Your browser is old and dusty. Try Google Chrome!

Details for slr0868

ORF slr0868
Accession NP_441136.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -96 -82 19.7641 0.0139
NP_441061.1_2 Forward -305 -291 7.66941 0.1
NP_440795.1_7 Forward -96 -89 14.6904 0.0123
NP_440795.1_7 Reverse -89 -96 14.6904 0.0123
NP_441418.1_6 Forward -97 -78 -11.8003 0.0565
NP_441418.1_6 Reverse -88 -107 -29.7948 0.238
NP_440815.1_5 Forward -312 -293 6.98095 0.262
NP_442291.1_5 Reverse -87 -103 9.69497 0.0492
NP_441453.1_4 Reverse -88 -96 16.539 0.00633
NP_441453.1_4 Forward -97 -89 16.539 0.00633
NP_441453.1_4 Forward -179 -171 4.14932 0.264
NP_441623.1_1 Forward -134 -116 -4.50408 0.274
NP_442151.1_6 Forward -97 -83 12.586 0.0718
NP_442151.1_6 Reverse -296 -310 10.226 0.127
NP_442151.1_6 Reverse -88 -102 5.89945 0.256
NP_441818.1_1 Forward -96 -85 13.1362 0.0861
NP_441818.1_1 Reverse -89 -100 9.59626 0.232
NP_441818.1_9 Reverse -291 -310 -10.3253 0.292
NP_440226.1_1 Reverse -88 -107 21.4356 0.00635
NP_441630.1_3 Reverse -80 -99 0.58944 0.272
NP_442623.1_3 Forward -96 -77 -10.7186 0.193
NP_441098.1_3 Forward -283 -264 -7.45889 0.294
NP_441098.1_3 Reverse -13 -32 -7.6503 0.296
NP_440150.1_2 Forward -95 -76 5.11187 0.276
NP_442744.1_9 Forward -103 -89 14.3866 0.266
NP_442173.1_1 Forward -96 -88 15.4574 0.00633
NP_442173.1_1 Reverse -89 -97 15.4574 0.00633
NP_442752.1_4 Forward -97 -90 13.8055 0.0199
NP_442752.1_4 Reverse -88 -95 13.8055 0.0199
NP_443027.1_4 Forward -99 -89 16.2046 0.0437
NP_443027.1_4 Reverse -86 -96 13.1564 0.0521
NP_441745.1_3 Reverse -353 -372 13.0766 0.298
NP_441812.1_3 Reverse -87 -101 20.8458 0.00667
NP_442975.1_10 Forward -101 -87 21.3367 0.00107
NP_442975.1_10 Reverse -84 -98 11.5037 0.0497
NP_440784.1_7 Forward -96 -89 15.9687 0.0123
NP_440784.1_7 Reverse -89 -96 15.9687 0.0123
NP_442909.1_7 Forward -96 -82 8.84875 0.161
NP_442289.1_4 Forward -231 -215 15.2998 0.195
NP_440061.1_9 Forward -99 -85 16.6169 0.0239
NP_440061.1_9 Forward -181 -167 6.58715 0.239
NP_440878.1_9 Reverse -78 -97 -0.688862 0.22
NP_442062.1_8 Forward -97 -87 17.3846 0.00193
NP_442062.1_8 Reverse -88 -98 10.3048 0.0493
NP_441859.1_3 Forward -98 -79 17.7965 0.0382
NP_440304.1_4 Forward -99 -89 19.9412 0.00364
NP_440304.1_4 Reverse -86 -96 9.91146 0.051
NP_442242.1_4 Forward -96 -89 14.3954 0.0124
NP_442242.1_4 Reverse -89 -96 14.3954 0.0124
NP_440044.1_8 Reverse -89 -108 8.16093 0.0769
NP_441210.1_8 Reverse -369 -388 16.7157 0.1
NP_441208.1_9 Reverse -167 -181 8.16106 0.219
NP_441208.1_9 Reverse -85 -99 7.27608 0.223
NP_441594.1_6 Forward -362 -343 -0.39387 0.299
NP_440370.1_10 Forward -314 -295 9.43923 0.229
NP_440370.1_10 Forward -309 -290 7.17762 0.265
NP_442110.1_7 Reverse -296 -310 7.17775 0.123
NP_442110.1_7 Reverse -88 -102 1.96621 0.222
NP_442110.1_7 Forward -97 -83 0.687908 0.252
NP_441083.1_5 Forward -97 -87 20.3345 0.00053
NP_441083.1_5 Reverse -88 -98 11.2881 0.0159
NP_441083.1_5 Reverse -253 -263 3.91327 0.162
NP_442827.1_8 Reverse -80 -99 5.70185 0.115
NP_441738.1_2 Forward -95 -88 15.28 0.0102
NP_441738.1_2 Reverse -90 -97 15.28 0.0102
NP_441738.1_2 Forward -303 -296 10.0685 0.125
NP_441558.1_5 Forward -236 -217 8.84924 0.138
NP_440209.1_1 Reverse -88 -96 18.1123 0.00295
NP_440209.1_1 Forward -97 -89 18.1123 0.00295
NP_442889.1_8 Forward -100 -86 9.93039 0.0933
NP_442889.1_8 Forward -116 -102 4.22722 0.27
NP_441713.1_1 Forward -240 -221 -11.4069 0.226
NP_441713.1_1 Reverse -82 -101 -15.2418 0.261
NP_441770.1_4 Forward -222 -203 -3.24547 0.198
NP_441770.1_5 Reverse -342 -361 1.86774 0.238
NP_440178.1_7 Reverse -87 -106 4.12936 0.0199
NP_440178.1_7 Reverse -169 -188 -13.5702 0.139
NP_440178.1_7 Reverse -380 -399 -22.9117 0.282
NP_441716.1_1 Forward -97 -83 10.4227 0.0956
NP_442111.1_4 Forward -98 -84 10.226 0.0553
NP_442111.1_4 Forward -306 -292 6.29277 0.131
NP_442111.1_4 Reverse -87 -101 1.96621 0.292
NP_441624.1_7 Reverse -225 -239 19.1741 0.0856
NP_440851.1_3 Forward -42 -23 1.96607 0.275
NP_440906.1_5 Forward -96 -89 15.8704 0.0124
NP_440906.1_5 Reverse -89 -96 15.8704 0.0124
NP_440747.1_10 Reverse -85 -97 7.4138 0.00422
NP_440747.1_10 Forward -100 -88 -1.92764 0.0192
NP_440747.1_10 Forward -182 -170 -11.8591 0.161
NP_440747.1_10 Reverse -167 -179 -11.8591 0.161
NP_440747.1_10 Reverse -66 -78 -12.3507 0.27
NP_441130.1_10 Reverse -86 -100 6.29277 0.194
NP_441854.1_10 Reverse -246 -265 1.57275 0.282
NP_441486.1_1 Forward -100 -86 5.21113 0.0384
NP_441486.1_1 Reverse -85 -99 -4.4253 0.198
NP_442634.1_4 Reverse -86 -100 5.80112 0.051
NP_442634.1_4 Forward -99 -85 -3.44199 0.161
NP_442634.1_4 Reverse -168 -182 -3.63866 0.161
NP_440842.1_10 Forward -243 -229 2.85119 0.273
NP_440842.1_10 Reverse -230 -244 1.47456 0.292
NP_441014.1_10 Reverse -87 -106 14.9449 0.0692
NP_441014.1_10 Reverse -183 -202 -1.8696 0.267
