Your browser is old and dusty. Try Google Chrome!

Details for slr0862

ORF slr0862
Accession NP_441125.1
Symbol
Category Other
Definition probable sugar kinase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -239 -253 -2.06536 0.281
NP_440897.1_6 Forward -147 -128 -2.65624 0.219
NP_441818.1_9 Reverse -242 -261 -10.817 0.299
NP_442752.1_4 Forward -247 -240 12.1338 0.0546
NP_440784.1_7 Reverse -57 -64 7.51227 0.138
NP_440928.1_5 Forward -96 -78 11.8189 0.16
NP_440304.1_4 Reverse -49 -59 11.7798 0.051
NP_442097.1_1 Forward -160 -141 4.52268 0.187
NP_442602.1_3 Reverse -363 -382 -1.67217 0.245
NP_442602.1_3 Reverse -114 -133 -1.7705 0.246
NP_441200.1_4 Forward -328 -309 10.3242 0.201
NP_441208.1_1 Forward -187 -168 -6.88371 0.296
NP_441208.1_9 Reverse -120 -134 4.91614 0.282
NP_441594.1_6 Forward -140 -121 3.83436 0.225
NP_441925.1_4 Forward -273 -254 -15.2425 0.263
NP_440273.1_3 Forward -114 -95 13.9625 0.0788
NP_441434.1_3 Reverse -100 -119 -0.4922 0.233
NP_442889.1_1 Forward -127 -108 -15.2418 0.288
NP_440178.1_7 Forward -28 -9 -21.24 0.215
NP_441495.1_6 Reverse -142 -159 22.36 0.0314
NP_442634.1_2 Forward -313 -294 1.17943 0.287
NP_442634.1_4 Reverse -49 -63 -0.688726 0.149
NP_441014.1_8 Reverse -89 -108 -1.86883 0.224
NP_443018.1_3 Reverse -295 -302 8.20058 0.153
NP_440376.1_1 Forward -91 -82 3.34298 0.206
NP_442687.1_7 Forward -323 -313 5.48657 0.2
NP_442485.1_3 Forward -258 -239 -5.50708 0.291
NP_441846.1_10 Forward -190 -171 -22.3217 0.259
NP_440642.1_10 Reverse -263 -277 7.66879 0.221
NP_441013.1_3 Forward -27 -8 8.45592 0.243
NP_440691.1_10 Reverse -126 -145 8.06259 0.269
NP_442720.1_1 Reverse -305 -324 18.0915 0.202
NP_442658.1_1 Reverse -49 -59 5.48612 0.265
NP_441971.1_10 Reverse -117 -136 16.6174 0.137
NP_442782.1_2 Forward -115 -101 0.196253 0.293
NP_442937.1_5 Reverse -358 -377 7.96426 0.237
NP_441127.1_1 Forward -276 -262 9.04604 0.283
NP_442836.1_10 Forward -121 -111 14.7297 0.212
NP_440203.1_5 Forward -57 -47 9.12434 0.271
NP_439990.1_5 Forward -74 -61 7.49244 0.194
NP_440858.1_5 Forward -87 -68 9.43841 0.272
NP_443055.1_6 Forward -59 -41 -1.6532 0.281
NP_442210.1_9 Forward -101 -83 12.3105 0.209
NP_442853.1_6 Reverse -67 -86 18.4238 0.155
NP_442002.1_1 Forward -123 -105 -3.6191 0.212
NP_441646.1_1 Forward -66 -47 4.71934 0.189
NP_441646.1_1 Forward -98 -79 -0.590531 0.269
NP_441125.1_1 Forward -205 -186 21.2389 0.0127
NP_441125.1_2 Forward -388 -369 19.6648 0.0292
NP_441125.1_3 Forward -256 -237 23.2056 0.0187
NP_441125.1_6 Forward -176 -163 18.8988 0.109
NP_441125.1_9 Forward -106 -87 21.828 0.0502
NP_441125.1_10 Forward -133 -119 19.7641 0.156
NP_441175.1_10 Reverse -349 -367 14.8671 0.108
NP_441916.1_10 Reverse -49 -68 2.94938 0.236
NP_441041.1_4 Forward -247 -228 -13.7669 0.295
NP_440569.1_10 Forward -390 -371 3.58052 0.278
NP_441725.1_5 Forward -59 -49 4.89658 0.115
NP_439966.1_9 Reverse -363 -372 6.5879 0.253
