NP_440379.1_5 Reverse -365 -384 0.294447 0.172
NP_440379.1_5 Forward -374 -355 -2.45882 0.198
NP_440379.1_5 Reverse -292 -311 -4.6221 0.215
NP_441468.1_1 Forward -303 -296 4.07068 0.263
NP_440920.1_1 Forward -384 -365 22.5172 0.00882
NP_441618.1_8 Reverse -51 -70 19.764 0.0476
NP_441020.2_6 Reverse -45 -62 6.33202 0.267
NP_441673.1_1 Forward -304 -295 1.37636 0.114
NP_441673.1_1 Reverse -295 -304 1.1797 0.163
NP_441876.1_9 Forward -185 -175 12.4676 0.267
NP_441826.1_2 Forward -310 -296 3.63784 0.107
NP_442719.1_2 Reverse -286 -304 -11.1913 0.29
NP_442719.1_2 Reverse -240 -258 -11.5846 0.292
NP_442808.1_1 Reverse -294 -304 6.56775 0.107
NP_442808.1_1 Reverse -210 -220 3.91283 0.218
NP_442808.1_1 Reverse -249 -259 2.73286 0.256
NP_442808.1_1 Forward -395 -385 1.84789 0.281
NP_442808.1_1 Forward -296 -286 1.25791 0.289
NP_441101.1_10 Reverse -126 -145 -7.86702 0.293
NP_442542.1_2 Reverse -366 -379 8.27909 0.158
NP_442542.1_9 Reverse -361 -375 10.9137 0.111
NP_440342.1_2 Forward -377 -358 8.84924 0.264
NP_441114.1_3 Forward -285 -276 7.86621 0.231
NP_440558.1_2 Reverse -292 -311 -0.39387 0.203
NP_440558.1_2 Forward -320 -301 -0.4922 0.203
NP_440558.1_2 Forward -308 -289 -3.04881 0.232
NP_440558.1_2 Reverse -298 -317 -4.52377 0.246
NP_441878.1_6 Forward -305 -295 2.24165 0.0462
NP_441878.1_6 Reverse -294 -304 1.16001 0.11
NP_441878.1_6 Reverse -307 -317 -7.49312 0.231
NP_441036.1_7 Reverse -10 -20 15.8108 0.292
NP_442650.1_2 Forward -310 -296 4.12949 0.19
NP_441557.1_5 Forward -304 -295 0.491382 0.144
NP_441557.1_5 Reverse -295 -304 0.29472 0.174
NP_441445.1_1 Reverse -286 -305 7.17762 0.138
NP_442830.1_5 Forward -288 -274 -0.787633 0.299
NP_442183.1_1 Reverse -147 -161 7.27608 0.145
NP_442183.1_1 Forward -392 -378 4.91614 0.239
NP_442183.1_1 Reverse -295 -309 3.73617 0.299
NP_442166.1_7 Forward -373 -359 17.3058 0.129
NP_442170.1_5 Forward -201 -182 -1.67217 0.254
NP_441037.1_4 Forward -336 -326 8.29227 0.237
NP_442047.1_2 Forward -149 -135 11.701 0.297
NP_441633.1_3 Forward -385 -372 -5.78224 0.236
NP_442590.1_10 Forward -323 -304 7.7676 0.219
NP_442590.1_10 Reverse -289 -308 7.17762 0.23
NP_442998.1_5 Forward -250 -240 10.7964 0.204
NP_442998.1_5 Reverse -106 -116 10.6981 0.206
NP_440299.1_1 Reverse -297 -310 6.21356 0.149
NP_440299.1_1 Forward -308 -295 3.55864 0.241
NP_440299.1_1 Forward -60 -47 2.37867 0.291
NP_441799.1_1 Reverse -291 -305 5.1122 0.223
NP_440640.1_9 Reverse -308 -327 13.9625 0.281
NP_440087.1_1 Reverse -48 -67 -8.55534 0.28
NP_441559.1_8 Reverse -246 -260 -3.63866 0.207