NP_442848.1_1 Reverse -82 -96 7.37441 0.0791
NP_442848.1_1 Forward -103 -89 6.6861 0.0791
NP_443018.1_3 Forward -96 -89 14.8871 0.0123
NP_443018.1_3 Reverse -89 -96 14.8871 0.0123
NP_443018.1_3 Reverse -171 -178 4.26735 0.267
NP_443018.1_3 Forward -178 -171 4.16902 0.278
NP_441316.1_10 Reverse -229 -246 13.1169 0.298
NP_441634.1_8 Reverse -86 -100 -4.62196 0.295
NP_440376.1_1 Forward -97 -88 19.4693 0.000692
NP_440376.1_1 Reverse -88 -97 19.4693 0.000692
NP_440376.1_1 Reverse -170 -179 14.356 0.01
NP_440376.1_1 Forward -179 -170 0.393051 0.279
NP_441588.1_4 Reverse -90 -100 6.66654 0.185
NP_441588.1_4 Forward -95 -85 6.37155 0.2
NP_442687.1_7 Forward -98 -88 9.02648 0.0994
NP_442687.1_7 Reverse -87 -97 8.92815 0.0994
NP_442687.1_7 Forward -160 -150 5.5849 0.194
NP_442687.1_7 Forward -180 -170 4.89658 0.23
NP_441077.1_2 Reverse -3 -22 1.57519 0.282
NP_442946.1_6 Forward -62 -43 15.708 0.291
NP_440781.1_1 Reverse -163 -177 16.2242 0.227
NP_440642.1_10 Reverse -155 -169 2.65393 0.277
NP_441013.1_2 Reverse -333 -351 -4.79907 0.299
NP_442296.1_9 Forward -96 -77 -4.13045 0.266
NP_442658.1_1 Forward -99 -89 13.0576 0.04
NP_442658.1_1 Reverse -86 -96 9.616 0.147
NP_442782.1_2 Forward -305 -291 0.687908 0.286
NP_442205.1_9 Forward -103 -87 4.28677 0.156
NP_440656.1_8 Forward -108 -89 0.58944 0.128
NP_441414.1_9 Forward -97 -78 -4.6221 0.158
NP_442937.1_5 Reverse -83 -102 13.8641 0.0867
NP_441958.1_5 Forward -98 -88 21.2195 0.000805
NP_441958.1_5 Reverse -87 -97 12.2714 0.00183
NP_441958.1_5 Forward -180 -170 1.94665 0.0664
NP_441958.1_5 Reverse -169 -179 1.94665 0.0664
NP_442836.1_5 Reverse -82 -101 14.0608 0.0588
NP_442836.1_5 Reverse -322 -341 2.45773 0.259
NP_440950.1_10 Reverse -27 -46 12.9769 0.232
NP_439905.1_1 Forward -178 -165 17.2272 0.045
NP_440984.1_7 Reverse -226 -240 6.3911 0.217
NP_441097.1_2 Reverse -293 -310 3.48043 0.293
NP_439990.1_5 Reverse -83 -96 12.8023 0.106
NP_442911.1_2 Reverse -78 -97 15.2408 0.011
NP_440153.1_5 Forward -96 -82 8.06273 0.149
NP_440153.1_5 Reverse -89 -103 8.06273 0.149
NP_440153.1_8 Forward -240 -227 -3.4223 0.295
NP_440369.1_9 Reverse -91 -110 22.1934 0.0381
NP_442064.1_4 Reverse -340 -359 5.30853 0.271
NP_443055.1_3 Forward -106 -87 20.9582 0.0201
NP_443055.1_6 Forward -397 -379 0.706727 0.24
NP_442236.1_3 Reverse -341 -360 7.96426 0.248
NP_440993.1_2 Forward -102 -86 15.5948 0.0631
NP_440993.1_2 Reverse -83 -99 2.32015 0.268
NP_440602.1_8 Reverse -88 -102 13.3726 0.174
NP_440138.1_6 Forward -96 -77 9.04509 0.178
NP_441099.1_5 Reverse -78 -97 -0.4922 0.0937
NP_441294.1_7 Forward -101 -87 14.914 0.033
NP_441646.1_1 Reverse -81 -100 15.5357 0.0796
NP_441646.1_1 Reverse -374 -393 5.30933 0.182
NP_442438.1_10 Reverse -83 -97 1.17956 0.204
NP_442885.1_4 Forward -375 -362 15.5371 0.264
NP_441000.1_6 Reverse -87 -101 -4.81863 0.252
NP_442771.1_1 Forward -99 -81 -10.3056 0.254
NP_440147.1_4 Forward -99 -86 13.0973 0.0326
NP_440147.1_4 Forward -181 -168 5.62415 0.119
NP_440147.1_4 Reverse -86 -99 1.49425 0.226
NP_441550.1_8 Reverse -86 -96 16.7941 0.00906
NP_441550.1_8 Forward -99 -89 13.0576 0.0273
NP_441916.1_7 Reverse -88 -98 18.9579 0.00144
NP_441916.1_7 Forward -97 -87 10.3048 0.0261
NP_441916.1_7 Reverse -170 -180 6.66654 0.0875
NP_441916.1_10 Forward -105 -86 0.786102 0.275
NP_441041.1_4 Reverse -88 -107 -7.37537 0.186
NP_441041.1_7 Forward -100 -88 9.65268 0.108
NP_441041.1_7 Reverse -293 -305 4.98816 0.282
NP_442396.1_5 Reverse -314 -327 5.72248 0.271
NP_441547.1_2 Reverse -159 -177 4.05072 0.26
NP_440703.1_9 Forward -240 -227 8.2785 0.238
NP_441725.1_4 Reverse -83 -97 2.35894 0.287
NP_441725.1_5 Reverse -89 -99 11.1898 0.0247
NP_441725.1_5 Forward -96 -86 9.02648 0.0553
NP_441725.1_5 Reverse -151 -161 -0.0199663 0.223
NP_439966.1_7 Reverse -86 -96 14.8275 0.0177
NP_439966.1_7 Forward -99 -89 14.8275 0.0177
NP_439966.1_7 Forward -307 -297 10.6976 0.0838
NP_439966.1_9 Reverse -86 -95 0.884706 0.253
NP_442941.1_3 Reverse -89 -99 19.9412 0.00262
NP_442941.1_3 Forward -96 -86 10.9931 0.0116
NP_442941.1_3 Forward -178 -168 -0.0199663 0.244
NP_442941.1_3 Reverse -171 -181 -0.0199663 0.244
NP_440289.1_2 Forward -100 -87 13.3923 0.0132
NP_440289.1_2 Reverse -85 -98 -4.7006 0.294
NP_440983.1_5 Forward -97 -78 -2.45882 0.231
NP_440983.1_5 Forward -246 -227 -6.68705 0.278
NP_442281.1_1 Forward -102 -88 17.8952 0.00513
NP_442281.1_1 Reverse -83 -97 6.88214 0.113
NP_442281.1_1 Forward -184 -170 4.71887 0.184
NP_442281.1_1 Forward -310 -296 2.06395 0.278
NP_441079.1_7 Forward -37 -18 -4.52452 0.25
NP_440018.1_3 Forward -239 -220 5.40766 0.28
NP_440177.1_9 Reverse -80 -99 10.9142 0.298
NP_442256.1_2 Reverse -86 -104 -1.94747 0.188
NP_442256.1_2 Forward -242 -224 -6.86402 0.214
NP_442012.1_1 Reverse -374 -393 4.12936 0.174
NP_442982.1_5 Forward -107 -88 -2.55715 0.286
