Your browser is old and dusty. Try Google Chrome!

Details for slr0878

ORF slr0878
Accession NP_440919.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -7 -21 13.5693 0.168
NP_441061.1_2 Reverse -126 -140 17.9942 0.0206
NP_441061.1_3 Forward -368 -349 17.4032 0.128
NP_440557.1_1 Reverse -126 -145 25.8605 0.00738
NP_440795.1_4 Reverse -110 -129 24.778 0.014
NP_440795.1_7 Forward -133 -126 14.6904 0.0123
NP_440795.1_7 Reverse -126 -133 14.6904 0.0123
NP_441418.1_6 Reverse -125 -144 16.8141 0.0022
NP_441418.1_6 Reverse -228 -247 -22.0267 0.166
NP_441418.1_6 Forward -134 -115 -29.8932 0.245
NP_441418.1_6 Reverse -131 -150 -30.4831 0.28
NP_441418.1_6 Reverse -212 -231 -30.7781 0.296
NP_441343.1_7 Forward -126 -107 0.884433 0.278
NP_440897.1_6 Forward -134 -115 0.785326 0.177
NP_440897.1_6 Reverse -60 -79 -1.18128 0.187
NP_441453.1_1 Forward -141 -123 20.0778 0.0318
NP_441453.1_4 Reverse -125 -133 16.539 0.00633
NP_441453.1_4 Forward -134 -126 16.539 0.00633
NP_441453.1_4 Forward -16 -8 14.8674 0.00947
NP_441453.1_4 Reverse -7 -15 6.80426 0.121
NP_441453.1_4 Reverse -228 -236 6.70593 0.121
NP_441453.1_7 Forward -89 -82 12.9205 0.23
NP_441623.1_1 Forward -56 -38 -2.3408 0.241
NP_442151.1_6 Forward -134 -120 18.7808 0.00618
NP_442151.1_6 Reverse -125 -139 7.17775 0.206
NP_442151.1_6 Reverse -7 -21 6.19444 0.244
NP_442151.1_6 Reverse -228 -242 5.99778 0.253
NP_441818.1_9 Reverse -228 -247 -10.227 0.292
NP_440226.1_1 Reverse -125 -144 10.9142 0.0579
NP_440226.1_1 Reverse -228 -247 9.3409 0.0734
NP_440226.1_1 Forward -237 -218 3.6377 0.218
NP_442744.1_8 Reverse -81 -100 0.687771 0.217
NP_442744.1_8 Forward -134 -115 -1.86883 0.284
NP_442655.1_10 Reverse -122 -141 -19.2734 0.282
NP_442173.1_1 Forward -133 -125 15.4574 0.00633
NP_442173.1_1 Reverse -126 -134 15.4574 0.00633
NP_442173.1_1 Reverse -8 -16 13.8841 0.0225
NP_442173.1_1 Forward -15 -7 12.0158 0.0316
NP_442173.1_1 Forward -236 -228 5.82095 0.2
NP_442752.1_4 Reverse -228 -235 13.8055 0.0199
NP_442752.1_4 Forward -134 -127 13.8055 0.0199
NP_442752.1_4 Reverse -125 -132 13.8055 0.0199
NP_442752.1_4 Reverse -7 -14 13.8055 0.0199
NP_443027.1_4 Forward -136 -126 14.828 0.0437
NP_443027.1_4 Forward -18 -8 6.96153 0.253
NP_441812.1_3 Reverse -124 -138 8.06273 0.254
NP_442975.1_10 Forward -138 -124 14.0603 0.0459
NP_442975.1_10 Forward -241 -227 9.43874 0.0703
NP_440784.1_7 Forward -133 -126 15.9687 0.0123
NP_440784.1_7 Reverse -126 -133 15.9687 0.0123
NP_440784.1_7 Forward -236 -229 6.23397 0.241
NP_440784.1_7 Reverse -8 -15 6.23397 0.241
NP_440784.1_7 Reverse -229 -236 6.13563 0.241
NP_440784.1_7 Forward -15 -8 6.13563 0.241
NP_440061.1_9 Forward -136 -122 9.53707 0.143
NP_440110.1_8 Reverse -123 -142 0.392778 0.211
NP_441476.1_5 Forward -157 -138 8.45592 0.0945
NP_441476.1_5 Forward -139 -120 -2.55715 0.229
NP_441476.1_5 Reverse -120 -139 -3.24547 0.235
NP_440878.1_9 Reverse -115 -134 3.24438 0.174
NP_440878.1_9 Forward -247 -228 -3.24547 0.29
NP_441499.1_5 Forward -72 -58 14.2576 0.275
NP_442062.1_8 Reverse -125 -135 19.4496 0.000558
NP_442062.1_8 Forward -134 -124 17.3846 0.00193
NP_442062.1_8 Forward -16 -6 7.15819 0.107
NP_441859.1_3 Forward -135 -116 10.52 0.12
NP_441859.1_3 Forward -153 -134 7.27514 0.162
NP_441859.1_3 Reverse -124 -143 5.80018 0.191
NP_440304.1_4 Forward -136 -126 10.8948 0.051
NP_440304.1_4 Reverse -348 -358 2.14332 0.299
NP_440304.1_4 Reverse -123 -133 1.84832 0.299
NP_442242.1_4 Forward -133 -126 14.3954 0.0124
NP_442242.1_4 Reverse -126 -133 14.3954 0.0124
NP_442242.1_4 Reverse -229 -236 12.4288 0.0393
NP_441935.1_1 Forward -313 -294 8.06259 0.24
NP_441208.1_9 Reverse -122 -136 14.3559 0.0974
NP_441594.1_6 Forward -143 -124 15.0441 0.0984
NP_440370.1_10 Forward -25 -6 12.1925 0.155
NP_440132.1_1 Reverse -123 -141 10.7372 0.218
NP_442110.1_7 Reverse -125 -139 12.0943 0.0586
NP_442110.1_7 Reverse -7 -21 8.75105 0.083
NP_442110.1_7 Forward -134 -120 1.76955 0.222
NP_440014.1_7 Reverse -219 -233 17.4035 0.119
NP_440856.1_4 Forward -23 -4 11.9958 0.0432
NP_440856.1_7 Reverse -122 -141 4.916 0.141
NP_441083.1_5 Forward -134 -124 20.3345 0.00053
NP_441083.1_5 Reverse -125 -135 11.3864 0.0159
NP_441083.1_5 Forward -237 -227 9.81313 0.0224
NP_441083.1_5 Forward -16 -6 0.865012 0.218
NP_441083.1_5 Reverse -228 -238 -0.0199663 0.251
NP_441083.1_5 Reverse -7 -17 -1.10161 0.295
NP_442827.1_8 Forward -245 -226 -2.95123 0.294
NP_441738.1_2 Forward -235 -228 15.28 0.0102
NP_441738.1_2 Forward -132 -125 15.28 0.0102
NP_441738.1_2 Reverse -127 -134 15.28 0.0102
NP_441738.1_2 Forward -14 -7 15.28 0.0102
NP_441558.1_5 Reverse -123 -142 4.916 0.267
NP_440209.1_1 Reverse -125 -133 18.1123 0.00295
NP_440209.1_1 Forward -134 -126 18.1123 0.00295
NP_440209.1_1 Reverse -228 -236 14.8674 0.012
NP_440209.1_1 Reverse -7 -15 8.57422 0.0425
NP_440209.1_1 Forward -237 -229 5.62429 0.0821
NP_442889.1_8 Forward -137 -123 13.5686 0.0588
NP_440447.1_1 Forward -139 -121 1.49411 0.3
NP_442398.1_4 Reverse -161 -180 11.405 0.181
NP_441713.1_1 Reverse -119 -138 -5.80207 0.114
NP_441713.1_1 Forward -106 -87 -15.3402 0.261
NP_441792.1_5 Forward -250 -234 12.6449 0.19
NP_441716.1_1 Forward -134 -120 13.1759 0.0689
NP_441716.1_1 Forward -100 -86 5.01447 0.243
NP_441716.1_1 Reverse -125 -139 3.63784 0.259
NP_442111.1_4 Reverse -124 -138 19.6658 0.00373
NP_442111.1_4 Forward -17 -3 4.32615 0.212
NP_442111.1_4 Forward -135 -121 2.94952 0.259
NP_442111.1_4 Reverse -211 -225 2.65453 0.268
NP_441163.1_9 Forward -143 -124 13.5691 0.236
NP_440048.1_8 Forward -234 -215 13.3725 0.27
NP_440906.1_5 Forward -133 -126 15.8704 0.0124
NP_440906.1_5 Reverse -126 -133 15.8704 0.0124
NP_440906.1_5 Forward -236 -229 12.0355 0.0724
NP_440906.1_5 Reverse -229 -236 12.0355 0.0724
NP_440906.1_5 Reverse -8 -15 6.23397 0.234
NP_440906.1_5 Forward -15 -8 6.13563 0.241
NP_440747.1_10 Reverse -122 -134 24.7201 0.00036
NP_440747.1_10 Forward -137 -125 7.70879 0.00236
NP_440747.1_10 Reverse -225 -237 -4.58258 0.109
NP_440747.1_10 Forward -19 -7 -11.7607 0.142
NP_441486.1_1 Forward -137 -123 13.7659 0.00763
NP_441486.1_1 Reverse -122 -136 11.3077 0.0164
NP_441486.1_1 Reverse -225 -239 -3.04867 0.175
NP_442634.1_4 Reverse -123 -137 -1.67204 0.149
NP_442634.1_4 Reverse -5 -19 -2.55701 0.153
NP_441265.1_3 Reverse -119 -133 3.04785 0.181
NP_440403.1_4 Forward -230 -211 -8.16202 0.251
NP_440842.1_10 Forward -240 -226 2.5562 0.274
NP_441014.1_8 Reverse -302 -321 -0.590531 0.218
NP_441014.1_8 Forward -244 -225 -6.58872 0.276
NP_441014.1_10 Reverse -124 -143 2.35861 0.216
NP_441014.1_10 Forward -395 -376 -1.08295 0.257
NP_442848.1_1 Forward -140 -126 -2.26202 0.263
NP_441012.1_4 Forward -138 -125 7.19745 0.272
NP_443018.1_3 Forward -133 -126 14.8871 0.0123
NP_443018.1_3 Reverse -126 -133 14.8871 0.0123
NP_443018.1_3 Forward -15 -8 11.7405 0.0655