NP_441559.1_8 Forward -299 -285 -6.58858 0.279
NP_441559.1_8 Reverse -290 -304 -6.68692 0.279
NP_441559.1_8 Forward -309 -295 -7.57189 0.295
NP_441559.1_10 Forward -268 -249 12.7825 0.143
NP_440717.1_1 Forward -376 -357 9.93088 0.24
NP_441866.1_6 Reverse -293 -312 6.29183 0.29
NP_440134.1_2 Forward -259 -240 -0.197208 0.298
NP_442866.1_1 Reverse -290 -309 1.47442 0.158
NP_442866.1_1 Forward -322 -303 -4.42544 0.227
NP_440748.1_5 Reverse -214 -233 5.60432 0.193
NP_441464.1_8 Reverse -131 -145 8.16106 0.2
NP_441464.1_8 Forward -298 -284 4.42448 0.273
NP_442993.1_1 Forward -304 -288 -1.80975 0.101
NP_442993.1_1 Reverse -233 -249 -11.0529 0.233
NP_442386.1_9 Forward -305 -296 8.06244 0.209
NP_442386.1_9 Reverse -294 -303 4.7192 0.289
NP_440570.1_5 Reverse -37 -56 5.11266 0.204
NP_440570.1_5 Forward -314 -295 0.392778 0.254
NP_441340.1_5 Reverse -296 -303 3.97235 0.274
NP_440622.1_7 Reverse -356 -375 15.0441 0.265
NP_441947.1_10 Reverse -293 -311 1.98577 0.276
NP_440597.1_9 Forward -246 -232 18.4858 0.275
NP_441776.1_5 Forward -344 -325 15.7324 0.229
NP_440586.1_1 Reverse -364 -383 -0.885524 0.237
NP_440586.1_1 Forward -381 -362 -5.11376 0.28
NP_440586.1_8 Reverse -302 -309 5.8403 0.283
NP_440192.1_4 Reverse -234 -253 10.9499 0.227
NP_440027.1_3 Forward -72 -54 2.77167 0.286
NP_440027.1_3 Forward -304 -286 2.37835 0.29
NP_440027.1_8 Reverse -292 -311 9.04509 0.243
NP_440027.1_8 Reverse -358 -377 3.9319 0.294
NP_439937.1_8 Reverse -360 -379 4.12936 0.202
NP_442294.1_3 Reverse -234 -248 12.3887 0.289
NP_440398.1_2 Reverse -359 -378 2.65439 0.237
NP_440408.1_2 Forward -376 -358 12.9988 0.288
NP_440408.1_7 Reverse -9 -28 11.9958 0.212
NP_440408.1_7 Reverse -295 -314 9.24257 0.264
NP_442239.1_8 Reverse -47 -66 15.5357 0.205
NP_440271.1_2 Forward -313 -294 5.211 0.247
NP_440574.1_3 Reverse -290 -309 1.96607 0.173
NP_440819.1_5 Forward -250 -242 7.68924 0.266
NP_441803.1_2 Forward -382 -363 4.62101 0.177
NP_441803.1_2 Forward -303 -284 -0.4922 0.279
NP_442384.1_10 Forward -304 -291 4.93583 0.142
NP_442384.1_10 Reverse -311 -324 1.29759 0.263
NP_441877.1_7 Forward -388 -369 16.1249 0.0595
NP_441877.1_7 Reverse -5 -24 13.0766 0.1
NP_441018.1_7 Reverse -49 -68 8.65258 0.241
NP_441018.1_7 Forward -314 -295 8.06259 0.256
NP_441018.1_7 Reverse -291 -310 6.4893 0.286
NP_442262.1_10 Reverse -296 -303 9.87221 0.164
NP_440163.1_10 Forward -380 -370 10.1081 0.206
NP_440163.1_10 Reverse -292 -302 7.94484 0.297
NP_440163.1_10 Forward -301 -291 7.84651 0.299
NP_440344.1_10 Forward -293 -276 -11.1709 0.205
NP_440344.1_10 Reverse -376 -393 -13.9242 0.298