NP_442982.1_5 Forward -315 -296 -2.65548 0.287
NP_441644.1_6 Reverse -88 -98 19.0557 0.000803
NP_441644.1_6 Forward -97 -87 17.3841 0.00127
NP_441644.1_6 Reverse -170 -180 8.04271 0.11
NP_441644.1_6 Forward -179 -169 7.84605 0.115
NP_441644.1_6 Forward -305 -295 4.30615 0.242
NP_442215.1_2 Reverse -86 -102 -5.05468 0.244
NP_442215.1_2 Forward -392 -376 -6.92296 0.281
NP_442177.1_5 Reverse -299 -313 7.57108 0.297
NP_442029.1_6 Reverse -291 -310 3.34271 0.282
NP_440253.1_2 Forward -97 -79 4.24738 0.106
NP_440253.1_2 Reverse -88 -106 -2.93078 0.28
NP_440929.1_8 Forward -97 -88 19.2726 0.000701
NP_440929.1_8 Reverse -88 -97 19.2726 0.000701
NP_440929.1_8 Forward -179 -170 6.68623 0.0887
NP_440566.1_6 Reverse -168 -187 14.8474 0.18
NP_442933.1_10 Forward -97 -88 17.601 0.00325
NP_442933.1_10 Reverse -88 -97 17.601 0.00325
NP_442933.1_10 Reverse -170 -179 5.01461 0.204
NP_441751.2_8 Forward -96 -82 6.88276 0.0348
NP_441751.2_8 Reverse -89 -103 5.50613 0.0423
NP_442554.1_8 Forward -96 -86 18.0729 0.00543
NP_442554.1_8 Reverse -89 -99 16.9913 0.0065
NP_442554.1_8 Reverse -254 -264 9.22315 0.0617
NP_442554.1_8 Forward -178 -168 6.76487 0.107
NP_442554.1_8 Reverse -171 -181 6.66654 0.111
NP_442554.1_8 Forward -239 -229 3.71661 0.215
NP_441762.1_7 Forward -98 -86 2.79224 0.0676
NP_441762.1_7 Reverse -87 -99 -6.94252 0.284
NP_442142.1_4 Forward -100 -87 13.5883 0.0348
NP_442142.1_4 Reverse -85 -98 4.83694 0.209
NP_442142.1_4 Forward -243 -230 4.64028 0.214
NP_442142.1_4 Forward -350 -337 4.24695 0.227
NP_442142.1_4 Forward -182 -169 2.96866 0.269
NP_442292.1_1 Forward -96 -87 18.486 0.00229
NP_442292.1_1 Reverse -89 -98 17.5026 0.00435
NP_442292.1_1 Forward -178 -169 5.11294 0.162
NP_442476.1_6 Forward -96 -82 1.67122 0.207
NP_443009.1_5 Reverse -87 -98 14.5128 0.02
NP_443009.1_5 Forward -98 -87 10.1862 0.0792
NP_443009.1_5 Forward -180 -169 4.38475 0.249
NP_441865.1_3 Forward -136 -118 13.9821 0.242
NP_441715.1_4 Reverse -89 -99 14.238 0.0295
NP_441715.1_4 Forward -96 -86 7.84651 0.107
NP_440357.1_3 Reverse -167 -186 -0.983855 0.296
NP_441198.1_5 Forward -95 -82 18.7999 0.206
NP_441198.1_8 Forward -99 -89 13.2713 0.108
NP_440379.1_5 Reverse -166 -185 -4.6221 0.215
NP_441468.1_1 Forward -96 -89 15.8704 0.0124
NP_441468.1_1 Reverse -89 -96 15.8704 0.0124
NP_441468.1_1 Reverse -171 -178 4.36568 0.237
NP_441020.2_6 Reverse -86 -103 12.9202 0.0824
NP_441673.1_1 Forward -97 -88 20.8459 0.000698
NP_441673.1_1 Reverse -88 -97 20.8459 0.000698
NP_441673.1_1 Forward -179 -170 1.57302 0.0764
NP_441673.1_1 Reverse -170 -179 1.57302 0.0764
NP_441826.1_2 Reverse -82 -96 13.7659 0.0214
NP_441826.1_2 Forward -103 -89 2.06454 0.136
NP_441764.1_8 Forward -55 -45 11.5978 0.284
NP_442868.1_6 Reverse -86 -96 17.4829 0.012
NP_442868.1_6 Forward -99 -89 1.06167 0.205
NP_442719.1_2 Forward -365 -347 -2.43985 0.186
NP_441612.1_2 Forward -97 -87 8.54929 0.21
NP_442559.1_3 Forward -243 -224 11.1109 0.214
NP_442427.1_3 Reverse -83 -101 6.01734 0.171
NP_442808.1_1 Forward -98 -88 8.73102 0.0481
NP_442808.1_1 Reverse -87 -97 8.63269 0.0481
NP_442808.1_1 Forward -180 -170 4.89613 0.185
NP_442808.1_1 Reverse -204 -214 3.91283 0.218
NP_440031.1_10 Reverse -333 -352 1.96607 0.264
NP_440145.1_3 Forward -107 -88 17.7974 0.00908
NP_440145.1_3 Forward -189 -170 -3.04881 0.185
NP_442542.1_9 Forward -91 -77 6.78381 0.223
NP_442050.1_5 Forward -99 -89 18.0724 0.00365
NP_442050.1_5 Reverse -86 -96 15.6142 0.01
NP_442050.1_5 Forward -307 -297 12.4676 0.0617
NP_440630.1_1 Forward -223 -204 8.06259 0.242
NP_442739.1_3 Reverse -106 -120 19.0751 0.115
NP_441518.1_3 Forward -107 -88 -6.58872 0.14
NP_441878.1_6 Forward -98 -88 10.5014 0.0176
NP_441878.1_6 Reverse -87 -97 10.4031 0.0176
NP_441878.1_6 Reverse -169 -179 2.53664 0.0363
NP_441878.1_6 Forward -180 -170 0.0783647 0.152
NP_441878.1_6 Reverse -230 -240 -0.0199663 0.163
NP_441878.1_6 Forward -390 -380 -7.68978 0.255
NP_441036.1_8 Forward -98 -88 15.713 0.00724
NP_441036.1_8 Reverse -87 -97 8.33817 0.174
NP_441557.1_5 Forward -97 -88 19.9609 0.000699
NP_441557.1_5 Reverse -88 -97 19.9609 0.000699
NP_441557.1_5 Forward -179 -170 0.688044 0.128
NP_441557.1_5 Reverse -170 -179 0.688044 0.128
NP_441445.1_1 Forward -106 -87 5.60432 0.166
NP_442066.2_4 Reverse -318 -337 -8.45701 0.294
NP_442066.2_9 Reverse -84 -97 10.2457 0.154
NP_441433.1_8 Reverse -226 -245 8.06259 0.161
NP_440084.1_8 Reverse -22 -36 15.0039 0.185
NP_441308.1_8 Forward -99 -89 13.353 0.218
NP_440101.1_3 Reverse -71 -90 4.916 0.207
NP_440101.1_3 Reverse -220 -239 3.6377 0.226
NP_440101.1_3 Reverse -291 -310 1.17943 0.282
NP_442183.1_1 Reverse -88 -102 18.5841 0.00743
NP_442183.1_1 Forward -97 -83 18.2892 0.00781
NP_442397.1_9 Reverse -350 -369 7.57094 0.246
NP_440595.1_8 Forward -97 -78 12.5858 0.247
NP_442135.1_1 Forward -178 -159 20.6736 0.134