NP_443018.1_3 Reverse -8 -15 5.44732 0.193
NP_443018.1_3 Forward -236 -229 5.34899 0.212
NP_443018.1_3 Reverse -229 -236 5.34899 0.212
NP_441316.1_7 Forward -136 -121 3.71647 0.137
NP_441634.1_8 Reverse -129 -143 0.687908 0.219
NP_441634.1_8 Reverse -331 -345 -3.147 0.295
NP_441634.1_8 Reverse -123 -137 -3.147 0.295
NP_440376.1_1 Forward -134 -125 19.4693 0.000692
NP_440376.1_1 Reverse -125 -134 19.4693 0.000692
NP_440376.1_1 Reverse -7 -16 5.89959 0.116
NP_440376.1_1 Reverse -228 -237 -0.000272808 0.285
NP_440376.1_1 Forward -237 -228 -0.0986038 0.285
NP_440376.1_1 Forward -16 -7 -0.0986038 0.285
NP_441857.1_5 Reverse -118 -136 5.52568 0.2
NP_441588.1_4 Forward -14 -4 14.238 0.0773
NP_441588.1_4 Forward -132 -122 9.02648 0.14
NP_441588.1_4 Forward -235 -225 8.92815 0.14
NP_442687.1_7 Forward -135 -125 15.8113 0.0125
NP_442687.1_7 Reverse -6 -16 12.5664 0.0712
NP_442687.1_7 Reverse -124 -134 8.92815 0.0994
NP_442687.1_7 Forward -238 -228 6.07655 0.179
NP_442191.1_4 Reverse -126 -140 16.6166 0.034
NP_442191.1_4 Forward -280 -266 11.0901 0.271
NP_441077.1_6 Reverse -102 -118 3.18749 0.271
NP_442485.1_3 Forward -145 -126 -3.24547 0.272
NP_442485.1_3 Forward -151 -132 -4.6221 0.285
NP_440642.1_4 Forward -279 -260 26.6471 0.00232
NP_440642.1_8 Forward -235 -216 16.7295 0.106
NP_440533.1_9 Reverse -125 -144 5.89931 0.19
NP_442296.1_9 Forward -236 -217 -5.11376 0.282
NP_442658.1_1 Forward -136 -126 15.9091 0.00966
NP_442658.1_1 Forward -239 -229 12.1726 0.0615
NP_442658.1_1 Reverse -123 -133 6.76441 0.214
NP_442658.1_1 Reverse -5 -15 6.17443 0.235
NP_442658.1_1 Forward -18 -8 5.38779 0.269
NP_441855.2_4 Forward -142 -123 12.2225 0.2
NP_442782.1_2 Reverse -125 -139 10.521 0.173
NP_441414.1_9 Forward -134 -115 -3.83545 0.143
NP_441414.1_9 Reverse -63 -82 -6.1954 0.19
NP_441414.1_9 Forward -237 -218 -6.98204 0.208
NP_440720.1_1 Forward -27 -8 1.0811 0.279
NP_442937.1_5 Reverse -120 -139 15.3391 0.0581
NP_442937.1_5 Reverse -132 -151 14.9458 0.066
NP_442937.1_5 Forward -74 -55 10.5209 0.158
NP_441958.1_5 Forward -135 -125 12.2714 0.00183
NP_441958.1_5 Reverse -124 -134 12.2714 0.00183
NP_441958.1_5 Reverse -6 -16 8.73149 0.0255
NP_441958.1_5 Forward -17 -7 1.65166 0.0872
NP_441958.1_5 Forward -238 -228 0.963343 0.12
NP_441958.1_5 Reverse -227 -237 -6.41148 0.28
NP_440203.1_5 Forward -131 -121 14.2375 0.0886
NP_440203.1_5 Reverse -297 -307 9.81266 0.245
NP_440203.1_5 Forward -234 -224 9.71433 0.245
NP_439905.1_1 Forward -15 -2 8.77074 0.232
NP_440984.1_7 Reverse -2 -16 10.3243 0.126
NP_440984.1_7 Forward -242 -228 6.3911 0.217
NP_439990.1_5 Reverse -120 -133 20.7671 0.00296
NP_442376.1_2 Forward -139 -120 -11.8986 0.286
NP_442911.1_2 Forward -144 -125 14.1591 0.0112
NP_442911.1_2 Reverse -115 -134 6.4893 0.0286
NP_442911.1_2 Reverse -218 -237 -5.31042 0.155
NP_442064.1_1 Reverse -120 -139 -13.8652 0.299
NP_440993.1_2 Forward -21 -5 16.6765 0.0615
NP_440993.1_3 Forward -26 -7 2.9486 0.19
NP_441913.1_1 Reverse -289 -305 14.9816 0.246
NP_441099.1_5 Forward -144 -125 -11.5053 0.283
NP_442002.1_9 Forward -135 -128 10.7572 0.185
NP_442002.1_9 Reverse -6 -13 10.7572 0.185
NP_441938.1_1 Reverse -123 -142 2.16274 0.272
NP_440411.1_10 Reverse -123 -142 8.99299 0.293
NP_442438.1_10 Forward -139 -125 20.0591 0.0124
NP_442438.1_10 Reverse -223 -237 1.67122 0.19
NP_442438.1_10 Reverse -120 -134 0.786239 0.213
NP_442438.1_10 Forward -21 -7 0.294584 0.232
NP_442431.1_7 Reverse -306 -325 5.60432 0.273
NP_441292.1_2 Forward -325 -306 -6.1954 0.241
NP_441000.1_6 Forward -238 -224 -3.63866 0.225
NP_442771.1_1 Reverse -123 -141 2.77242 0.0672
NP_440147.1_4 Reverse -5 -18 17.6205 0.00602
NP_440147.1_4 Reverse -123 -136 10.049 0.0355
NP_440147.1_4 Forward -136 -123 3.46087 0.187
NP_440147.1_4 Reverse -226 -239 2.2809 0.209
NP_441175.1_7 Forward -237 -218 12.4875 0.116
NP_441550.1_8 Reverse -123 -133 14.6309 0.0132
NP_441550.1_8 Forward -18 -8 11.6809 0.0446
NP_441550.1_8 Reverse -5 -15 7.0594 0.178
NP_441550.1_8 Forward -239 -229 7.0594 0.178
NP_441550.1_8 Forward -136 -126 6.0761 0.214
NP_441550.1_8 Reverse -226 -236 5.28945 0.255
NP_441916.1_7 Reverse -125 -135 18.4663 0.00144
NP_441916.1_7 Forward -134 -124 10.3048 0.0261
NP_441916.1_7 Forward -16 -6 9.51814 0.0338
NP_441916.1_7 Reverse -7 -17 7.15819 0.0745
NP_441916.1_10 Forward -142 -123 8.25926 0.172
NP_441916.1_10 Reverse -95 -114 0.294447 0.286
NP_441041.1_4 Reverse -125 -144 4.62101 0.0558
NP_441041.1_4 Forward -134 -115 -2.85214 0.117
NP_441041.1_7 Reverse -122 -134 8.58373 0.133
NP_441041.1_7 Forward -137 -125 7.61196 0.162
NP_441041.1_7 Forward -240 -228 5.95994 0.231
NP_442396.1_5 Reverse -3 -16 10.639 0.106
NP_442004.1_6 Reverse -125 -139 10.0294 0.14
NP_442004.1_6 Forward -134 -120 5.80112 0.181
NP_442004.1_6 Reverse -258 -272 2.06454 0.274
NP_441725.1_4 Forward -139 -125 2.94893 0.279
NP_441725.1_5 Reverse -126 -136 11.2881 0.0247
NP_441725.1_5 Reverse -229 -239 6.96153 0.108
NP_441725.1_5 Forward -133 -123 2.04498 0.115
NP_439966.1_7 Forward -136 -126 18.4657 0.00473
NP_439966.1_7 Reverse -123 -133 7.25606 0.15
NP_439966.1_7 Forward -18 -8 4.60114 0.265
NP_439966.1_9 Forward -136 -127 0.983037 0.253
NP_439966.1_9 Reverse -5 -14 0.884706 0.253
NP_442941.1_3 Reverse -126 -136 11.4848 0.0116
NP_442941.1_3 Forward -133 -123 11.0914 0.0116
NP_442941.1_3 Forward -236 -226 1.35667 0.15
NP_442941.1_3 Reverse -8 -18 -1.29827 0.297
NP_440289.1_2 Forward -137 -124 11.819 0.0171
NP_440289.1_2 Forward -240 -227 1.29759 0.132
NP_440983.1_5 Reverse -176 -195 -5.60541 0.268
NP_440983.1_9 Forward -61 -42 2.3594 0.292
NP_440260.1_8 Forward -143 -125 -4.79907 0.273
NP_440260.1_8 Reverse -39 -57 -5.58572 0.275
NP_440260.1_8 Reverse -136 -154 -5.78238 0.279
NP_440260.1_8 Reverse -243 -261 -7.25734 0.295
NP_441514.1_6 Forward -292 -285 14.2971 0.248
NP_442281.1_1 Forward -139 -125 18.4851 0.0043
NP_442281.1_1 Forward -21 -7 13.8636 0.0233
NP_442281.1_1 Reverse -120 -134 9.53707 0.0685
NP_441334.1_7 Reverse -123 -142 -19.4701 0.275
NP_442256.1_2 Forward -239 -221 11.9172 0.0965
NP_440647.1_9 Reverse -5 -23 3.65739 0.268
NP_442012.1_1 Reverse -119 -138 3.34271 0.18
NP_442012.1_1 Forward -140 -121 2.45773 0.2
NP_442012.1_1 Reverse -222 -241 1.17943 0.222
NP_442049.1_6 Reverse -117 -136 6.78429 0.215
NP_441087.1_6 Reverse -286 -304 0.805058 0.258
NP_441087.1_6 Forward -37 -19 -2.14486 0.284
NP_441556.1_10 Reverse -120 -134 13.4339 0.178
NP_440498.1_1 Forward -143 -125 -0.865831 0.22
NP_442982.1_5 Forward -144 -125 -3.14714 0.296
NP_441644.1_6 Forward -134 -124 17.3841 0.00127
NP_441644.1_6 Reverse -125 -135 10.1076 0.0628
NP_441644.1_6 Reverse -228 -238 7.64939 0.121
NP_441644.1_6 Forward -16 -6 7.45273 0.124
NP_441644.1_6 Forward -237 -227 5.87944 0.174
NP_442215.1_2 Forward -136 -120 6.74504 0.0702
NP_442215.1_2 Reverse -123 -139 6.54838 0.0702