NP_440282.1_10 Reverse -267 -286 -5.70374 0.25
NP_440531.1_6 Forward -384 -365 -2.36049 0.249
NP_441640.1_8 Forward -322 -303 -6.29373 0.299
NP_440297.1_9 Reverse -296 -306 7.05986 0.15
NP_440297.1_9 Forward -303 -293 0.57002 0.282
NP_440297.1_9 Forward -309 -299 -0.118297 0.282
NP_440894.1_10 Reverse -243 -262 2.3594 0.29
NP_440999.1_2 Reverse -135 -154 10.4225 0.251
NP_440999.1_9 Forward -60 -46 7.17775 0.0896
NP_440999.1_9 Reverse -364 -378 1.27789 0.168
NP_440999.1_9 Reverse -291 -305 -2.95034 0.281
NP_440888.1_2 Reverse -295 -309 13.077 0.0339
NP_440888.1_2 Forward -377 -363 6.19383 0.243
NP_441748.1_3 Forward -325 -306 13.193 0.247
NP_441543.1_2 Reverse -296 -305 5.01461 0.209
NP_442845.1_2 Forward -310 -296 5.50613 0.231
NP_442845.1_2 Reverse -271 -285 3.24451 0.298
NP_440380.1_1 Reverse -356 -375 -10.4236 0.284
NP_441469.1_8 Reverse -294 -303 5.50626 0.265
NP_440710.1_1 Forward -385 -367 -8.53565 0.269
NP_440071.1_6 Reverse -47 -61 14.1927 0.25
NP_440220.1_4 Forward -63 -44 -3.04956 0.285
NP_441621.1_7 Reverse -372 -386 4.32615 0.0934
NP_441621.1_7 Forward -373 -359 -3.83532 0.195
NP_441621.1_7 Forward -376 -362 -4.22864 0.214
NP_441621.1_7 Reverse -363 -377 -5.01529 0.248
NP_440668.1_3 Forward -73 -54 7.86593 0.213
NP_443062.1_1 Forward -156 -138 5.6207 0.224
NP_443062.1_6 Forward -312 -293 11.6025 0.103
NP_440519.1_8 Reverse -371 -387 4.28677 0.228
NP_442204.1_1 Forward -308 -297 0.94365 0.281
NP_442600.1_5 Reverse -313 -332 23.3039 0.0417
NP_441033.1_2 Forward -296 -277 -9.44032 0.293
NP_442428.1_5 Forward -303 -296 4.46401 0.267
NP_442120.1_10 Reverse -289 -308 -7.27704 0.217
NP_440673.1_2 Reverse -364 -383 14.0966 0.103
NP_440673.1_2 Reverse -291 -310 8.73121 0.263
NP_440673.1_3 Reverse -297 -304 8.98723 0.203
NP_441052.1_2 Forward -286 -276 12.2714 0.0285
NP_441052.1_2 Reverse -295 -305 7.25653 0.0765
NP_441052.1_2 Forward -383 -373 2.43831 0.204
NP_440436.1_4 Reverse -296 -305 11.0124 0.0655
NP_441884.1_9 Reverse -380 -399 -20.65 0.199
NP_441884.1_9 Reverse -305 -324 -24.0916 0.284
NP_441004.1_1 Reverse -368 -387 -15.4385 0.275
NP_441004.1_1 Forward -254 -235 -18.0934 0.297
NP_441004.1_2 Forward -259 -240 -3.24547 0.274
NP_442813.1_4 Forward -27 -8 -7.76869 0.299
NP_442366.1_3 Reverse -294 -312 22.1436 0.00634
NP_442366.1_3 Reverse -300 -318 1.69077 0.144
NP_442139.1_9 Reverse -298 -317 9.43923 0.264
NP_440323.1_6 Forward -21 -3 14.7688 0.215
NP_440328.1_4 Reverse -141 -160 3.24438 0.184
NP_442312.1_1 Forward -316 -297 9.83255 0.282
NP_440094.1_2 Reverse -296 -315 -3.14714 0.281