NP_440260.1_8 Forward -112 -94 -2.43913 0.243
NP_440260.1_8 Reverse -47 -65 -6.1757 0.287
NP_441079.1_7 Reverse -157 -176 -0.984623 0.2
NP_441556.1_10 Reverse -77 -91 11.3899 0.227
NP_440867.1_10 Reverse -264 -283 0.982764 0.299
NP_442029.1_10 Reverse -127 -146 5.70265 0.284
NP_442926.1_1 Reverse -242 -261 4.81767 0.151
NP_442554.1_8 Forward -59 -49 4.0116 0.2
NP_442075.1_9 Reverse -171 -190 12.3883 0.253
NP_442313.1_4 Forward -96 -77 6.29264 0.288
NP_440919.1_1 Forward -249 -230 -4.22878 0.23
NP_440919.1_7 Forward -108 -90 10.9461 0.171
NP_442381.1_8 Forward -259 -240 -8.85033 0.232
NP_443009.1_5 Reverse -237 -248 10.2846 0.0792
NP_440881.1_4 Forward -146 -127 0.392778 0.226
NP_440881.1_4 Forward -145 -126 -0.885524 0.265
NP_440881.1_7 Reverse -345 -364 16.3224 0.185
NP_440730.1_4 Reverse -122 -141 -2.75381 0.297
NP_441015.1_8 Forward -282 -263 3.04771 0.272
NP_441015.1_8 Forward -335 -316 -0.39387 0.292
NP_441339.1_4 Forward -66 -47 3.24438 0.204
NP_442253.1_5 Reverse -47 -64 0.727158 0.203
NP_441826.1_2 Forward -66 -52 -3.147 0.283
NP_441764.1_8 Forward -203 -193 10.9279 0.291
NP_442719.1_2 Forward -389 -371 -10.1096 0.269
NP_441612.1_2 Reverse -6 -16 8.83972 0.21
NP_443058.1_7 Reverse -39 -58 3.34271 0.263
NP_442808.1_1 Reverse -179 -189 6.0761 0.131
NP_442808.1_1 Reverse -135 -145 5.38779 0.155
NP_440558.1_2 Reverse -47 -66 3.83436 0.153
NP_440558.1_2 Forward -25 -6 2.0644 0.173
NP_440558.1_2 Forward -63 -44 -2.16383 0.223
NP_441878.1_6 Reverse -50 -60 -7.49312 0.231
NP_441036.1_3 Forward -180 -161 8.75091 0.119
NP_441557.1_8 Reverse -239 -249 14.2375 0.201
NP_440084.1_8 Reverse -158 -172 13.5715 0.223
NP_440101.1_10 Forward -121 -102 12.0942 0.137
NP_441458.1_10 Forward -100 -81 5.01433 0.224
NP_441116.1_9 Forward -202 -188 17.5025 0.126
NP_439936.1_3 Reverse -11 -30 15.6341 0.253
NP_441467.1_9 Reverse -251 -265 17.5025 0.142
NP_440136.1_1 Forward -89 -73 11.4642 0.238
NP_442590.1_9 Forward -153 -134 5.80098 0.267
NP_442998.1_5 Forward -203 -193 11.4848 0.184
NP_442333.2_1 Forward -62 -43 -5.31042 0.25
NP_441559.1_8 Reverse -308 -322 2.5562 0.143
NP_441559.1_8 Forward -64 -50 -4.32697 0.222
NP_442158.1_4 Forward -197 -187 10.7964 0.283
NP_441464.1_1 Forward -311 -292 8.94757 0.246
NP_441113.1_3 Forward -181 -167 14.1586 0.295
NP_440306.1_8 Reverse -163 -182 2.75194 0.204
NP_439985.1_7 Reverse -258 -277 5.11266 0.224
NP_440677.1_1 Forward -390 -371 6.29264 0.275
NP_442386.1_10 Reverse -40 -53 5.42749 0.262
NP_440570.1_5 Forward -101 -82 -3.44213 0.289
NP_441750.1_4 Reverse -131 -150 0.786102 0.291
NP_441750.1_7 Forward -188 -178 12.9597 0.278
NP_439976.1_4 Reverse -130 -149 4.62021 0.28
NP_440586.1_8 Reverse -295 -302 9.08521 0.178
NP_440192.1_4 Forward -62 -43 9.00952 0.287
NP_440027.1_3 Reverse -50 -68 4.14829 0.262
NP_439984.1_10 Reverse -129 -143 13.5686 0.186
NP_439937.1_9 Forward -61 -44 -9.7949 0.209