NP_442029.1_6 Reverse -120 -139 4.42435 0.268
NP_442247.1_8 Reverse -226 -240 9.5377 0.247
NP_440253.1_2 Reverse -125 -143 2.37909 0.139
NP_440253.1_2 Reverse -131 -149 1.39578 0.161
NP_440253.1_4 Reverse -270 -289 11.7008 0.274
NP_440929.1_8 Forward -134 -125 19.2726 0.000701
NP_440929.1_8 Reverse -125 -134 19.2726 0.000701
NP_440929.1_8 Forward -16 -7 7.17789 0.0713
NP_442933.1_10 Forward -134 -125 17.601 0.00325
NP_442933.1_10 Reverse -125 -134 17.601 0.00325
NP_442933.1_10 Forward -16 -7 8.06287 0.0885
NP_442933.1_10 Reverse -7 -16 7.96454 0.0937
NP_442933.1_10 Reverse -228 -237 5.40793 0.19
NP_441751.2_8 Reverse -126 -140 -1.5737 0.129
NP_441751.2_8 Forward -133 -119 -2.36035 0.132
NP_442554.1_8 Forward -133 -123 15.3197 0.00882
NP_442554.1_8 Reverse -126 -136 13.8447 0.0145
NP_442554.1_8 Reverse -8 -18 7.15819 0.0975
NP_442554.1_8 Forward -236 -226 5.5849 0.145
NP_442554.1_8 Forward -15 -5 3.42162 0.226
NP_441762.1_7 Forward -135 -123 9.57708 0.0142
NP_441762.1_7 Reverse -124 -136 2.89058 0.0676
NP_441762.1_7 Forward -17 -5 2.20226 0.0676
NP_441762.1_7 Reverse -227 -239 -5.17256 0.191
NP_441762.1_7 Reverse -6 -18 -5.46756 0.212
NP_442142.1_4 Forward -137 -124 17.1282 0.0264
NP_442142.1_4 Reverse -122 -135 14.7683 0.0302
NP_442142.1_4 Forward -240 -227 6.90188 0.153
NP_442142.1_4 Forward -143 -130 4.64028 0.214
NP_442292.1_1 Forward -133 -124 18.486 0.00229
NP_442292.1_1 Reverse -126 -135 9.63616 0.0183
NP_442292.1_1 Forward -236 -227 8.75118 0.0306
NP_442292.1_1 Forward -15 -6 -0.196935 0.239
NP_440919.1_7 Forward -330 -312 13.8383 0.147
NP_440919.1_10 Forward -86 -67 21.7306 0.137
NP_440895.1_6 Reverse -119 -132 19.8821 0.0221
NP_441523.1_6 Forward -138 -119 10.9142 0.161
NP_443009.1_5 Reverse -124 -135 18.3477 0.00265
NP_443009.1_5 Forward -395 -384 6.94134 0.144
NP_443009.1_5 Forward -17 -6 5.95804 0.18
NP_442301.1_2 Forward -144 -125 5.89851 0.263
NP_441715.1_4 Reverse -126 -136 16.303 0.0117
NP_441715.1_4 Forward -133 -123 7.94484 0.107
NP_441613.1_1 Reverse -43 -62 13.6675 0.274
NP_440379.1_5 Forward -143 -124 -6.58872 0.238
NP_440464.1_10 Forward -133 -123 13.0082 0.169
NP_441468.1_1 Forward -133 -126 15.8704 0.0124
NP_441468.1_1 Reverse -126 -133 15.8704 0.0124
NP_441468.1_1 Forward -236 -229 6.13563 0.209
NP_441468.1_1 Reverse -8 -15 6.13563 0.209
NP_441468.1_1 Reverse -229 -236 6.0373 0.223
NP_441468.1_1 Forward -15 -8 6.0373 0.223
NP_441020.2_6 Reverse -123 -140 18.5251 0.0115
NP_441020.2_6 Forward -18 -1 8.49531 0.197
NP_441015.1_10 Forward -139 -120 -5.70374 0.23
NP_441015.1_10 Reverse -120 -139 -6.09707 0.241
NP_441673.1_1 Forward -134 -125 20.8459 0.000698
NP_441673.1_1 Reverse -125 -134 20.8459 0.000698
NP_441673.1_1 Forward -237 -228 1.27803 0.155
NP_441673.1_1 Reverse -228 -237 1.27803 0.155
NP_441673.1_1 Forward -16 -7 1.27803 0.155
NP_441673.1_1 Reverse -7 -16 1.27803 0.155
NP_441096.1_5 Forward -103 -85 14.0797 0.297
NP_442253.1_5 Reverse -255 -272 2.10379 0.157
NP_441826.1_2 Forward -140 -126 4.03116 0.105
NP_441826.1_2 Reverse -119 -133 -2.65535 0.273
NP_441330.1_1 Forward -21 -2 -13.8652 0.206
NP_441330.1_1 Reverse -120 -139 -14.1602 0.214
NP_442490.1_1 Forward -228 -209 15.7324 0.295
NP_442490.1_9 Forward -146 -127 -0.4922 0.179
NP_442868.1_6 Reverse -123 -133 9.81313 0.038
NP_442868.1_6 Forward -239 -229 6.76487 0.101
NP_442868.1_6 Forward -136 -126 0.963343 0.205
NP_442868.1_6 Reverse -226 -236 -0.0199663 0.255
NP_441056.1_1 Reverse -125 -144 -7.4737 0.272
NP_441612.1_2 Forward -134 -124 8.54929 0.21
NP_442227.1_2 Forward -141 -122 -0.885524 0.26
NP_442227.1_2 Forward -67 -48 -2.16383 0.271
NP_443058.1_4 Forward -363 -344 21.8289 0.021
NP_443058.1_7 Forward -326 -307 8.65258 0.206
NP_442361.1_3 Forward -140 -127 18.0139 0.0481
NP_442427.1_8 Forward -246 -227 6.19431 0.247
NP_441911.1_10 Reverse -200 -219 9.52306 0.231
NP_442808.1_1 Forward -135 -125 18.4657 0.00201
NP_442808.1_1 Reverse -124 -134 8.63269 0.0481
NP_442808.1_1 Forward -238 -228 7.84605 0.0668
NP_442808.1_1 Reverse -90 -100 4.01116 0.212
NP_442775.1_6 Reverse -120 -139 12.3892 0.277
NP_440145.1_3 Forward -26 -7 -0.787193 0.143
NP_440145.1_3 Reverse -115 -134 -1.37718 0.151
NP_441906.1_2 Forward -263 -244 1.76863 0.286
NP_442542.1_2 Forward -239 -226 6.50913 0.222
NP_442050.1_5 Forward -18 -8 14.1392 0.0227
NP_442050.1_5 Forward -136 -126 9.12434 0.193
NP_442050.1_5 Reverse -123 -133 7.64939 0.243
NP_441114.1_3 Reverse -296 -305 8.35786 0.231
NP_441114.1_3 Reverse -260 -269 7.66954 0.231
NP_440558.1_2 Forward -271 -252 -1.18052 0.211
NP_440558.1_2 Reverse -255 -274 -4.03212 0.241
NP_440558.1_2 Forward -143 -124 -5.31042 0.256
NP_442789.1_4 Reverse -123 -142 -1.18052 0.214
NP_441518.1_3 Forward -144 -125 -6.58872 0.14
NP_441878.1_6 Forward -135 -125 10.4031 0.0176
NP_441878.1_6 Reverse -124 -134 10.4031 0.0176
NP_441878.1_6 Forward -238 -228 0.668351 0.139
NP_441878.1_6 Reverse -59 -69 -7.29646 0.217
NP_441878.1_6 Forward -268 -258 -7.68978 0.255
NP_441036.1_8 Forward -135 -125 17.7779 0.000554
NP_441036.1_8 Reverse -6 -16 12.5664 0.0744
NP_441036.1_8 Reverse -124 -134 8.33817 0.174
NP_441036.1_8 Forward -17 -7 6.07655 0.242
NP_442650.1_2 Forward -134 -120 8.25939 0.13
NP_442650.1_2 Reverse -125 -139 6.98109 0.13
NP_441557.1_5 Forward -134 -125 19.9609 0.000699
NP_441557.1_5 Reverse -125 -134 19.9609 0.000699
NP_441557.1_5 Reverse -7 -16 8.94785 0.0289
NP_441557.1_5 Reverse -228 -237 0.983037 0.0911
NP_441557.1_5 Forward -237 -228 0.688044 0.128
NP_441557.1_5 Forward -16 -7 0.688044 0.128
NP_441445.1_1 Forward -143 -124 9.73422 0.103
NP_441445.1_1 Reverse -116 -135 9.63589 0.104
NP_441445.1_1 Reverse -219 -238 6.68596 0.144
NP_442066.2_4 Reverse -7 -26 -8.55534 0.294
NP_442066.2_9 Forward -186 -173 8.27909 0.188
NP_442579.1_6 Reverse -72 -91 9.93088 0.154
NP_442419.1_2 Reverse -120 -139 1.47442 0.238
NP_441308.1_8 Forward -136 -126 10.1081 0.22
NP_440101.1_5 Forward -141 -122 4.42435 0.196
NP_441458.1_10 Forward -143 -124 12.9791 0.0856
NP_441458.1_10 Reverse -116 -135 5.99764 0.208
NP_442183.1_1 Reverse -125 -139 16.9125 0.0129
NP_442183.1_3 Forward -392 -373 15.9282 0.241
NP_442166.1_7 Reverse -126 -140 10.0294 0.19
NP_440440.1_1 Reverse -301 -320 11.7983 0.168
NP_441574.1_1 Reverse -125 -144 -7.57203 0.292
NP_441549.1_9 Reverse -254 -272 -5.09406 0.198
NP_442347.1_2 Forward -133 -124 12.4878 0.056
NP_442347.1_2 Reverse -126 -135 11.1111 0.056
NP_442347.1_2 Forward -15 -6 8.94785 0.0718
NP_442347.1_2 Forward -236 -227 3.93297 0.284
NP_442645.1_2 Reverse -117 -136 -22.9117 0.299
NP_441037.1_4 Forward -269 -259 9.55921 0.21
NP_441037.1_4 Reverse -123 -133 7.9999 0.237
NP_441037.1_4 Forward -136 -126 7.02532 0.237
NP_441037.1_4 Reverse -226 -236 6.92787 0.237
NP_442508.1_8 Reverse -5 -22 11.0519 0.259
NP_441633.1_3 Reverse -123 -136 8.47575 0.0377