NP_443054.1_2 Forward -306 -292 3.63784 0.24
NP_441851.1_10 Forward -305 -295 4.60159 0.259
NP_441851.1_10 Reverse -294 -304 4.50326 0.266
NP_442856.1_7 Reverse -292 -311 -4.03212 0.254
NP_441668.1_4 Forward -314 -295 1.96607 0.207
NP_442515.1_1 Forward -305 -291 -0.688726 0.231
NP_442515.1_1 Reverse -307 -321 -2.06536 0.268
NP_440593.1_3 Forward -303 -284 1.0811 0.19
NP_440593.1_3 Forward -315 -296 0.0977854 0.198
NP_440593.1_9 Forward -380 -366 10.521 0.24
NP_440593.1_9 Reverse -362 -376 8.84938 0.255
NP_441982.1_6 Forward -251 -242 12.4854 0.275
NP_440463.1_8 Reverse -358 -377 14.9545 0.168
NP_441409.1_6 Reverse -289 -308 -8.35868 0.167
NP_440432.1_9 Forward -155 -140 -6.01829 0.28
NP_442843.1_1 Reverse -48 -67 -11.3086 0.288
NP_439960.1_10 Reverse -358 -376 10.0489 0.105
NP_439960.1_10 Forward -387 -369 -1.16082 0.242
NP_440474.1_8 Forward -303 -289 7.07881 0.21
NP_442450.1_5 Forward -188 -178 8.82982 0.124
NP_440588.1_2 Forward -313 -294 -4.32711 0.214
NP_441031.1_8 Reverse -326 -345 -4.91709 0.268
NP_442006.1_2 Reverse -359 -376 -6.54933 0.164
NP_442006.1_2 Reverse -134 -151 -16.5791 0.256
NP_440078.1_10 Forward -310 -291 3.14605 0.269
NP_441078.1_4 Forward -304 -295 8.1612 0.039
NP_441078.1_4 Forward -286 -277 3.44131 0.14
NP_441078.1_4 Reverse -295 -304 0.983037 0.151
NP_442348.1_2 Reverse -237 -246 12.2911 0.218
NP_442348.1_2 Reverse -236 -245 7.47288 0.28
NP_442443.1_1 Forward -216 -197 -4.81876 0.278
NP_441432.1_8 Forward -305 -296 15.0444 0.0182
NP_441732.1_2 Forward -308 -292 -16.2644 0.165
NP_442797.1_6 Reverse -235 -254 7.54634 0.283
NP_441131.1_5 Forward -305 -286 10.8159 0.155
NP_440199.1_10 Forward -301 -291 7.05986 0.242
NP_439900.1_3 Reverse -283 -297 19.5675 0.111
NP_442353.1_4 Reverse -362 -381 10.1267 0.118
NP_442353.1_4 Reverse -302 -321 5.89851 0.183
NP_441072.1_2 Forward -212 -193 5.89931 0.296
NP_442489.1_7 Forward -304 -295 8.1612 0.0294
NP_442489.1_7 Reverse -295 -304 7.76787 0.0518
NP_441659.2_8 Reverse -295 -305 6.27322 0.0797
NP_441659.2_8 Forward -201 -191 1.94665 0.22
NP_442913.1_10 Reverse -280 -299 -4.81876 0.248
NP_441040.1_2 Forward -20 -1 1.47442 0.119
NP_442346.1_5 Forward -305 -295 13.1564 0.029
NP_442346.1_10 Reverse -284 -303 1.57275 0.214
NP_440545.1_3 Forward -308 -291 -0.0594896 0.147
NP_441629.1_1 Reverse -287 -306 7.7676 0.251
NP_441629.1_3 Reverse -247 -266 -2.36125 0.269
NP_440555.1_7 Reverse -354 -373 20.649 0.0859
NP_441923.1_6 Forward -370 -356 13.4709 0.201
NP_441126.1_5 Reverse -366 -385 4.22769 0.249
NP_440459.1_2 Reverse -359 -376 7.90532 0.276