NP_442135.1_8 Forward -108 -90 9.95058 0.233
NP_441574.1_1 Forward -97 -78 -3.63879 0.241
NP_441574.1_1 Reverse -63 -82 -6.29373 0.276
NP_442347.1_2 Forward -96 -87 12.4878 0.056
NP_442347.1_2 Reverse -89 -98 3.34298 0.284
NP_442645.1_2 Reverse -372 -391 -13.8652 0.165
NP_441037.1_4 Reverse -86 -96 9.55921 0.21
NP_441037.1_4 Forward -99 -89 7.31769 0.237
NP_442317.1_6 Reverse -83 -102 11.8975 0.174
NP_441633.1_3 Forward -99 -86 -3.4223 0.177
NP_441633.1_3 Reverse -86 -99 -6.17557 0.238
NP_440136.1_2 Forward -96 -89 15.9687 0.0123
NP_440136.1_2 Reverse -89 -96 15.9687 0.0123
NP_442590.1_9 Reverse -168 -187 4.42435 0.273
NP_442590.1_10 Reverse -218 -237 5.80098 0.258
NP_442998.1_5 Reverse -258 -268 13.353 0.158
NP_442998.1_5 Reverse -259 -269 11.3864 0.187
NP_442998.1_10 Forward -95 -88 15.5754 0.0102
NP_442998.1_10 Reverse -90 -97 15.5754 0.0102
NP_442998.1_10 Reverse -152 -159 10.4622 0.0819
NP_442998.1_10 Reverse -352 -359 7.21728 0.144
NP_440299.1_1 Reverse -84 -97 22.2414 0.000575
NP_441799.1_1 Forward -101 -87 11.2087 0.0606
NP_441799.1_1 Forward -331 -317 6.39049 0.174
NP_441799.1_1 Reverse -166 -180 5.89884 0.19
NP_441799.1_1 Reverse -84 -98 4.71887 0.238
NP_441799.1_1 Forward -183 -169 4.22722 0.261
NP_441007.1_10 Reverse -83 -96 8.57408 0.112
NP_441007.1_10 Forward -102 -89 2.47756 0.186
NP_442201.1_10 Forward -190 -171 -7.86702 0.205
NP_440256.1_1 Reverse -85 -104 -2.36049 0.116
NP_440256.1_1 Forward -100 -81 -3.04881 0.126
NP_440256.1_1 Forward -182 -163 -3.83545 0.14
NP_440256.1_1 Reverse -293 -312 -10.227 0.297
NP_440256.1_1 Reverse -167 -186 -10.227 0.297
NP_441559.1_8 Reverse -165 -179 10.3243 0.0595
NP_440915.1_6 Reverse -84 -98 22.1241 0.00318
NP_440915.1_6 Reverse -292 -306 -3.24533 0.292
NP_442158.1_2 Forward -38 -19 15.4215 0.247
NP_441296.1_4 Reverse -292 -311 14.1591 0.267
NP_440717.1_1 Forward -84 -65 7.27595 0.265
NP_442866.1_1 Reverse -291 -310 7.17762 0.115
NP_442866.1_1 Reverse -164 -183 3.34271 0.151
NP_440306.1_8 Forward -275 -256 2.26028 0.204
NP_441199.1_6 Forward -101 -82 5.11266 0.155
NP_442957.1_4 Reverse -223 -242 16.4207 0.139
NP_442993.1_1 Reverse -88 -104 -0.334789 0.0725
NP_442386.1_9 Reverse -87 -96 13.8639 0.0289
NP_442386.1_9 Forward -98 -89 6.39082 0.219
NP_442386.1_9 Forward -241 -232 5.0142 0.27
NP_441340.1_5 Forward -96 -89 15.6737 0.0124
NP_441340.1_5 Reverse -89 -96 15.6737 0.0124
NP_441340.1_5 Forward -178 -171 4.07068 0.239
NP_441340.1_5 Reverse -297 -304 3.97235 0.274
NP_442791.1_9 Reverse -325 -344 11.2084 0.3
NP_440327.1_6 Forward -226 -207 10.4225 0.191
NP_442240.1_2 Reverse -89 -108 -13.6686 0.171
NP_440161.1_3 Reverse -86 -105 11.9958 0.193
NP_440586.1_8 Forward -96 -89 13.2151 0.026
NP_440586.1_8 Reverse -89 -96 13.2151 0.026
NP_440586.1_8 Forward -178 -171 7.70858 0.227
NP_442251.1_6 Forward -96 -89 15.2804 0.0124
NP_442251.1_6 Reverse -89 -96 15.2804 0.0124
NP_441912.1_2 Reverse -291 -310 19.7814 0.173
NP_441912.1_3 Forward -347 -328 7.66927 0.27
NP_440684.1_9 Reverse -82 -96 11.6026 0.173
NP_441262.1_3 Reverse -88 -95 14.7888 0.0223
NP_441262.1_3 Forward -97 -90 14.7888 0.0223
NP_441262.1_3 Reverse -296 -303 11.6422 0.0477
NP_440027.1_3 Forward -240 -222 9.35981 0.184
NP_443051.1_1 Forward -98 -89 19.5676 0.00335
NP_443051.1_1 Reverse -87 -96 10.4228 0.00754
NP_443051.1_1 Reverse -295 -304 4.71961 0.111
NP_443051.1_1 Reverse -169 -178 0.29472 0.195
NP_443051.1_1 Forward -180 -171 0.29472 0.195
NP_439937.1_9 Forward -98 -81 -16.0881 0.287
NP_442294.1_3 Reverse -181 -195 14.8469 0.215
NP_440408.1_7 Reverse -375 -394 6.88262 0.298
NP_440439.1_1 Forward -100 -87 1.88757 0.139
NP_440439.1_1 Reverse -85 -98 1.00259 0.164
NP_440439.1_1 Reverse -167 -180 0.805932 0.175
NP_440372.1_2 Forward -96 -89 16.3621 0.0124
NP_440372.1_2 Reverse -89 -96 16.3621 0.0124
NP_441138.1_5 Reverse -48 -61 3.02202 0.297
NP_440316.1_10 Reverse -230 -240 9.02648 0.236
NP_441803.1_2 Forward -178 -159 1.27776 0.235
NP_441572.1_7 Forward -311 -292 -5.31042 0.257
NP_440267.1_2 Forward -102 -88 18.7801 0.0237
NP_440267.1_2 Forward -184 -170 9.93039 0.156
NP_442384.1_10 Forward -97 -84 11.6223 0.0341
NP_442384.1_10 Forward -179 -166 5.42749 0.13
NP_441877.1_5 Reverse -347 -366 0.0977854 0.276
NP_441018.1_7 Reverse -340 -359 8.65258 0.241
NP_440399.1_3 Reverse -363 -382 20.944 0.052
NP_442790.1_4 Reverse -79 -98 26.5488 0.00183
NP_442262.1_10 Forward -96 -89 14.1988 0.0123
NP_442262.1_10 Reverse -89 -96 14.1988 0.0123
NP_441689.1_5 Forward -99 -89 17.8758 0.0158
NP_441689.1_5 Reverse -86 -96 5.87944 0.197
NP_441689.1_5 Forward -307 -297 5.68278 0.215
NP_440344.1_10 Forward -104 -87 -7.23765 0.116
NP_440344.1_10 Reverse -81 -98 -8.61428 0.13
NP_440531.1_6 Reverse -330 -349 0.196116 0.197
NP_440531.1_6 Reverse -223 -242 -2.65548 0.257
NP_440531.1_6 Forward -222 -203 -3.04881 0.26