NP_441633.1_3 Reverse -226 -239 0.805932 0.115
NP_441633.1_3 Forward -136 -123 -3.71729 0.177
NP_441633.1_3 Reverse -5 -18 -6.47056 0.253
NP_441633.1_3 Forward -74 -61 -6.66722 0.265
NP_440136.1_2 Forward -133 -126 15.9687 0.0123
NP_440136.1_2 Reverse -126 -133 15.9687 0.0123
NP_440136.1_2 Forward -236 -229 6.23397 0.171
NP_440136.1_2 Reverse -8 -15 6.23397 0.171
NP_440136.1_2 Reverse -229 -236 6.13563 0.193
NP_440136.1_2 Forward -15 -8 6.13563 0.193
NP_442590.1_10 Forward -274 -255 9.0459 0.2
NP_442998.1_10 Forward -235 -228 15.5754 0.0102
NP_442998.1_10 Forward -132 -125 15.5754 0.0102
NP_442998.1_10 Reverse -127 -134 15.5754 0.0102
NP_442998.1_10 Forward -14 -7 15.5754 0.0102
NP_440299.1_1 Reverse -121 -134 22.3398 0.000547
NP_440299.1_1 Forward -138 -125 20.1765 0.00128
NP_440299.1_1 Reverse -224 -237 3.85363 0.228
NP_441799.1_1 Reverse -121 -135 11.4053 0.0589
NP_441799.1_1 Reverse -3 -17 5.01387 0.227
NP_441799.1_1 Forward -20 -6 4.62054 0.242
NP_441799.1_1 Forward -138 -124 4.03056 0.269
NP_442802.1_6 Reverse -11 -30 -1.27885 0.204
NP_442333.2_5 Forward -248 -229 -14.3569 0.272
NP_440256.1_1 Reverse -122 -141 17.2074 0.00544
NP_440456.1_7 Forward -293 -279 14.3559 0.281
NP_441559.1_8 Reverse -120 -134 2.65453 0.143
NP_441559.1_8 Forward -139 -125 2.5562 0.143
NP_441559.1_8 Reverse -254 -268 -5.21195 0.254
NP_440915.1_6 Forward -138 -124 5.70279 0.0879
NP_440915.1_6 Reverse -121 -135 3.73617 0.1
NP_440915.1_6 Forward -20 -6 1.67122 0.132
NP_442158.1_4 Reverse -116 -126 14.533 0.176
NP_441179.1_1 Reverse -225 -244 10.4225 0.112
NP_441866.1_6 Forward -48 -29 8.06178 0.26
NP_441704.1_8 Reverse -114 -133 11.7983 0.13
NP_441704.1_8 Forward -145 -126 11.6017 0.138
NP_442866.1_1 Reverse -2 -21 4.32602 0.151
NP_441113.1_3 Reverse -100 -114 14.5519 0.27
NP_440695.1_5 Reverse -125 -144 -0.0988766 0.284
NP_441939.1_3 Reverse -126 -145 14.6508 0.0744
NP_442993.1_1 Reverse -125 -141 -8.88958 0.176
NP_440677.1_1 Forward -143 -124 6.4893 0.265
NP_442386.1_9 Forward -135 -126 15.7322 0.0144
NP_442386.1_9 Reverse -124 -133 13.8639 0.0289
NP_442386.1_9 Reverse -6 -15 5.9975 0.23
NP_442386.1_9 Forward -141 -132 4.91586 0.276
NP_440570.1_5 Forward -355 -336 -3.73712 0.292
NP_441340.1_5 Forward -133 -126 15.6737 0.0124
NP_441340.1_5 Reverse -126 -133 15.6737 0.0124
NP_441340.1_5 Reverse -8 -15 13.5105 0.0314
NP_441340.1_5 Reverse -229 -236 6.13563 0.175
NP_441340.1_5 Forward -236 -229 5.93897 0.198
NP_441340.1_5 Forward -15 -8 5.84064 0.208
NP_441947.1_10 Reverse -123 -141 0.0191479 0.276
NP_442484.1_2 Reverse -114 -133 2.16274 0.226
NP_442791.1_5 Reverse -347 -366 -6.1954 0.279
NP_441248.1_10 Reverse -202 -212 16.3534 0.277
NP_440161.1_3 Reverse -61 -80 11.3075 0.217
NP_441160.1_6 Forward -60 -41 1.96607 0.281
NP_440586.1_1 Reverse -121 -140 -3.54046 0.272
NP_440586.1_8 Forward -133 -126 13.2151 0.026
NP_440586.1_8 Reverse -126 -133 13.2151 0.026
NP_440586.1_8 Reverse -229 -236 11.4451 0.0645
NP_440586.1_8 Forward -15 -8 9.47853 0.146
NP_440586.1_8 Reverse -8 -15 5.74197 0.283
NP_442251.1_6 Forward -133 -126 15.2804 0.0124
NP_442251.1_6 Reverse -126 -133 15.2804 0.0124
NP_442251.1_6 Forward -236 -229 12.0355 0.0627
NP_440192.1_5 Forward -102 -83 4.32602 0.254
NP_442959.1_5 Forward -122 -103 5.99764 0.262
NP_441262.1_3 Reverse -228 -235 14.7888 0.0223
NP_441262.1_3 Reverse -125 -132 14.7888 0.0223
NP_441262.1_3 Reverse -7 -14 14.7888 0.0223
NP_441262.1_3 Forward -134 -127 14.7888 0.0223
NP_441262.1_3 Forward -72 -65 5.44732 0.11
NP_443051.1_1 Reverse -124 -133 10.4228 0.00754
NP_443051.1_1 Forward -135 -126 10.4228 0.00754
NP_443051.1_1 Reverse -6 -15 7.47288 0.0571
NP_443051.1_1 Reverse -227 -236 0.786375 0.125
NP_443051.1_1 Forward -17 -8 0.393051 0.169
NP_443051.1_1 Forward -238 -229 -1.08191 0.281
NP_439937.1_8 Forward -154 -135 2.3594 0.216
NP_439937.1_8 Forward -142 -123 0.0977854 0.237
NP_439937.1_8 Reverse -123 -142 -5.11376 0.286
NP_439937.1_9 Forward -135 -118 1.02145 0.0948
NP_439937.1_9 Forward -238 -221 -7.82829 0.168
NP_439937.1_9 Reverse -90 -107 -11.2699 0.248
NP_440408.1_7 Forward -140 -121 13.8641 0.175
NP_440439.1_1 Forward -137 -124 8.37742 0.0537
NP_440439.1_1 Forward -19 -6 5.52582 0.0884
NP_440439.1_1 Reverse -122 -135 0.314277 0.194
NP_440439.1_1 Reverse -4 -17 -0.570702 0.226
NP_439943.1_2 Forward -130 -111 14.4541 0.236
NP_439943.1_4 Forward -310 -291 3.34271 0.298
NP_439943.1_7 Reverse -120 -139 3.34271 0.29
NP_440372.1_2 Forward -133 -126 16.3621 0.0124
NP_440372.1_2 Reverse -126 -133 16.3621 0.0124
NP_440372.1_2 Reverse -8 -15 13.8055 0.0214
NP_440372.1_2 Reverse -229 -236 6.72562 0.0929
NP_440372.1_2 Forward -236 -229 6.62729 0.151
NP_440372.1_2 Forward -15 -8 6.52896 0.188
NP_440819.1_5 Reverse -100 -108 7.68924 0.266
NP_441803.1_2 Forward -139 -120 17.2074 0.0309
NP_441803.1_2 Reverse -343 -362 -0.787193 0.286
NP_439977.1_5 Forward -140 -121 6.09597 0.138
NP_439977.1_5 Reverse -119 -138 1.96607 0.183
NP_440139.1_1 Forward -140 -121 3.73524 0.2
NP_441572.1_7 Reverse -81 -100 -3.24547 0.208
NP_441572.1_7 Forward -140 -121 -4.03212 0.224
NP_441572.1_7 Forward -22 -3 -4.6221 0.24
NP_442384.1_10 Forward -134 -121 17.4239 0.00585
NP_442384.1_10 Reverse -125 -138 15.7522 0.00946
NP_442384.1_10 Forward -16 -3 10.5407 0.0439
NP_442384.1_10 Forward -237 -224 5.62415 0.124
NP_442035.1_8 Forward -240 -226 12.0943 0.251
NP_442114.1_2 Reverse -107 -126 3.24438 0.262
NP_441018.1_7 Reverse -121 -140 16.4207 0.0832
NP_441018.1_7 Forward -368 -349 12.9791 0.145
NP_441018.1_7 Reverse -133 -152 8.65258 0.241
NP_442262.1_10 Forward -133 -126 14.1988 0.0123
NP_442262.1_10 Reverse -126 -133 14.1988 0.0123
NP_442262.1_10 Forward -15 -8 13.2155 0.0213
NP_441689.1_5 Forward -136 -126 8.53436 0.132
NP_441689.1_5 Forward -18 -8 8.43603 0.132
NP_441689.1_5 Reverse -123 -133 5.78111 0.197
NP_440163.1_10 Forward -137 -127 16.303 0.0762
NP_440344.1_10 Forward -141 -124 18.4267 0.00244
NP_440344.1_10 Reverse -118 -135 8.7903 0.00973
NP_441632.1_7 Forward -240 -221 16.6174 0.193
NP_440531.1_8 Reverse -43 -62 3.44104 0.269
NP_441060.1_9 Reverse -125 -144 11.1109 0.248
NP_442910.1_1 Reverse -118 -137 -6.29373 0.254
NP_440487.1_1 Reverse -122 -141 -5.21209 0.214
NP_441965.1_10 Forward -137 -121 6.05672 0.187
NP_440297.1_9 Reverse -126 -136 9.32148 0.0917
NP_440297.1_9 Forward -133 -123 -0.118297 0.282
NP_440350.1_5 Forward -108 -89 7.7676 0.134
NP_442187.1_3 Reverse -227 -237 16.893 0.0619
NP_442280.1_10 Forward -328 -310 9.44784 0.233
NP_441896.1_3 Forward -143 -124 0.786102 0.224
NP_440894.1_10 Reverse -120 -139 9.24257 0.163
NP_442067.1_4 Forward -145 -126 15.7324 0.0681
NP_440999.1_9 Forward -138 -124 13.1759 0.0329
NP_440888.1_2 Reverse -125 -139 15.8302 0.00862
NP_440888.1_2 Forward -134 -120 9.04542 0.139
NP_440888.1_2 Forward -16 -2 5.01387 0.298