NP_440459.1_2 Forward -272 -255 7.61033 0.285
NP_440010.1_3 Reverse -356 -375 -0.590531 0.25
NP_442551.1_4 Forward -319 -304 -0.905081 0.245
NP_442900.1_1 Forward -146 -127 -5.60541 0.238
NP_441233.1_2 Reverse -48 -67 15.3391 0.162
NP_441888.1_7 Forward -388 -374 5.21113 0.225
NP_441888.1_7 Forward -61 -47 2.2612 0.225
NP_441948.1_4 Reverse -358 -376 -4.50408 0.231
NP_442699.1_8 Reverse -100 -119 -2.26216 0.217
NP_440671.1_4 Forward -310 -296 10.521 0.155
NP_440224.1_1 Reverse -266 -285 -0.197208 0.14
NP_441915.1_4 Forward -378 -359 11.405 0.241
NP_442140.1_3 Reverse -302 -312 5.97822 0.189
NP_441671.1_1 Forward -379 -360 1.96607 0.263
NP_440875.1_9 Forward -154 -144 8.08002 0.243
NP_440821.1_4 Reverse -293 -303 -0.609952 0.279
NP_441239.1_9 Reverse -293 -305 4.8572 0.239
NP_441239.1_9 Forward -306 -294 4.5622 0.251
NP_441239.1_9 Forward -210 -198 4.07055 0.264
NP_440665.1_1 Reverse -353 -372 -5.31042 0.194
NP_440665.1_1 Reverse -356 -375 -16.2252 0.282
NP_442193.1_1 Forward -377 -359 11.4255 0.225
NP_440949.1_5 Forward -306 -287 17.5024 0.221
NP_440949.1_7 Forward -294 -275 10.6184 0.233
NP_440546.1_4 Forward -334 -324 6.74945 0.282
NP_440462.1_6 Reverse -145 -155 3.91327 0.224
NP_442340.1_3 Reverse -309 -328 -10.7186 0.291
NP_442340.1_3 Forward -375 -356 -11.2103 0.299
NP_440868.1_4 Reverse -291 -303 0.628964 0.206
NP_442499.1_1 Forward -309 -290 2.55606 0.289
NP_441868.1_4 Reverse -128 -142 16.1259 0.258
NP_441474.1_1 Forward -70 -51 -1.8696 0.267
NP_442402.1_2 Reverse -238 -252 10.1271 0.298
NP_442402.1_4 Reverse -233 -252 0.588665 0.182
NP_442402.1_6 Forward -253 -244 15.7327 0.241
NP_440696.1_3 Reverse -285 -303 2.57575 0.216
NP_440696.1_3 Forward -320 -302 -3.6191 0.287
NP_441843.2_9 Forward -154 -136 12.8263 0.205
NP_441811.1_8 Reverse -283 -297 5.70279 0.293
NP_440505.1_3 Forward -306 -296 5.5849 0.222
NP_440505.1_3 Reverse -275 -285 4.69992 0.272
NP_440505.1_3 Reverse -145 -155 4.50326 0.284
NP_441701.1_3 Reverse -43 -60 7.70866 0.257
NP_440520.1_1 Forward -378 -359 -4.91709 0.289
NP_442174.1_9 Reverse -14 -33 10.2259 0.173
NP_440914.1_2 Forward -364 -345 16.7157 0.297
NP_440914.1_4 Forward -64 -48 11.0709 0.271
NP_441011.1_8 Forward -382 -373 7.86621 0.165
NP_442533.1_1 Reverse -41 -60 -15.2418 0.253
NP_442533.1_6 Reverse -295 -304 8.25953 0.0776
NP_442533.1_6 Forward -304 -295 7.66954 0.0897
NP_442322.1_4 Forward -69 -52 -1.14182 0.226
NP_441482.1_7 Forward -310 -296 -11.2101 0.245
NP_441697.1_5 Reverse -77 -96 -5.87318 0.232
NP_441028.1_6 Reverse -242 -252 14.6309 0.158
NP_441028.1_6 Reverse -243 -253 5.78111 0.243