NP_440297.1_9 Reverse -89 -99 9.22315 0.0917
NP_440297.1_9 Reverse -151 -161 4.40493 0.231
NP_440297.1_9 Forward -96 -86 -0.216628 0.282
NP_440297.1_9 Reverse -226 -236 -0.609952 0.292
NP_440298.1_2 Reverse -285 -304 5.50599 0.282
NP_440700.1_5 Forward -219 -200 15.4374 0.21
NP_441679.1_6 Reverse -83 -102 1.0811 0.243
NP_440999.1_9 Reverse -84 -98 2.45787 0.149
NP_440888.1_2 Forward -97 -83 19.5668 0.00119
NP_440888.1_2 Reverse -88 -102 13.5686 0.027
NP_440888.1_2 Forward -249 -235 5.1122 0.293
NP_440600.1_4 Reverse -80 -98 -0.7675 0.155
NP_440600.1_4 Forward -105 -87 -4.99573 0.272
NP_442277.1_4 Reverse -79 -98 6.88182 0.155
NP_441543.1_2 Forward -96 -87 16.9127 0.00359
NP_441543.1_2 Reverse -89 -98 15.9293 0.00518
NP_441543.1_2 Forward -178 -169 4.22796 0.267
NP_442845.1_2 Reverse -82 -96 14.0609 0.0872
NP_440208.1_1 Forward -237 -218 -1.08219 0.135
NP_441178.1_6 Forward -243 -224 5.70185 0.268
NP_441319.1_8 Reverse -312 -330 5.82068 0.277
NP_442710.1_7 Reverse -18 -37 10.2692 0.0963
NP_441469.1_8 Forward -98 -89 6.5879 0.227
NP_441469.1_8 Reverse -87 -96 6.48957 0.227
NP_443064.1_6 Forward -97 -87 12.5669 0.0796
NP_443064.1_6 Reverse -88 -98 10.8217 0.13
NP_442578.1_7 Forward -96 -89 14.5921 0.026
NP_442578.1_7 Reverse -89 -96 14.5921 0.026
NP_440710.1_1 Forward -105 -87 4.14905 0.113
NP_440710.1_1 Forward -187 -169 -6.86402 0.228
NP_440071.1_5 Reverse -329 -348 9.0459 0.276
NP_441462.1_2 Reverse -88 -98 20.2362 0.000805
NP_441462.1_2 Forward -97 -87 11.5831 0.00406
NP_441462.1_2 Forward -179 -169 1.35667 0.0943
NP_441462.1_2 Reverse -170 -180 0.963343 0.109
NP_441621.1_7 Reverse -86 -100 -5.31028 0.25
NP_443062.1_1 Reverse -88 -106 20.1493 0.0208
NP_443062.1_1 Reverse -170 -188 7.47334 0.175
NP_443062.1_1 Reverse -291 -309 6.40076 0.202
NP_442204.1_1 Reverse -166 -177 0.94365 0.281
NP_442204.1_1 Forward -101 -90 0.157002 0.283
NP_441560.1_10 Forward -105 -86 12.8808 0.138
NP_442780.1_1 Reverse -17 -36 7.57094 0.279
NP_440516.1_8 Forward -97 -88 16.9127 0.00442
NP_440516.1_8 Reverse -88 -97 16.9127 0.00442
NP_440516.1_8 Forward -234 -225 -0.295266 0.232
NP_440516.1_8 Reverse -296 -305 -0.68859 0.297
NP_442428.1_5 Forward -96 -89 15.8704 0.0124
NP_442428.1_5 Reverse -89 -96 15.8704 0.0124
NP_442428.1_5 Reverse -171 -178 4.66067 0.244
NP_442859.1_2 Reverse -89 -108 6.88262 0.199
NP_442120.1_10 Reverse -344 -363 -13.0786 0.28
NP_442823.1_9 Reverse -159 -178 17.8386 0.196
NP_440673.1_3 Forward -95 -88 12.4288 0.0426
NP_440673.1_3 Reverse -90 -97 12.4288 0.0426
NP_440673.1_7 Reverse -77 -96 10.7175 0.111
NP_440865.1_9 Forward -103 -84 -7.4737 0.247
NP_441052.1_2 Forward -97 -87 19.9412 0.00106
NP_441052.1_2 Reverse -88 -98 10.4031 0.0285
NP_441052.1_2 Forward -240 -230 4.89658 0.14
NP_441052.1_2 Forward -389 -379 1.84832 0.225
NP_442219.1_9 Forward -96 -87 17.7976 0.00718
NP_442219.1_9 Reverse -89 -98 8.25953 0.0681
NP_440436.1_4 Forward -96 -87 17.2072 0.00233
NP_440436.1_4 Reverse -89 -98 9.24241 0.0871
NP_441884.1_9 Forward -100 -81 -14.2585 0.138
NP_440314.1_9 Forward -96 -77 -7.67036 0.241
NP_440314.1_9 Reverse -89 -108 -10.4236 0.298
NP_439982.1_10 Forward -280 -261 18.7807 0.0886
NP_442907.1_9 Forward -239 -220 0.58944 0.207
NP_441719.1_4 Forward -96 -89 16.3621 0.0124
NP_441719.1_4 Reverse -89 -96 16.3621 0.0124
NP_441733.1_10 Reverse -85 -98 7.49244 0.153
NP_441004.1_4 Reverse -175 -185 9.02648 0.259
NP_441004.1_4 Forward -236 -226 8.04317 0.282
NP_442366.1_1 Reverse -10 -23 17.0305 0.245
NP_442366.1_3 Forward -98 -80 -0.177514 0.186
NP_442873.1_9 Reverse -78 -97 13.47 0.124
NP_441115.1_4 Forward -180 -162 10.6381 0.17
NP_441115.1_4 Forward -98 -80 8.6715 0.24
NP_442854.1_6 Reverse -88 -107 0.884433 0.287
NP_440328.1_4 Forward -185 -166 0.786102 0.239
NP_443054.1_2 Forward -99 -85 2.85119 0.24
NP_441851.1_10 Reverse -87 -97 15.8113 0.00552
NP_441851.1_10 Forward -98 -88 8.53483 0.114
NP_441668.1_4 Reverse -78 -97 4.71934 0.173
NP_442515.1_1 Forward -98 -84 5.01447 0.107
NP_442515.1_1 Reverse -87 -101 2.65453 0.131
NP_440593.1_3 Reverse -226 -245 -3.83545 0.242
NP_442709.1_4 Forward -37 -18 8.07601 0.161
NP_441349.1_10 Forward -107 -88 5.30933 0.0446
NP_441349.1_10 Reverse -59 -78 2.26107 0.0753
NP_440874.1_2 Forward -29 -10 10.3644 0.288
NP_441409.1_6 Reverse -164 -183 -9.34199 0.182
NP_441409.1_6 Reverse -82 -101 -9.83364 0.194
NP_441409.1_8 Forward -117 -98 7.78774 0.277
NP_441394.1_10 Forward -309 -291 8.86816 0.263
NP_440432.1_9 Reverse -89 -104 13.9429 0.017
NP_440432.1_9 Reverse -171 -186 3.51981 0.0897
NP_442843.1_1 Reverse -254 -273 -10.4236 0.278
NP_442843.1_1 Forward -364 -345 -10.817 0.281
NP_440474.1_8 Reverse -89 -103 5.60385 0.246
NP_440431.1_3 Forward -98 -79 -11.3086 0.286
NP_442450.1_5 Forward -99 -89 9.41981 0.115
NP_441031.1_1 Reverse -10 -29 4.12335 0.292
NP_442006.1_2 Reverse -231 -248 1.61214 0.117