NP_440600.1_4 Forward -245 -227 -0.177514 0.147
NP_440491.1_1 Forward -149 -130 7.98904 0.253
NP_440491.1_1 Reverse -122 -141 6.81956 0.288
NP_439969.1_1 Reverse -299 -318 -5.01543 0.288
NP_442948.1_2 Reverse -6 -25 4.22769 0.269
NP_442033.1_10 Forward -136 -117 -7.67036 0.186
NP_440575.1_8 Reverse -109 -128 -0.0988766 0.185
NP_441543.1_2 Reverse -126 -135 18.486 0.00236
NP_441543.1_2 Forward -133 -124 16.9127 0.00359
NP_441543.1_2 Forward -15 -6 8.65285 0.0968
NP_441543.1_2 Forward -236 -227 7.17789 0.131
NP_442845.1_2 Reverse -119 -133 11.3077 0.131
NP_442845.1_2 Reverse -125 -139 7.07942 0.199
NP_442845.1_2 Reverse -252 -266 6.48943 0.209
NP_441551.1_5 Forward -100 -84 6.05604 0.286
NP_441178.1_6 Forward -240 -221 2.35861 0.27
NP_440982.1_1 Reverse -289 -308 3.53858 0.297
NP_441469.1_8 Forward -135 -126 16.126 0.00797
NP_441469.1_8 Reverse -124 -133 6.48957 0.227
NP_441469.1_8 Reverse -6 -15 6.39124 0.227
NP_443064.1_6 Forward -134 -124 12.5669 0.0796
NP_443064.1_6 Forward -237 -227 8.39772 0.292
NP_442578.1_7 Forward -133 -126 14.5921 0.026
NP_442578.1_7 Reverse -126 -133 14.5921 0.026
NP_442578.1_7 Reverse -8 -15 6.0373 0.18
NP_442578.1_7 Reverse -229 -236 5.93897 0.183
NP_441462.1_2 Reverse -7 -17 17.4829 0.00406
NP_441462.1_2 Forward -134 -124 11.5831 0.00406
NP_441462.1_2 Reverse -125 -135 11.5831 0.00406
NP_441462.1_2 Reverse -228 -238 8.4365 0.0363
NP_441621.1_7 Forward -136 -122 -3.147 0.188
NP_441621.1_7 Reverse -123 -137 -3.44199 0.188
NP_441621.1_7 Reverse -5 -19 -3.63866 0.192
NP_441621.1_7 Forward -71 -57 -6.49025 0.295
NP_443062.1_1 Forward -134 -116 3.57305 0.293
NP_443062.1_6 Reverse -117 -136 13.7658 0.088
NP_443062.1_6 Reverse -220 -239 1.0811 0.28
NP_440349.1_3 Forward -151 -132 11.0117 0.282
NP_442204.1_1 Forward -138 -127 9.69511 0.0736
NP_442204.1_1 Reverse -121 -132 8.7118 0.0852
NP_442204.1_2 Forward -144 -125 12.7825 0.223
NP_440516.1_8 Reverse -228 -237 17.6993 0.00442
NP_440516.1_8 Forward -134 -125 16.9127 0.00442
NP_440516.1_8 Reverse -125 -134 16.9127 0.00442
NP_440516.1_8 Reverse -7 -16 9.4395 0.0183
NP_440516.1_8 Forward -16 -7 5.11294 0.118
NP_442428.1_5 Forward -133 -126 15.8704 0.0124
NP_442428.1_5 Reverse -126 -133 15.8704 0.0124
NP_442428.1_5 Forward -236 -229 6.13563 0.209
NP_442428.1_5 Reverse -8 -15 6.13563 0.209
NP_442428.1_5 Reverse -229 -236 6.0373 0.212
NP_442428.1_5 Forward -15 -8 6.0373 0.212
NP_442120.1_10 Forward -140 -121 -14.0619 0.288
NP_440673.1_3 Forward -235 -228 12.4288 0.0426
NP_440673.1_3 Forward -132 -125 12.4288 0.0426
NP_440673.1_3 Forward -14 -7 12.4288 0.0426
NP_440673.1_3 Reverse -127 -134 12.4288 0.0426
NP_441052.1_2 Forward -134 -124 19.9412 0.00106
NP_441052.1_2 Forward -237 -227 10.7964 0.0285
NP_441052.1_2 Reverse -125 -135 10.5014 0.0285
NP_441052.1_2 Forward -267 -257 1.84832 0.225
NP_442219.1_9 Forward -133 -124 17.7976 0.00718
NP_442219.1_9 Reverse -126 -135 8.35786 0.0681
NP_442219.1_9 Forward -236 -227 8.06287 0.0696
NP_440436.1_4 Reverse -126 -135 18.1905 0.00233
NP_440436.1_4 Forward -133 -124 17.2072 0.00233
NP_440436.1_4 Forward -236 -227 13.9623 0.0193
NP_440436.1_4 Forward -15 -6 8.55409 0.0997
NP_441884.1_8 Reverse -6 -25 -8.06369 0.259
NP_441884.1_9 Forward -240 -221 -23.6 0.284
NP_442412.1_5 Forward -316 -297 17.699 0.0365
NP_441719.1_4 Forward -133 -126 16.3621 0.0124
NP_441719.1_4 Reverse -126 -133 16.3621 0.0124
NP_441719.1_4 Reverse -8 -15 6.82395 0.0855
NP_441719.1_4 Reverse -229 -236 6.72562 0.093
NP_441719.1_4 Forward -236 -229 6.62729 0.151
NP_441719.1_4 Forward -15 -8 6.52896 0.188
NP_441733.1_10 Reverse -122 -135 7.39411 0.153
NP_441733.1_10 Forward -19 -6 3.95252 0.28
NP_441004.1_1 Reverse -54 -73 -14.0619 0.263
NP_441004.1_1 Reverse -119 -138 -14.9469 0.271
NP_442366.1_3 Forward -135 -117 16.2438 0.0198
NP_442366.1_3 Reverse -6 -24 0.707465 0.166
NP_442366.1_3 Reverse -124 -142 -2.43913 0.228
NP_442366.1_5 Reverse -225 -235 17.2858 0.0141
NP_442366.1_5 Reverse -122 -132 14.0409 0.0497
NP_442366.1_5 Reverse -4 -14 13.3526 0.0775
NP_440129.1_10 Forward -141 -127 6.58777 0.177
NP_442873.1_3 Forward -144 -125 7.37347 0.211
NP_441115.1_4 Forward -135 -117 12.703 0.0976
NP_441115.1_4 Reverse -6 -24 8.47483 0.247
NP_442694.1_4 Forward -83 -74 12.6844 0.248
NP_442206.1_9 Forward -237 -218 15.1416 0.28
NP_442206.1_10 Reverse -7 -22 8.63302 0.167
NP_442206.1_10 Reverse -125 -140 4.60145 0.178
NP_442206.1_10 Forward -134 -119 2.14318 0.205
NP_443054.1_2 Forward -136 -122 1.86788 0.245
NP_441966.1_8 Reverse -119 -137 -1.45582 0.198
NP_440864.1_3 Reverse -79 -98 6.78429 0.297
NP_441851.1_10 Forward -135 -125 16.008 0.00552
NP_441851.1_10 Reverse -124 -134 15.8113 0.00552
NP_441851.1_10 Reverse -6 -16 7.55152 0.137
NP_441851.1_10 Forward -268 -258 5.48657 0.211
NP_442814.1_3 Forward -229 -211 25.9785 0.00696
NP_442011.1_1 Reverse -6 -25 -1.37718 0.268
NP_442856.1_7 Forward -143 -124 -2.45882 0.236
NP_442515.1_1 Reverse -227 -241 5.1128 0.107
NP_442515.1_1 Reverse -124 -138 -4.81863 0.298
NP_440593.1_3 Reverse -120 -139 -0.983855 0.211
NP_440463.1_8 Forward -355 -336 5.85408 0.277
NP_440165.1_5 Reverse -6 -25 -8.26035 0.297
NP_441046.1_2 Forward -303 -284 2.3594 0.24
NP_442689.1_8 Reverse -147 -164 -4.77938 0.267
NP_440940.1_7 Forward -144 -126 12.5064 0.0927
NP_441349.1_10 Reverse -115 -134 0.786102 0.0864
NP_441409.1_6 Reverse -119 -138 1.17943 0.062
NP_441409.1_6 Forward -140 -121 -15.5368 0.297
NP_440432.1_9 Reverse -229 -244 6.07642 0.0481
NP_442843.1_1 Reverse -229 -248 -10.1286 0.276
NP_440474.1_8 Forward -71 -57 7.47213 0.204
NP_440431.1_3 Forward -135 -116 6.78429 0.0886
NP_442450.1_5 Forward -136 -126 9.32148 0.115
NP_442450.1_5 Reverse -123 -133 7.55152 0.13
NP_440588.1_2 Reverse -116 -135 11.7008 0.0311
NP_440588.1_2 Reverse -122 -141 2.0644 0.125
NP_440588.1_2 Forward -109 -90 -5.50708 0.252
NP_441003.1_9 Forward -354 -335 3.83436 0.291
NP_441570.1_1 Reverse -125 -143 0.21581 0.0403
NP_441570.1_1 Forward -100 -82 -4.8974 0.075
NP_441570.1_1 Reverse -43 -61 -12.4689 0.214
NP_441570.1_1 Reverse -228 -246 -15.2222 0.228
NP_440078.1_4 Forward -145 -126 13.4708 0.19
NP_441078.1_4 Forward -134 -125 19.6659 0.0007
NP_441078.1_4 Reverse -125 -134 19.6659 0.0007
NP_441078.1_4 Forward -267 -258 3.44131 0.14
NP_441078.1_4 Reverse -228 -237 0.0980582 0.205
NP_441078.1_4 Reverse -7 -16 0.0980582 0.205
NP_441078.1_4 Forward -237 -228 0.0980582 0.205
NP_441078.1_4 Forward -16 -7 0.0980582 0.205
NP_442729.1_5 Reverse -227 -237 8.1415 0.248
NP_442729.1_8 Forward -138 -125 8.08242 0.125
NP_442348.1_2 Forward -84 -75 13.5694 0.179
NP_440526.1_3 Forward -133 -122 8.02298 0.126
NP_440526.1_3 Reverse -229 -240 0.64819 0.273
NP_441432.1_8 Reverse -124 -133 16.8143 0.00595
NP_441432.1_8 Forward -135 -126 8.25953 0.0755
NP_441432.1_8 Reverse -227 -236 7.17789 0.102
NP_441432.1_8 Forward -346 -337 6.98123 0.112