NP_441527.1_4 Reverse -172 -191 -9.2154 0.255
NP_440007.1_9 Reverse -292 -306 5.60446 0.251
NP_440007.1_9 Forward -28 -14 0.491246 0.297
NP_443045.1_2 Reverse -362 -381 16.6174 0.181
NP_441602.1_3 Forward -382 -363 -2.45882 0.233
NP_441972.1_5 Forward -315 -296 2.55606 0.121
NP_441972.1_5 Reverse -309 -328 -4.32711 0.21
NP_440429.1_2 Forward -382 -363 14.9458 0.176
NP_440429.1_2 Reverse -360 -379 9.43923 0.272
NP_440429.1_2 Forward -303 -284 6.98095 0.295
NP_441815.1_6 Reverse -240 -259 6.09517 0.187
NP_439903.1_6 Reverse -292 -311 1.57197 0.243
NP_442306.1_7 Forward -28 -9 16.5182 0.262
NP_441286.1_1 Forward -305 -293 -4.9759 0.183
NP_440670.1_8 Reverse -295 -304 5.3096 0.167
NP_440670.1_8 Forward -201 -192 3.93297 0.212
NP_440886.1_7 Reverse -294 -304 7.64939 0.0865
NP_440886.1_7 Forward -375 -365 6.76441 0.114
NP_440886.1_7 Reverse -373 -383 5.87944 0.158
NP_440886.1_7 Forward -287 -277 4.7978 0.218
NP_440886.1_7 Forward -60 -50 3.61784 0.272
NP_442072.1_9 Forward -202 -184 -13.0589 0.098
NP_441427.1_5 Forward -359 -340 9.24257 0.277
NP_441753.1_10 Reverse -316 -335 3.53937 0.214
NP_442264.1_2 Reverse -291 -308 16.3618 0.121
NP_441021.1_1 Reverse -296 -315 -9.047 0.206
NP_441021.1_1 Reverse -326 -345 -11.5053 0.267
NP_441463.1_3 Reverse -297 -316 -9.44032 0.28
NP_441463.1_6 Forward -306 -292 15.4029 0.152
NP_441463.1_6 Reverse -293 -307 10.2813 0.242
NP_442794.1_1 Forward -308 -296 14.592 0.0654
NP_442794.1_1 Forward -387 -375 4.07055 0.279
NP_441742.1_7 Forward -320 -301 13.7658 0.261
NP_440387.1_1 Reverse -295 -311 -4.85801 0.203
NP_441431.1_2 Forward -204 -190 5.70218 0.291
NP_441488.1_8 Forward -315 -301 8.55376 0.184
NP_441836.1_2 Reverse -289 -308 1.86774 0.185
NP_441993.1_1 Reverse -53 -72 3.89583 0.227
NP_441993.1_1 Reverse -326 -345 3.11618 0.241
NP_440114.1_10 Forward -304 -290 8.75105 0.195
NP_441858.1_6 Reverse -108 -127 16.3224 0.0751
NP_442698.1_10 Forward -308 -289 0.687771 0.297
NP_441510.2_7 Forward -310 -296 9.93039 0.281
NP_439988.1_3 Reverse -363 -377 4.03116 0.296
NP_441237.1_9 Reverse -148 -158 11.1898 0.196
NP_440798.1_6 Forward -200 -187 0.60927 0.254
NP_440942.1_6 Forward -210 -191 4.91521 0.281
NP_442439.1_8 Reverse -336 -355 7.37428 0.288
NP_441440.1_8 Reverse -47 -60 14.2773 0.299
NP_441885.1_5 Reverse -295 -305 1.84832 0.0957
NP_442341.1_7 Reverse -294 -308 6.09611 0.135
NP_442341.1_7 Forward -305 -291 4.42448 0.191
NP_442341.1_7 Forward -281 -267 4.03116 0.204
NP_442341.1_7 Reverse -307 -321 3.53951 0.22
NP_442341.1_9 Reverse -190 -204 13.4703 0.0816