NP_442006.1_2 Reverse -205 -222 -10.6792 0.197
NP_443047.1_7 Reverse -89 -108 17.7974 0.0485
NP_441570.1_1 Reverse -88 -106 17.9154 0.00322
NP_441570.1_1 Reverse -170 -188 -12.7639 0.218
NP_441078.1_4 Forward -97 -88 19.6659 0.0007
NP_441078.1_4 Reverse -88 -97 19.6659 0.0007
NP_441078.1_4 Reverse -170 -179 7.86621 0.0432
NP_441078.1_4 Forward -389 -380 3.44131 0.14
NP_441078.1_4 Forward -179 -170 0.884706 0.154
NP_442729.1_8 Reverse -84 -97 18.2105 0.0325
NP_442443.1_1 Reverse -330 -349 -0.000545616 0.219
NP_440526.1_3 Forward -96 -85 10.7762 0.0646
NP_440526.1_3 Reverse -89 -100 1.82816 0.267
NP_441432.1_8 Reverse -87 -96 16.8143 0.00595
NP_441432.1_8 Forward -98 -89 16.8143 0.00595
NP_441432.1_8 Reverse -169 -178 11.3078 0.0569
NP_442320.1_8 Reverse -82 -96 13.2743 0.0144
NP_442320.1_8 Forward -103 -89 3.8345 0.0578
NP_441732.1_2 Forward -101 -85 2.8118 0.0159
NP_440760.1_1 Forward -97 -78 -7.4737 0.0704
NP_440199.1_10 Forward -100 -90 14.238 0.0861
NP_440913.1_1 Reverse -86 -104 11.5239 0.168
NP_440913.1_1 Reverse -168 -186 7.4923 0.202
NP_440913.1_3 Forward -240 -227 17.9155 0.184
NP_442489.1_7 Forward -97 -88 20.1576 0.000695
NP_442489.1_7 Reverse -88 -97 20.1576 0.000695
NP_442489.1_7 Reverse -170 -179 8.35786 0.0225
NP_442489.1_7 Forward -179 -170 0.884706 0.145
NP_440559.1_1 Forward -96 -87 17.4043 0.00658
NP_440559.1_1 Reverse -89 -98 8.65285 0.0586
NP_441659.2_8 Reverse -88 -98 20.9245 0.000805
NP_441659.2_8 Forward -97 -87 18.1713 0.00133
NP_441659.2_8 Forward -179 -169 9.51814 0.0293
NP_441659.2_8 Reverse -170 -180 1.65166 0.233
NP_442913.1_10 Forward -106 -87 -1.18052 0.167
NP_442913.1_10 Reverse -276 -295 -4.91709 0.251
NP_442913.1_10 Forward -188 -169 -5.99873 0.287
NP_441040.1_2 Reverse -161 -180 -0.197208 0.128
NP_442346.1_5 Reverse -87 -97 16.6963 0.00248
NP_442346.1_5 Forward -98 -88 16.303 0.00248
NP_442346.1_5 Reverse -169 -179 5.97822 0.219
NP_442346.1_5 Forward -180 -170 5.78156 0.229
NP_440352.1_5 Reverse -249 -268 14.5051 0.143
NP_440545.1_3 Reverse -84 -101 -2.91109 0.195
NP_440545.1_3 Forward -183 -166 -6.84433 0.289
NP_440831.1_1 Reverse -219 -238 9.0459 0.29
NP_440459.1_2 Reverse -222 -239 11.1502 0.181
NP_440010.1_3 Reverse -158 -177 2.94938 0.204
NP_442027.1_4 Reverse -43 -62 17.3314 0.144
NP_442603.1_7 Forward -97 -83 17.9935 0.0187
NP_441888.1_7 Reverse -83 -97 2.85119 0.225
NP_441050.1_5 Reverse -315 -333 6.90232 0.181
NP_440449.1_6 Reverse -80 -98 10.6874 0.149
NP_439970.1_2 Reverse -280 -299 19.3707 0.0644
NP_441833.1_4 Forward -96 -89 15.9687 0.0124
NP_441833.1_4 Reverse -89 -96 15.9687 0.0124
NP_441895.1_10 Reverse -256 -275 -18.7818 0.282
NP_441112.1_6 Forward -189 -170 -4.6221 0.297
NP_442162.1_9 Forward -96 -89 16.2637 0.0124
NP_442162.1_9 Reverse -89 -96 16.2637 0.0124
NP_442162.1_9 Reverse -297 -304 9.28223 0.0694
NP_440671.1_4 Forward -103 -89 13.7659 0.0748
NP_440671.1_4 Reverse -290 -304 5.1128 0.292
NP_442140.1_3 Forward -96 -86 13.5497 0.0542
NP_442140.1_3 Reverse -232 -242 3.61828 0.288
NP_440875.1_9 Reverse -172 -182 11.8762 0.147
NP_440875.1_9 Forward -303 -293 11.0001 0.187
NP_440875.1_9 Reverse -90 -100 7.59334 0.255
NP_441813.1_5 Forward -99 -89 15.9097 0.01
NP_441813.1_5 Reverse -86 -96 8.73149 0.0367
NP_441813.1_5 Forward -307 -297 3.02829 0.178
NP_440590.1_4 Forward -96 -83 12.409 0.0141
NP_440567.1_1 Forward -96 -82 12.291 0.0241
NP_442497.1_10 Reverse -89 -98 17.601 0.00813
NP_442497.1_10 Forward -96 -87 10.4228 0.0087
NP_440821.1_4 Reverse -86 -96 17.9746 0.00497
NP_440821.1_4 Forward -99 -89 11.0914 0.0146
NP_441239.1_9 Forward -99 -87 12.1337 0.0494
NP_441239.1_9 Forward -302 -290 7.11881 0.169
NP_441239.1_9 Reverse -86 -98 7.11881 0.169
NP_441239.1_9 Forward -307 -295 4.5622 0.251
NP_441239.1_9 Forward -181 -169 4.16888 0.26
NP_441239.1_9 Reverse -223 -235 3.57889 0.283
NP_441239.1_9 Reverse -168 -180 3.48056 0.285
NP_442897.1_5 Reverse -219 -238 20.4633 0.0737
NP_441727.1_3 Reverse -81 -100 4.32602 0.264
NP_441892.1_1 Forward -106 -89 7.217 0.0915
NP_441892.1_1 Reverse -79 -96 -5.27103 0.276
NP_442193.1_8 Forward -100 -81 10.4217 0.286
NP_442270.1_9 Reverse -71 -90 -3.54046 0.184
NP_442643.1_3 Forward -352 -333 -5.60541 0.261
NP_440612.1_1 Forward -329 -310 10.7175 0.29
NP_441017.1_6 Forward -101 -87 12.192 0.224
NP_441874.1_1 Reverse -78 -92 14.7492 0.173
NP_440900.1_5 Reverse -83 -102 16.6961 0.201
NP_440876.1_5 Forward -95 -76 4.916 0.283
NP_442138.1_10 Reverse -88 -107 10.9142 0.0361
NP_442138.1_10 Reverse -170 -189 -6.68705 0.286
NP_440546.1_4 Reverse -88 -98 13.5365 0.0459
NP_440546.1_4 Forward -97 -87 10.046 0.109
NP_440546.1_4 Reverse -231 -241 6.74945 0.282
NP_440462.1_6 Forward -99 -89 16.893 0.00853
NP_440462.1_6 Reverse -86 -96 10.3048 0.0396
NP_440462.1_6 Forward -307 -297 3.22496 0.255
NP_440868.1_4 Forward -101 -89 5.93884 0.0879