NP_441432.1_8 Reverse -6 -15 5.50626 0.151
NP_442320.1_8 Forward -140 -126 6.88276 0.0227
NP_442320.1_8 Reverse -119 -133 -2.06536 0.0851
NP_442320.1_8 Forward -22 -8 -3.54032 0.124
NP_441732.1_2 Forward -138 -122 2.02515 0.0253
NP_441732.1_2 Reverse -121 -137 -7.51295 0.0859
NP_441732.1_2 Forward -260 -244 -8.10294 0.116
NP_440760.1_1 Reverse -125 -144 -20.65 0.224
NP_442797.1_7 Forward -141 -123 3.95239 0.234
NP_442797.1_7 Forward -238 -220 0.117479 0.278
NP_440199.1_10 Reverse -388 -398 14.238 0.0861
NP_441945.1_10 Reverse -124 -143 8.84924 0.273
NP_441805.1_1 Reverse -97 -116 -4.52377 0.249
NP_442298.1_9 Forward -335 -322 19.8815 0.118
NP_440913.1_1 Reverse -226 -244 3.55906 0.298
NP_440713.1_4 Forward -144 -125 4.52268 0.226
NP_440713.1_4 Reverse -115 -134 0.884433 0.3
NP_442489.1_2 Reverse -120 -139 8.94757 0.168
NP_442489.1_2 Forward -139 -120 0.687771 0.297
NP_442489.1_7 Forward -134 -125 20.1576 0.000695
NP_442489.1_7 Reverse -125 -134 20.1576 0.000695
NP_442489.1_7 Forward -237 -228 0.786375 0.152
NP_442489.1_7 Forward -16 -7 0.786375 0.152
NP_442489.1_7 Reverse -228 -237 0.589713 0.17
NP_442489.1_7 Reverse -7 -16 0.589713 0.17
NP_440757.1_7 Forward -74 -56 9.26226 0.156
NP_440565.1_7 Reverse -120 -139 -0.787193 0.278
NP_441706.1_10 Reverse -330 -349 10.5209 0.218
NP_440559.1_1 Forward -133 -124 17.4043 0.00658
NP_440559.1_1 Forward -236 -227 14.1594 0.0317
NP_440559.1_1 Reverse -126 -135 8.75118 0.0586
NP_440559.1_1 Reverse -8 -17 5.99792 0.135
NP_441659.2_8 Forward -134 -124 18.1713 0.00133
NP_441659.2_8 Reverse -125 -135 11.9764 0.0147
NP_441659.2_8 Forward -16 -6 6.56821 0.0714
NP_441659.2_8 Reverse -228 -238 6.46988 0.0744
NP_441659.2_8 Reverse -7 -17 1.74999 0.227
NP_441659.2_8 Forward -250 -240 0.57002 0.262
NP_441040.1_2 Forward -77 -58 -0.787193 0.128
NP_441040.1_2 Reverse -123 -142 -9.34199 0.236
NP_440442.1_3 Forward -141 -127 17.7975 0.187
NP_441800.1_3 Reverse -120 -138 10.9339 0.279
NP_441800.1_3 Forward -139 -121 6.11567 0.286
NP_442346.1_5 Reverse -124 -134 16.6963 0.00248
NP_442346.1_5 Forward -135 -125 9.02648 0.118
NP_442346.1_5 Reverse -227 -237 6.8632 0.188
NP_442346.1_5 Reverse -59 -69 6.27322 0.208
NP_442346.1_5 Forward -251 -241 4.50326 0.286
NP_442346.1_5 Forward -238 -228 4.40493 0.29
NP_442346.1_5 Forward -17 -7 4.3066 0.291
NP_440545.1_3 Reverse -121 -138 19.3117 0.00865
NP_440545.1_3 Reverse -56 -73 -4.87771 0.235
NP_440486.1_5 Forward -99 -80 12.6841 0.255
NP_441653.1_2 Forward -145 -126 4.88249 0.252
NP_440010.1_4 Forward -144 -125 1.57197 0.234
NP_440010.1_4 Reverse -121 -140 0.981987 0.243
NP_442311.1_5 Forward -316 -297 6.09597 0.245
NP_442603.1_7 Forward -134 -120 11.307 0.117
NP_442603.1_7 Reverse -7 -21 8.3571 0.176
NP_441888.1_7 Forward -139 -125 3.93283 0.225
NP_440449.1_6 Forward -77 -59 5.33794 0.279
NP_441948.1_4 Reverse -221 -239 -2.63579 0.173
NP_441833.1_4 Forward -133 -126 15.9687 0.0124
NP_441833.1_4 Reverse -126 -133 15.9687 0.0124
NP_441833.1_4 Forward -236 -229 14.1004 0.0258
NP_441833.1_4 Forward -15 -8 6.52896 0.0924
NP_441833.1_4 Reverse -8 -15 6.23397 0.163
NP_441833.1_4 Reverse -229 -236 6.13563 0.198
NP_441833.1_4 Reverse -64 -71 4.56234 0.248
NP_442162.1_9 Forward -133 -126 16.2637 0.0124
NP_442162.1_9 Reverse -126 -133 16.2637 0.0124
NP_442162.1_9 Forward -15 -8 12.9205 0.0282
NP_442162.1_9 Reverse -8 -15 12.9205 0.0282
NP_442162.1_9 Forward -236 -229 6.62729 0.142
NP_442162.1_9 Reverse -229 -236 6.52896 0.178
NP_440671.1_4 Forward -140 -126 14.0609 0.0698
NP_440671.1_4 Reverse -119 -133 8.84938 0.188
NP_442199.1_5 Forward -142 -123 5.60432 0.0948
NP_442199.1_5 Forward -160 -141 -5.40875 0.245
NP_442140.1_3 Reverse -229 -239 15.123 0.0433
NP_442140.1_3 Forward -15 -5 14.1397 0.0501
NP_442140.1_3 Forward -133 -123 12.2714 0.0632
NP_442140.1_3 Reverse -126 -136 8.33817 0.119
NP_442140.1_3 Forward -71 -61 7.55152 0.135
NP_442021.1_3 Reverse -1 -20 3.93269 0.153
NP_440875.1_9 Reverse -127 -137 9.05339 0.233
NP_440875.1_9 Reverse -357 -367 8.66404 0.233
NP_441813.1_5 Forward -136 -126 17.188 0.00979
NP_441813.1_5 Reverse -123 -133 8.63316 0.0367
NP_441813.1_5 Forward -18 -8 4.79825 0.144
NP_441813.1_5 Reverse -5 -15 0.176696 0.215
NP_441813.1_5 Forward -239 -229 -0.609952 0.261
NP_442089.1_1 Reverse -225 -244 -2.45882 0.298
NP_442089.1_6 Forward -95 -76 5.30933 0.26
NP_440590.1_4 Forward -133 -120 12.9006 0.013
NP_440590.1_4 Forward -236 -223 6.80412 0.0565
NP_440590.1_4 Reverse -126 -139 4.8375 0.0585
NP_440590.1_4 Forward -15 -2 -1.06236 0.21
NP_440590.1_4 Reverse -8 -21 -5.78224 0.289
NP_440567.1_1 Reverse -126 -140 15.3392 0.0177
NP_440567.1_1 Reverse -8 -22 8.35772 0.0584
NP_440567.1_1 Forward -236 -222 7.86607 0.0642
NP_440567.1_1 Forward -133 -119 6.58777 0.0816
NP_440567.1_1 Forward -15 -1 3.24451 0.148
NP_442497.1_10 Forward -133 -124 10.4228 0.0087
NP_442497.1_10 Reverse -126 -135 10.4228 0.0087
NP_442497.1_10 Reverse -8 -17 5.99792 0.095
NP_442497.1_10 Reverse -229 -238 0.983037 0.123
NP_442497.1_10 Forward -236 -227 0.688044 0.141
NP_442497.1_10 Forward -15 -6 0.589713 0.153
NP_440821.1_4 Forward -136 -126 19.0562 0.00399
NP_440821.1_4 Reverse -123 -133 9.41981 0.0286
NP_440821.1_4 Forward -239 -229 7.45319 0.0708
NP_440821.1_4 Reverse -5 -15 0.471689 0.174
NP_440821.1_4 Reverse -226 -236 -0.41329 0.257
NP_441239.1_9 Forward -18 -6 14.592 0.0271
NP_441239.1_9 Forward -136 -124 13.3137 0.037
NP_441239.1_9 Forward -247 -235 6.82381 0.175
NP_441239.1_9 Reverse -123 -135 5.93884 0.202
NP_441239.1_9 Forward -239 -227 4.95553 0.234
NP_441239.1_9 Reverse -353 -365 3.48056 0.285
NP_441951.1_4 Reverse -125 -144 8.94757 0.256
NP_441009.1_4 Forward -134 -115 15.4374 0.165
NP_441009.1_4 Forward -303 -284 11.4058 0.255
NP_442691.1_2 Forward -156 -137 5.30933 0.247
NP_441727.1_3 Reverse -118 -137 5.30933 0.254
NP_440400.1_1 Reverse -285 -304 5.11187 0.22
NP_441892.1_1 Forward -143 -126 5.05372 0.105
NP_441892.1_1 Forward -246 -229 3.0871 0.131
NP_442044.1_1 Forward -139 -120 -13.7669 0.279
NP_442193.1_1 Forward -303 -285 9.45892 0.245
NP_442643.1_1 Forward -140 -121 -11.2103 0.231
NP_441769.1_3 Forward -181 -162 9.63507 0.0645
NP_440863.1_1 Forward -291 -277 15.0642 0.236
NP_442138.1_10 Reverse -125 -144 6.68596 0.0757
NP_440546.1_4 Reverse -7 -17 16.1543 0.0459
NP_440546.1_4 Reverse -228 -238 11.9852 0.0679
NP_440546.1_4 Reverse -125 -135 11.8882 0.0679
NP_440546.1_4 Forward -134 -124 10.046 0.109
NP_440546.1_4 Forward -16 -6 10.046 0.109
NP_439974.1_4 Reverse -92 -111 7.57094 0.288
NP_441509.1_1 Reverse -111 -130 10.4225 0.223
NP_440462.1_6 Forward -18 -8 15.8113 0.0142
NP_440462.1_6 Forward -136 -126 15.418 0.0142
NP_440462.1_6 Reverse -123 -133 1.35667 0.294
NP_442611.1_1 Reverse -7 -26 17.699 0.0415
NP_442611.1_1 Forward -72 -53 -3.04881 0.297