NP_442341.1_9 Reverse -293 -307 6.0955 0.243
NP_441173.1_9 Reverse -243 -251 13.1954 0.184
NP_441173.1_9 Reverse -33 -41 10.9338 0.242
NP_442395.2_4 Reverse -294 -313 -0.00131823 0.28
NP_440423.1_6 Reverse -366 -385 -20.4534 0.259
NP_440076.1_5 Reverse -367 -386 12.1917 0.274
NP_440679.1_5 Reverse -304 -323 11.8975 0.252
NP_441635.1_5 Forward -100 -86 17.216 0.219
NP_439962.1_4 Reverse -132 -151 -3.44213 0.251
NP_439962.1_4 Forward -376 -357 -4.32711 0.269
NP_439962.1_4 Reverse -360 -379 -5.99873 0.28
NP_440175.1_4 Reverse -287 -306 -11.8003 0.21
NP_442495.1_3 Forward -150 -132 14.8671 0.242
NP_440149.1_8 Reverse -368 -387 2.3594 0.111
NP_440216.1_1 Reverse -185 -199 -11.8001 0.219
NP_440216.1_9 Forward -308 -299 7.76787 0.286
NP_440216.1_9 Reverse -256 -265 5.60459 0.292
NP_440172.1_1 Forward -304 -294 2.7333 0.268
NP_440172.1_1 Reverse -295 -305 2.33998 0.279
NP_442015.1_10 Forward -308 -295 6.60746 0.111
NP_442015.1_10 Reverse -297 -310 5.91914 0.13
NP_442015.1_10 Forward -387 -374 -0.570702 0.272
NP_441226.1_7 Reverse -193 -200 7.1186 0.218
NP_440416.1_9 Forward -311 -292 -16.2252 0.21
NP_440416.1_9 Forward -151 -132 -17.4051 0.239
NP_443052.1_9 Reverse -357 -376 6.4893 0.138
NP_443052.1_9 Forward -63 -44 0.491109 0.197
NP_442403.1_8 Reverse -291 -310 1.86774 0.235
NP_442154.1_1 Reverse -278 -296 -10.6006 0.209
NP_442154.1_1 Forward -26 -8 -15.6155 0.222
NP_442154.1_1 Forward -219 -201 -17.6804 0.262
NP_441430.1_6 Reverse -363 -382 17.0107 0.134
NP_440261.1_5 Forward -303 -290 -6.37223 0.201
NP_440988.1_10 Forward -379 -365 7.51277 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCCCCTTGGATACCCCCGTTATGGCCGCTGCCGCCGGGGAGGTGATTTTAGTTAGCCAGGAAGGGGCCTATGGTTTCCTGGTGGTCATTGACCATGGCAATGGCCGTCAAACCCGCTATGCCCATCTGAGTCGATTTGCGGTGGATCCTGGGGAAAAAGTCCCCGCTGGTACTGTAATTGGCTATGTAGGCAGTACTGGCCGACCGGATATTGCTTCATCCCATCTTCATTTTGAAGTAAGGGTTCAATCCCCTGTTGGTTGGGCGGCCCAGGATCCGAAGTTACATTTACCCCGCCCATAGTTAAACGATTTTCAGTCCTTTGTGGACCCAGGAACAACCCCTGCCTCCGCCATATTTTTGGTAAACTAACAACGCTGTTGCCTTTAGCGGTTTTGCC

CDS

ATGGAACTGGAACATCCTGACGATCTCTATTATTTGGATTCCCACGAGTACGTCCGCTTTGATGGGGAAACGGCCACCATTGGCCTGAGTGCCTTTGCCGTGGATGAGCTGGGGGATATTGTCTTTGTGGAGTTACCCGAAGAAGGGGACAAAGTGGAATTTGAGCAGTCCATGGGGGCAGTGGAATCGGTCAAGGCCGCCTCGGATTTATATTCCCCTGTGACGGGCACTGTGATCGAAAAAAACTCAGCTTTGGAAGATCAGCCGGAGTTGCTCAATCAAGACCCCTACGGGGAAGAAGGTTGGTTGATCAAGGTGCGCCTAGATGATGTGGAAGATGCCAAAGAAGGATTGATGGCCGCCGGAGACTACCGCGCCACCCTAGAGACGGGAGATTAG

Protein

MELEHPDDLYYLDSHEYVRFDGETATIGLSAFAVDELGDIVFVELPEEGDKVEFEQSMGAVESVKAASDLYSPVTGTVIEKNSALEDQPELLNQDPYGEEGWLIKVRLDDVEDAKEGLMAAGDYRATLETGD