NP_440868.1_4 Reverse -166 -178 0.333971 0.217
NP_440868.1_4 Reverse -84 -96 0.333971 0.217
NP_442402.1_4 Reverse -190 -209 -9.63771 0.292
NP_441848.1_4 Reverse -109 -125 9.65149 0.275
NP_441084.1_6 Forward -99 -85 15.0646 0.0931
NP_440653.1_10 Forward -96 -77 6.39097 0.211
NP_440696.1_3 Reverse -221 -239 15.0638 0.0717
NP_440696.1_3 Reverse -88 -106 -0.275845 0.243
NP_440696.1_3 Reverse -170 -188 -1.55415 0.26
NP_442039.1_4 Forward -96 -89 15.1821 0.0124
NP_442039.1_4 Reverse -89 -96 15.1821 0.0124
NP_442039.1_4 Reverse -297 -304 10.8555 0.109
NP_442039.1_7 Reverse -233 -243 14.4347 0.211
NP_441811.1_8 Reverse -82 -96 7.37441 0.25
NP_441926.1_3 Reverse -88 -104 16.2831 0.0428
NP_441926.1_3 Reverse -170 -186 3.89344 0.206
NP_440825.1_6 Reverse -167 -186 16.8141 0.185
NP_442837.1_3 Forward -96 -89 15.7721 0.0124
NP_442837.1_3 Reverse -89 -96 15.7721 0.0124
NP_440160.1_2 Forward -312 -293 -9.34199 0.293
NP_442053.1_1 Forward -97 -88 18.3876 0.0007
NP_442053.1_1 Reverse -88 -97 18.3876 0.0007
NP_442053.1_1 Reverse -170 -179 5.3096 0.197
NP_440505.1_3 Reverse -86 -96 16.598 0.00683
NP_440505.1_3 Forward -99 -89 15.123 0.014
NP_440505.1_7 Reverse -166 -185 -2.85214 0.294
NP_442532.1_7 Forward -97 -83 6.3911 0.171
NP_441408.2_7 Forward -99 -80 -3.73712 0.277
NP_440914.1_1 Forward -97 -87 17.5935 0.000537
NP_440914.1_1 Reverse -88 -98 16.3248 0.00196
NP_440914.1_1 Forward -305 -295 7.63919 0.228
NP_441011.1_8 Reverse -89 -98 16.6177 0.00602
NP_441011.1_8 Forward -96 -87 8.25953 0.144
NP_442533.1_6 Forward -97 -88 17.2076 0.00137
NP_442533.1_6 Reverse -88 -97 17.2076 0.00137
NP_442533.1_6 Forward -179 -170 8.25953 0.0776
NP_442533.1_6 Reverse -170 -179 6.8829 0.101
NP_442533.1_6 Forward -240 -231 4.0313 0.194
NP_443050.1_2 Forward -345 -326 8.55425 0.265
NP_441482.1_7 Forward -103 -89 6.19444 0.0332
NP_441482.1_7 Reverse -82 -96 -2.65535 0.0979
NP_441482.1_7 Forward -311 -297 -3.44199 0.124
NP_441482.1_7 Forward -240 -226 -9.53851 0.206
NP_439944.1_9 Forward -96 -86 19.1546 0.00329
NP_439944.1_9 Reverse -89 -99 17.6796 0.00347
NP_442203.1_3 Forward -44 -25 2.11053 0.297
NP_440816.1_2 Reverse -5 -24 8.56484 0.244
NP_441749.1_7 Reverse -342 -361 7.96426 0.292
NP_440721.1_5 Forward -352 -333 9.34008 0.221
NP_442202.1_10 Forward -180 -166 3.34284 0.278
NP_440116.1_8 Reverse -297 -316 -6.68705 0.215
NP_441527.1_4 Forward -166 -147 -10.9342 0.277
NP_441527.1_4 Reverse -9 -28 -12.2711 0.285
NP_440115.1_6 Reverse -85 -95 9.7148 0.115
NP_440007.1_9 Reverse -287 -301 3.24451 0.272
NP_440007.1_9 Forward -101 -87 2.85119 0.277
NP_440007.1_9 Forward -309 -295 0.982901 0.29
NP_441972.1_5 Forward -83 -64 -8.55534 0.267
NP_441106.1_1 Forward -98 -89 18.486 0.0028
NP_441106.1_1 Reverse -87 -96 9.63616 0.0311
NP_441106.1_1 Reverse -169 -178 5.80125 0.124
NP_441106.1_3 Reverse -12 -31 15.7324 0.133
NP_439903.1_6 Forward -100 -81 11.11 0.0958
NP_439903.1_6 Reverse -85 -104 -0.984623 0.289
NP_442306.1_10 Reverse -165 -184 -10.9153 0.111
NP_441286.1_1 Reverse -87 -99 14.3953 0.00424
NP_441286.1_1 Forward -98 -86 12.232 0.00999
NP_440670.1_8 Forward -97 -88 18.3876 0.000699
NP_440670.1_8 Reverse -88 -97 18.3876 0.000699
NP_440886.1_7 Forward -98 -88 8.04271 0.0805
NP_440886.1_7 Reverse -87 -97 7.94438 0.0805
NP_440886.1_7 Forward -263 -253 3.22451 0.291
NP_442072.1_9 Reverse -87 -105 -13.4522 0.112
NP_442072.1_9 Forward -98 -80 -21.712 0.212
NP_441427.1_6 Reverse -173 -191 10.6389 0.249
NP_441808.1_8 Reverse -73 -92 6.19431 0.291
NP_440907.2_8 Forward -96 -86 10.8943 0.0969
NP_440907.2_8 Reverse -89 -99 9.51767 0.103
NP_441021.1_1 Forward -96 -77 8.75091 0.0482
NP_440326.1_5 Reverse -86 -99 13.589 0.229
NP_440841.1_4 Forward -99 -80 -6.78538 0.215
NP_441463.1_3 Forward -107 -88 -3.14714 0.17
NP_441463.1_3 Reverse -78 -97 -8.55534 0.271
NP_441463.1_6 Forward -99 -85 16.5625 0.114
NP_441626.1_2 Forward -96 -89 15.7721 0.0124
NP_441626.1_2 Reverse -89 -96 15.7721 0.0124
NP_442365.1_7 Forward -309 -290 0.491109 0.177
NP_442794.1_1 Reverse -84 -96 10.1671 0.0721
NP_442794.1_1 Forward -309 -297 6.72548 0.163
NP_442615.1_1 Reverse -79 -97 -2.0458 0.138
NP_441962.1_4 Reverse -83 -102 -8.16202 0.196
NP_441962.1_4 Forward -102 -83 -11.1119 0.238
NP_441962.1_4 Reverse -226 -245 -15.0452 0.297
NP_440387.1_1 Forward -97 -81 16.8731 0.00458
NP_440387.1_1 Reverse -88 -104 6.54838 0.0282
NP_440855.1_3 Reverse -163 -182 7.27514 0.247
NP_441836.1_1 Reverse -77 -96 13.4473 0.223
NP_440634.1_6 Forward -180 -166 16.3225 0.2
NP_441993.1_1 Reverse -82 -101 6.33227 0.181
NP_441993.1_1 Reverse -170 -189 6.0399 0.188
NP_441993.1_1 Reverse -381 -400 3.70092 0.23
NP_440114.1_10 Reverse -88 -102 19.0758 0.00367
NP_440114.1_10 Reverse -170 -184 8.65272 0.198
NP_442437.1_8 Reverse -232 -251 4.12936 0.267
NP_442698.1_10 Reverse -227 -246 1.0811 0.297