NP_442611.1_2 Forward -151 -132 20.1564 0.135
NP_442144.1_1 Reverse -4 -20 15.5948 0.152
NP_440868.1_4 Forward -138 -126 8.6921 0.0582
NP_440868.1_4 Reverse -3 -15 8.10212 0.0602
NP_440868.1_4 Reverse -224 -236 6.1355 0.0878
NP_440868.1_4 Reverse -121 -133 6.1355 0.0878
NP_441497.1_3 Reverse -154 -173 -2.16383 0.2
NP_441868.1_4 Reverse -52 -66 16.9125 0.258
NP_441868.1_4 Reverse -384 -398 15.8309 0.282
NP_441474.1_1 Reverse -299 -318 -1.77127 0.264
NP_441474.1_1 Reverse -288 -307 -2.95123 0.29
NP_442402.1_10 Forward -190 -180 10.501 0.288
NP_440653.1_10 Forward -133 -114 7.27595 0.203
NP_442460.1_3 Reverse -43 -62 15.2408 0.208
NP_442882.1_7 Reverse -221 -235 10.717 0.288
NP_440843.1_8 Reverse -54 -73 12.7825 0.297
NP_442039.1_4 Forward -133 -126 15.1821 0.0124
NP_442039.1_4 Reverse -126 -133 15.1821 0.0124
NP_442039.1_4 Reverse -8 -15 11.6422 0.0747
NP_441811.1_8 Reverse -137 -151 14.7492 0.162
NP_442273.1_5 Forward -176 -157 17.0428 0.222
NP_440825.1_7 Forward -133 -123 12.9096 0.152
NP_440825.1_7 Reverse -144 -154 12.2265 0.177
NP_442837.1_3 Forward -133 -126 15.7721 0.0124
NP_442837.1_3 Reverse -126 -133 15.7721 0.0124
NP_442837.1_3 Forward -236 -229 6.13563 0.25
NP_442837.1_3 Forward -15 -8 6.0373 0.25
NP_442837.1_3 Reverse -8 -15 6.0373 0.25
NP_442837.1_3 Reverse -229 -236 5.93897 0.265
NP_440160.1_9 Forward -262 -243 11.7992 0.216
NP_442053.1_1 Forward -134 -125 18.3876 0.0007
NP_442053.1_1 Reverse -125 -134 18.3876 0.0007
NP_442053.1_1 Reverse -228 -237 7.76787 0.0895
NP_442053.1_1 Forward -237 -228 7.17789 0.104
NP_442053.1_1 Forward -16 -7 7.17789 0.104
NP_440505.1_3 Forward -136 -126 13.8447 0.0247
NP_440505.1_3 Reverse -123 -133 9.22315 0.122
NP_440505.1_3 Reverse -226 -236 7.94484 0.147
NP_440505.1_3 Reverse -5 -15 5.19158 0.241
NP_441102.1_1 Reverse -126 -145 3.6377 0.285
NP_441203.1_1 Reverse -8 -27 -6.68705 0.122
NP_441203.1_1 Forward -133 -114 -19.4701 0.297
NP_441203.1_1 Reverse -126 -145 -20.65 0.298
NP_440914.1_1 Forward -134 -124 17.5935 0.000537
NP_440914.1_1 Forward -237 -227 13.4947 0.0297
NP_440914.1_1 Reverse -125 -135 8.6151 0.186
NP_441011.1_8 Reverse -126 -135 16.9127 0.00602
NP_441011.1_8 Reverse -8 -17 14.356 0.0249
NP_441011.1_8 Forward -133 -124 8.25953 0.144
NP_441011.1_8 Forward -15 -6 7.07956 0.179
NP_442533.1_1 Reverse -122 -141 -15.8318 0.257
NP_442533.1_6 Forward -134 -125 17.2076 0.00137
NP_442533.1_6 Reverse -125 -134 17.2076 0.00137
NP_442533.1_6 Reverse -7 -16 5.40793 0.14
NP_442533.1_6 Forward -267 -258 4.81794 0.172
NP_442533.1_6 Forward -16 -7 4.52295 0.179
NP_442533.1_6 Forward -364 -355 2.16301 0.27
NP_442232.1_3 Reverse -52 -71 7.96426 0.0823
NP_442322.1_4 Reverse -287 -304 -3.20676 0.243
NP_442229.1_1 Reverse -123 -137 7.27547 0.196
NP_441482.1_7 Forward -140 -126 10.0294 0.0135
NP_441482.1_7 Reverse -119 -133 -8.5552 0.193
NP_441482.1_7 Forward -22 -8 -12.1934 0.29
NP_439944.1_9 Forward -133 -123 10.5014 0.0887
NP_439944.1_9 Reverse -126 -136 10.3048 0.0887
NP_439944.1_9 Reverse -8 -18 6.76487 0.168
NP_439944.1_9 Reverse -229 -239 6.46988 0.179
NP_440816.1_7 Forward -241 -222 11.7008 0.218
NP_440116.1_5 Reverse -122 -139 7.61033 0.155
NP_440116.1_5 Reverse -225 -242 1.71047 0.298
NP_440116.1_8 Reverse -8 -27 5.11266 0.0663
NP_441527.1_4 Reverse -74 -93 -7.40105 0.232
NP_441527.1_4 Reverse -185 -204 -7.68752 0.236
NP_441527.1_4 Reverse -73 -92 -11.9847 0.285
NP_440115.1_6 Reverse -122 -132 9.32148 0.115
NP_440115.1_6 Reverse -225 -235 8.33817 0.13
NP_440115.1_6 Forward -19 -9 5.87989 0.214
NP_440007.1_9 Forward -138 -124 3.73617 0.267
NP_439965.1_1 Reverse -116 -135 2.16274 0.115
NP_439965.1_1 Forward -143 -124 -5.9004 0.211
NP_441602.1_3 Reverse -2 -21 7.7676 0.118
NP_441602.1_4 Forward -145 -126 17.2074 0.231
NP_441972.1_5 Forward -145 -126 -5.40875 0.22
NP_441106.1_1 Forward -135 -126 18.191 0.0028
NP_441106.1_1 Reverse -124 -133 9.63616 0.0311
NP_441106.1_1 Reverse -6 -15 8.45619 0.0548
NP_441106.1_1 Forward -17 -8 7.96454 0.0647
NP_441106.1_1 Reverse -62 -71 2.94966 0.248
NP_441420.1_1 Reverse -227 -246 6.68596 0.131
NP_440429.1_6 Reverse -83 -102 17.994 0.253
NP_439903.1_6 Reverse -122 -141 0.293673 0.267
NP_442928.1_3 Forward -23 -4 13.8694 0.246
NP_441286.1_1 Reverse -227 -239 20.6885 0.00225
NP_441286.1_1 Reverse -124 -136 14.4936 0.00418
NP_441286.1_1 Forward -135 -123 3.38223 0.0467
NP_440670.1_8 Forward -134 -125 18.3876 0.000699
NP_440670.1_8 Reverse -125 -134 18.3876 0.000699
NP_440670.1_8 Reverse -7 -16 8.65285 0.0627
NP_440670.1_8 Forward -237 -228 6.8829 0.0907
NP_440670.1_8 Forward -16 -7 6.29291 0.124
NP_440886.1_3 Reverse -343 -362 19.2723 0.281
NP_440886.1_7 Forward -135 -125 17.7774 0.0011
NP_440886.1_7 Reverse -124 -134 7.94438 0.0805
NP_440886.1_7 Forward -141 -131 5.48612 0.181
NP_442614.1_2 Forward -134 -120 8.25939 0.255
NP_442072.1_9 Reverse -124 -142 -23.187 0.284
NP_442072.1_9 Reverse -6 -24 -23.187 0.284
NP_440907.2_8 Forward -15 -5 12.4676 0.0624
NP_440907.2_8 Reverse -126 -136 7.84605 0.117
NP_440907.2_8 Forward -133 -123 7.64939 0.117
NP_440907.2_8 Reverse -8 -18 6.76441 0.15
NP_440841.1_4 Forward -136 -117 -6.78538 0.215
NP_440841.1_4 Reverse -314 -333 -9.047 0.251
NP_441463.1_3 Forward -144 -125 -8.35868 0.268
NP_441463.1_3 Forward -150 -131 -9.53865 0.28
NP_441463.1_6 Reverse -123 -137 5.54623 0.287
NP_441626.1_2 Forward -133 -126 15.7721 0.0124
NP_441626.1_2 Reverse -126 -133 15.7721 0.0124
NP_441626.1_2 Reverse -8 -15 12.2322 0.0511
NP_441626.1_2 Forward -236 -229 6.0373 0.212
NP_441626.1_2 Reverse -229 -236 6.0373 0.212
NP_441626.1_2 Forward -15 -8 5.93897 0.231
NP_442365.1_7 Reverse -121 -140 -5.40875 0.269
NP_440107.1_5 Reverse -124 -143 10.0292 0.139
NP_442794.1_1 Reverse -121 -133 21.9668 0.00123
NP_442794.1_1 Forward -138 -126 10.1671 0.0721
NP_442615.1_1 Reverse -116 -134 7.39397 0.0317
NP_442615.1_1 Forward -25 -7 2.37909 0.0686
NP_442615.1_1 Reverse -219 -237 -1.75081 0.132
NP_442615.1_1 Forward -143 -125 -6.56903 0.252
NP_441962.1_4 Reverse -55 -74 -4.72043 0.16
NP_441962.1_4 Reverse -120 -139 -11.5053 0.241
NP_441962.1_4 Forward -139 -120 -13.7669 0.277
NP_440387.1_1 Reverse -125 -141 13.6282 0.00825
NP_440387.1_1 Forward -134 -118 -3.57971 0.162
NP_440855.1_5 Forward -142 -123 2.45694 0.291
NP_441431.1_2 Forward -19 -5 15.5352 0.0467
NP_441431.1_2 Forward -137 -123 11.5037 0.136
NP_441431.1_2 Reverse -312 -326 6.98048 0.255
NP_441488.1_8 Reverse -120 -134 12.782 0.146
NP_441836.1_1 Reverse -114 -133 13.7395 0.223
NP_441836.1_2 Reverse -1 -20 -2.36049 0.229
NP_441993.1_1 Reverse -125 -144 4.67549 0.215
NP_440114.1_10 Forward -16 -2 6.98109 0.25
NP_441425.1_2 Reverse -101 -120 13.3189 0.247
NP_441817.1_7 Reverse -244 -263 14.4541 0.287
NP_442437.1_3 Reverse -297 -316 11.6017 0.193
NP_442437.1_8 Reverse -126 -145 9.53756 0.213
NP_442437.1_8 Reverse -132 -151 5.70265 0.247
NP_441510.2_7 Forward -237 -223 11.4053 0.28
NP_441510.2_7 Forward -146 -132 10.9137 0.28
NP_440287.1_6 Forward -239 -220 1.76941 0.266
NP_440293.1_3 Forward -354 -335 -6.98204 0.296
NP_440766.1_4 Reverse -121 -135 8.75105 0.0871
NP_440766.1_4 Forward -138 -124 8.25939 0.0871
NP_439988.1_3 Forward -94 -80 4.22782 0.295
NP_441237.1_9 Forward -133 -123 14.828 0.0242
NP_441237.1_9 Reverse -229 -239 12.8614 0.102
NP_441237.1_9 Forward -236 -226 10.5014 0.228
NP_439910.1_2 Forward -142 -125 -21.3973 0.183
NP_440457.1_1 Forward -138 -126 8.29878 0.101
NP_440457.1_1 Reverse -312 -324 0.825626 0.25
NP_440457.1_1 Reverse -121 -133 -0.452677 0.263
NP_440798.1_6 Forward -236 -223 6.21414 0.14
NP_440798.1_6 Forward -15 -2 4.93583 0.142
NP_440798.1_6 Reverse -1 -14 0.510939 0.259
NP_440142.1_7 Forward -133 -114 10.1275 0.203
NP_442509.1_9 Reverse -125 -135 16.2041 0.00739
NP_442509.1_9 Reverse -91 -101 10.4026 0.179
NP_442509.1_9 Forward -134 -124 8.14104 0.192
NP_442509.1_9 Reverse -228 -238 6.27276 0.279
NP_441489.1_3 Reverse -319 -333 9.56081 0.232
NP_440734.1_9 Forward -240 -221 15.1424 0.199
NP_440554.1_4 Reverse -126 -136 14.6313 0.02
NP_440554.1_4 Reverse -8 -18 7.74818 0.096
NP_440554.1_4 Forward -15 -5 4.40493 0.19
NP_442737.1_5 Reverse -124 -143 12.2972 0.264
NP_442737.1_7 Forward -319 -300 16.1257 0.259
NP_441885.1_5 Forward -134 -124 20.9245 0.000538
NP_441885.1_5 Reverse -125 -135 11.4848 0.00668
NP_441885.1_5 Reverse -7 -17 7.84651 0.0419
NP_441885.1_5 Forward -267 -257 6.37155 0.0618
NP_441885.1_5 Forward -237 -227 1.35667 0.11
NP_442703.1_2 Reverse -104 -123 13.6959 0.259
NP_442341.1_7 Reverse -124 -138 17.7975 0.0111
NP_442341.1_7 Forward -135 -121 16.1259 0.0186
NP_442341.1_7 Reverse -251 -265 2.16287 0.267
NP_442341.1_9 Forward -136 -122 16.3219 0.0371
NP_442395.2_4 Forward -135 -116 7.57013 0.139
NP_442395.2_4 Reverse -6 -25 7.27514 0.14
NP_443000.1_7 Reverse -123 -133 10.3048 0.0345
NP_443000.1_7 Forward -136 -126 8.73149 0.0437
NP_443000.1_7 Reverse -226 -236 0.471689 0.298
NP_440076.1_9 Reverse -258 -271 18.9965 0.166
NP_440507.2_3 Reverse -122 -141 9.53674 0.218
NP_441842.1_1 Forward -235 -222 16.1449 0.0484
NP_441842.1_10 Reverse -221 -235 17.7975 0.0203
NP_441842.1_10 Forward -141 -127 8.94771 0.203
NP_440275.1_3 Reverse -61 -71 14.238 0.0236
NP_440275.1_3 Forward -136 -126 8.4365 0.0602
NP_440275.1_3 Forward -239 -229 8.04317 0.0602
NP_440275.1_3 Reverse -123 -133 8.04317 0.0602
NP_440275.1_3 Reverse -5 -15 5.78156 0.131
NP_440091.1_1 Reverse -59 -71 7.90546 0.072
NP_440091.1_1 Forward -138 -126 1.41561 0.197
NP_440679.1_10 Reverse -133 -152 -15.1435 0.25
NP_440679.1_10 Reverse -127 -146 -16.0285 0.25
NP_441635.1_1 Reverse -101 -120 8.83258 0.236
NP_439962.1_4 Forward -24 -5 -3.3438 0.251
NP_440149.1_8 Reverse -125 -144 13.9625 0.0273
NP_441105.1_3 Forward -145 -126 4.42435 0.0794
NP_441105.1_3 Reverse -114 -133 2.16274 0.107
NP_441105.1_3 Forward -27 -8 -9.73531 0.295
NP_442373.1_2 Forward -310 -291 -2.95047 0.198
NP_442373.1_2 Reverse -122 -141 -9.63698 0.265
NP_440216.1_1 Reverse -125 -139 -2.26202 0.0484
NP_440216.1_1 Reverse -228 -242 -4.4253 0.111
NP_440216.1_1 Forward -16 -2 -4.62196 0.113
NP_440216.1_1 Forward -237 -223 -9.63684 0.145
NP_440216.1_1 Forward -134 -120 -10.2268 0.145
NP_440216.1_1 Reverse -7 -21 -12.2918 0.256
NP_440216.1_9 Forward -126 -117 15.536 0.128
NP_440172.1_1 Forward -134 -124 15.0247 0.00945
NP_440172.1_1 Reverse -7 -17 10.1081 0.0551
NP_440172.1_1 Reverse -125 -135 8.73149 0.0586
NP_440172.1_1 Reverse -228 -238 7.45319 0.0789
NP_440172.1_1 Forward -303 -293 2.24165 0.279
NP_441008.1_4 Forward -237 -218 15.3494 0.295
NP_442015.1_10 Reverse -121 -134 19.8821 0.00366
NP_442015.1_10 Forward -138 -125 19.1938 0.00444
NP_441226.1_7 Forward -133 -126 14.4934 0.0123
NP_441226.1_7 Reverse -126 -133 14.4934 0.0123
NP_441226.1_7 Reverse -8 -15 12.7234 0.0312
NP_441226.1_7 Forward -15 -8 11.5435 0.0757
NP_441226.1_7 Forward -230 -223 6.52862 0.253
NP_441757.1_3 Reverse -124 -143 1.76941 0.159
NP_441757.1_3 Reverse -227 -246 -1.57384 0.25
NP_441111.1_7 Forward -133 -125 18.7023 0.00294
NP_441111.1_7 Reverse -126 -134 18.7023 0.00294
NP_441111.1_7 Forward -236 -228 8.96754 0.0463
NP_441111.1_7 Forward -15 -7 8.86921 0.0589
NP_442379.1_10 Reverse -221 -238 4.16874 0.156
NP_441766.1_2 Forward -134 -125 17.5026 0.00297
NP_441766.1_2 Reverse -125 -134 17.5026 0.00297
NP_441766.1_2 Forward -237 -228 8.65285 0.0495
NP_441766.1_2 Reverse -7 -16 8.1612 0.0645
NP_441766.1_2 Forward -16 -7 5.89959 0.103
NP_442417.1_5 Reverse -125 -139 12.0943 0.0981
NP_442417.1_5 Forward -16 -2 7.37441 0.19
NP_440416.1_1 Reverse -7 -26 -14.0619 0.284
NP_440416.1_9 Forward -141 -122 5.01433 0.0355
NP_440416.1_9 Reverse -118 -137 0.0977854 0.0556
NP_440416.1_9 Reverse -221 -240 -18.4868 0.259
NP_443052.1_8 Reverse -53 -72 -6.09707 0.141
NP_443052.1_8 Forward -26 -7 -11.2103 0.224
NP_442116.1_6 Forward -171 -154 6.25912 0.283
NP_440591.1_9 Reverse -124 -142 8.57394 0.18
NP_442154.1_1 Reverse -132 -150 -16.9921 0.247
NP_440261.1_5 Forward -133 -120 -2.83231 0.0932
NP_440261.1_5 Reverse -126 -139 -10.5021 0.201
NP_440261.1_5 Forward -15 -2 -10.6988 0.203
NP_440261.1_5 Reverse -229 -242 -10.8955 0.221
NP_440261.1_5 Reverse -8 -21 -11.2888 0.255
NP_440261.1_5 Forward -236 -223 -12.3704 0.284
NP_440988.1_10 Forward -136 -122 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGATGACCATTCCAGTTAACTTAGCTGGTTTACCGGCCATGAGTGTGCCCTGTGGCTTTGACGACAATAATTTACCCATTGGCCTGCAATTGGTGGGCAATGTGTTAGGGGAAGAAATGCTATTCCGGGTGGGCTATGCCTATGAACAAGCCACCACATGGCACGATCGCCAACCGGATTTATCGGCCTAATATTTTATTGTTTAGCTGCTTTTCCGCAGGTCCAGCAATATTTTGAAATTGAAGCTGCAATCAAAACCGCCACGGCGATCGCCAAGGAAAATAATTGTCTTTTTCTCGGCGTTCCTGCTCCTTGGGCCTTTTTTCTGCGGTCGTAGCCCCGCCCAGGAGTTAACCGTTCCTCTCACTGACCTGTGTCCCGAACCGATCGCCGAAAGG

CDS

ATGACTCCCCATGTGGTGAAAGCTGGGGAAACCATTGACAGCATCGCCGCCCAATATCAACTAGTGCCGGCCACCCTGATCAGTGTGAACAATCAGTTGTCCAGTGGTCAAGTTACCCCAGGGCAGACGATTTTGATTCCCCCCTTTAACGGTCGTTTTGTTTCCGCACCAGCGGGGGCCACTTGGCGGGATTTAGCATCGGCCTATGGTTTACGGGCAGATATTTTATTTGAAATCAACGGTTGCACAGAAAAGCCCAGTCGTGCCTTTATTCCCGGCATCAGTTGGGGGGGAAATGCCCCTAGCAATGTGGATAACTACACGGGCTTGGCCCAATGGCCCATTCAACCAACTCCCAAAATTGGCCTAGATTACGGCTGGCAAAATCAGGCCGCGGGGCAAGATGCCTTTTTTCACAGTGGCGTAGATCTGTTAGCCCCCTTGGATACCCCCGTTATGGCCGCTGCCGCCGGGGAGGTGATTTTAGTTAGCCAGGAAGGGGCCTATGGTTTCCTGGTGGTCATTGACCATGGCAATGGCCGTCAAACCCGCTATGCCCATCTGAGTCGATTTGCGGTGGATCCTGGGGAAAAAGTCCCCGCTGGTACTGTAATTGGCTATGTAGGCAGTACTGGCCGACCGGATATTGCTTCATCCCATCTTCATTTTGAAGTAAGGGTTCAATCCCCTGTTGGTTGGGCGGCCCAGGATCCGAAGTTACATTTACCCCGCCCATAG

Protein

MTPHVVKAGETIDSIAAQYQLVPATLISVNNQLSSGQVTPGQTILIPPFNGRFVSAPAGATWRDLASAYGLRADILFEINGCTEKPSRAFIPGISWGGNAPSNVDNYTGLAQWPIQPTPKIGLDYGWQNQAAGQDAFFHSGVDLLAPLDTPVMAAAAGEVILVSQEGAYGFLVVIDHGNGRQTRYAHLSRFAVDPGEKVPAGTVIGYVGSTGRPDIASSHLHFEVRVQSPVGWAAQDPKLHLPRP