NP_442323.1_7 Forward -305 -286 8.06178 0.163
NP_441272.1_4 Reverse -79 -98 0.392778 0.258
NP_441272.1_7 Forward -214 -204 16.008 0.2
NP_441237.1_9 Forward -96 -86 14.9263 0.0242
NP_439910.1_2 Forward -105 -88 -4.09106 0.0692
NP_442867.1_3 Reverse -88 -107 1.27776 0.223
NP_442867.1_8 Forward -222 -203 7.86593 0.242
NP_440457.1_1 Reverse -84 -96 5.34885 0.141
NP_440457.1_1 Forward -238 -226 1.12062 0.245
NP_440457.1_1 Forward -101 -89 0.137309 0.25
NP_440457.1_1 Reverse -292 -304 0.0389777 0.25
NP_440473.1_9 Forward -108 -89 -6.88371 0.236
NP_440473.1_9 Reverse -236 -255 -7.4737 0.236
NP_442509.1_9 Forward -97 -87 8.14104 0.192
NP_442509.1_9 Reverse -88 -98 8.04271 0.192
NP_442514.1_5 Reverse -224 -243 1.17865 0.178
NP_442514.1_5 Forward -397 -378 -9.34271 0.295
NP_440554.1_4 Reverse -89 -99 16.1063 0.0189
NP_440554.1_4 Forward -304 -294 6.76487 0.114
NP_440554.1_4 Forward -96 -86 6.37155 0.123
NP_440554.1_4 Forward -178 -168 5.5849 0.139
NP_442862.1_3 Reverse -185 -202 3.87375 0.299
NP_441885.1_5 Forward -97 -87 20.9245 0.000538
NP_441885.1_5 Reverse -88 -98 11.3864 0.00668
NP_442341.1_7 Forward -98 -84 11.2093 0.0567
NP_442341.1_7 Forward -360 -346 3.04785 0.237
NP_442341.1_7 Forward -263 -249 1.76955 0.281
NP_442341.1_9 Reverse -294 -308 8.45543 0.17
NP_442341.1_9 Forward -181 -167 4.52221 0.299
NP_441756.1_5 Reverse -166 -185 -4.22878 0.294
NP_441173.1_9 Forward -266 -258 12.1137 0.21
NP_442395.2_4 Forward -98 -79 8.55343 0.123
NP_442534.1_7 Forward -187 -168 7.96426 0.26
NP_440423.1_6 Forward -105 -86 -16.2252 0.232
NP_443000.1_7 Forward -99 -89 17.4829 0.00719
NP_443000.1_7 Reverse -86 -96 10.4031 0.0345
NP_443000.1_7 Reverse -168 -178 8.04317 0.0553
NP_443000.1_7 Forward -181 -171 1.06167 0.274
NP_440076.1_5 Forward -241 -222 12.6833 0.256
NP_441842.1_10 Reverse -81 -95 6.88276 0.271
NP_440275.1_3 Reverse -86 -96 17.6796 0.0102
NP_440275.1_3 Forward -99 -89 9.12481 0.055
NP_440275.1_3 Reverse -294 -304 3.81494 0.21
NP_440091.1_1 Forward -101 -89 8.9871 0.0567
NP_440091.1_1 Reverse -84 -96 1.41561 0.197
NP_441397.1_8 Reverse -256 -269 16.5819 0.142
NP_443010.1_10 Forward -100 -83 3.54386 0.253
NP_441122.1_1 Reverse -376 -391 4.20813 0.28
NP_439962.1_4 Forward -351 -332 -4.52377 0.271
NP_439962.1_8 Reverse -377 -396 9.0459 0.21
NP_440149.1_8 Reverse -350 -369 -0.590531 0.151
NP_441105.1_3 Reverse -77 -96 -0.787193 0.142
NP_442373.1_2 Reverse -301 -320 -10.9153 0.292
NP_440216.1_1 Reverse -170 -184 6.3911 0.0156
NP_440216.1_1 Reverse -88 -102 5.99778 0.0166
NP_440216.1_1 Forward -97 -83 -10.7185 0.146
NP_440216.1_1 Forward -179 -165 -10.9151 0.153
NP_440172.1_1 Reverse -88 -98 17.5813 0.00421
NP_440172.1_1 Forward -97 -87 15.0247 0.00945
NP_440172.1_1 Reverse -170 -180 5.28991 0.146
NP_442015.1_10 Reverse -84 -97 3.5592 0.179
NP_441045.1_4 Reverse -257 -276 18.289 0.264
NP_441226.1_7 Forward -96 -89 14.4934 0.0123
NP_441226.1_7 Reverse -89 -96 14.4934 0.0123
NP_441226.1_7 Forward -178 -171 11.2485 0.0971
NP_441226.1_7 Forward -233 -226 9.47853 0.147
NP_441226.1_7 Forward -310 -303 5.34865 0.289
NP_441485.1_2 Reverse -56 -75 10.0292 0.276
NP_441111.1_7 Forward -96 -88 18.7023 0.00294
NP_441111.1_7 Reverse -89 -97 18.7023 0.00294
NP_441111.1_7 Forward -178 -170 -0.570565 0.233
NP_441111.1_7 Reverse -171 -179 -0.570565 0.233
NP_442379.1_10 Reverse -81 -98 -1.33779 0.223
NP_442379.1_10 Forward -104 -87 -3.8944 0.272
NP_441766.1_2 Forward -97 -88 17.5026 0.00297
NP_441766.1_2 Reverse -88 -97 17.5026 0.00297
NP_443052.1_8 Forward -107 -88 -1.67217 0.081
NP_442116.1_6 Reverse -135 -152 5.2087 0.299
NP_442403.1_9 Reverse -344 -363 3.34271 0.27
NP_440591.1_9 Reverse -81 -99 13.2938 0.0931
NP_442154.1_1 Reverse -223 -241 -15.3205 0.218
NP_442154.1_1 Reverse -167 -185 -17.4838 0.257
NP_442154.1_1 Forward -222 -204 -18.9587 0.288
NP_440261.1_5 Forward -178 -165 -6.56889 0.201
NP_440261.1_5 Forward -96 -83 -10.4038 0.201
NP_440261.1_7 Reverse -252 -271 -1.86883 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGAACCATTGGTCTATGCCCAACCTTTCTGGCTCAGGTATGGCAATATTCACCGCCAAGACTTGGAGCGGGAAGCATTCACCATACAGACCCAACCCAATCGCATGGCCTTAGTTTCTGGTTACCTTAATCAATTTTGCCCATCTCGATAACTCATTTCCGCCAGGGCCAACGGGTACCCATTTCGGTTTTGGCGGACCAAATTAGGTAAAGCACCAACAGGCCAACGCCTGCAAGAAAGGGCAATAGATCTTCTTTCATAACTTCCCACGTCGTAATTTTGCTTAGGCTACAGCAAAAAAAGGCGATCGCCACAGTCAATGACGACAGACAGGTCCAAACTCAAAATAAAATTTCAATACTAAACAACTTTATTAATCTTTACAGTTTTCCTGAGTTG

CDS

GTGGAACTATCATTGTTTTACCAAGATCCCAACTTGATTATAGAGTTTATGTTTTTACAGTCCTGGAAAAGCTTAGAGGGAACCCATTTGAAGGACAAGTACTTACTTGAAACCTTGCTTGGGATTGGTGGGTTCGGCGCAGTGTTTCTGTCAAAAACAGTCGGCCACGATGGGGCGATCGCCAAGGTTGCGGTGAAATTAATGGTCTGGGATAGCAAAAGGGAAAAAGAACAAACCCAAGAACTGGAGTTGGCAACTACGCTCAAGCACGACAGGCTAATCAATTTTGTCGATCTTGATCATTGA

Protein

MELSLFYQDPNLIIEFMFLQSWKSLEGTHLKDKYLLETLLGIGGFGAVFLSKTVGHDGAIAKVAVKLMVWDSKREKEQTQELELATTLKHDRLINFVDLDH