NP_442294.1_3 Reverse -120 -134 14.0603 0.249
NP_440171.1_3 Forward -147 -128 1.86774 0.293
NP_440819.1_5 Forward -325 -317 7.98423 0.228
NP_440316.1_10 Forward -144 -134 9.02648 0.236
NP_441803.1_2 Forward -259 -240 0.687771 0.247
NP_441018.1_7 Forward -101 -82 10.7175 0.199
NP_441018.1_7 Reverse -330 -349 9.53756 0.223
NP_442262.1_10 Reverse -295 -302 9.38056 0.202
NP_441689.1_5 Forward -305 -295 5.28945 0.273
NP_440531.1_1 Forward -323 -304 1.27776 0.286
NP_440531.1_6 Forward -151 -132 -2.85214 0.258
NP_440189.1_2 Forward -160 -141 2.65439 0.268
NP_440297.1_9 Forward -302 -292 -0.511621 0.289
NP_439926.1_7 Forward -331 -313 5.72234 0.268
NP_440803.1_3 Reverse -122 -141 8.65258 0.201
NP_440575.1_1 Reverse -165 -184 3.83357 0.253
NP_443064.1_6 Forward -243 -233 8.49468 0.287
NP_442337.1_8 Reverse -210 -229 -1.37718 0.28
NP_442736.1_1 Reverse -315 -334 3.24438 0.287
NP_443062.1_6 Reverse -305 -324 2.16274 0.26
NP_440519.1_8 Forward -259 -243 10.285 0.199
NP_440519.1_8 Forward -303 -287 0.845183 0.298
NP_442204.1_1 Forward -124 -113 0.0586712 0.284
NP_442080.1_7 Reverse -267 -286 -4.52377 0.296
NP_440104.1_8 Reverse -298 -312 17.7968 0.28
NP_442428.1_4 Reverse -137 -156 6.4893 0.197
NP_440618.1_1 Forward -138 -119 -10.3253 0.297
NP_441714.1_3 Reverse -26 -44 15.7513 0.138
NP_440718.1_2 Reverse -71 -90 16.9124 0.18
NP_441052.1_2 Reverse -18 -28 1.65166 0.233
NP_440436.1_4 Reverse -239 -248 9.04574 0.092
NP_440436.1_4 Forward -348 -339 7.76745 0.124
NP_442414.1_8 Reverse -129 -148 18.1907 0.0564
NP_442813.1_4 Reverse -242 -261 -5.50708 0.299
NP_443054.1_2 Reverse -134 -148 -0.492064 0.295
NP_441851.1_9 Forward -143 -124 9.14423 0.248
NP_441851.1_10 Forward -248 -238 4.69992 0.254
NP_442515.1_1 Forward -358 -344 0.294584 0.196
NP_441046.1_2 Reverse -71 -90 1.27776 0.257
NP_441661.1_3 Forward -118 -101 0.530496 0.226
NP_441124.1_2 Reverse -121 -138 19.9009 0.0809
NP_440431.1_3 Forward -320 -301 -4.42544 0.179
NP_442168.1_4 Forward -326 -312 18.4858 0.252
NP_442006.1_2 Forward -51 -34 -18.0541 0.287
NP_442006.1_2 Reverse -42 -59 -18.1524 0.288
NP_441003.1_9 Forward -69 -50 4.03102 0.29
NP_441078.1_4 Reverse -82 -91 3.53964 0.136
NP_442729.1_8 Reverse -96 -109 5.13249 0.263
NP_440539.1_9 Reverse -90 -109 -3.24547 0.286
NP_440793.1_1 Reverse -168 -182 8.65209 0.295
NP_440526.1_3 Forward -348 -337 5.85971 0.229
NP_441432.1_3 Reverse -71 -90 10.815 0.275
NP_441432.1_8 Reverse -6 -15 2.55633 0.298
NP_441732.1_2 Reverse -119 -135 -16.4611 0.167
NP_441732.1_2 Forward -95 -79 -16.6577 0.186
NP_440497.1_6 Forward -126 -107 -6.29373 0.264
NP_440290.1_1 Reverse -155 -164 15.65 0.292
NP_442797.1_7 Forward -123 -105 1.19912 0.262
NP_442763.1_8 Forward -151 -132 8.25926 0.159
NP_441659.2_8 Forward -349 -339 0.963343 0.254
NP_440860.1_8 Reverse -346 -365 17.6007 0.15
NP_441040.1_2 Reverse -304 -323 -6.88371 0.202
NP_441040.1_2 Forward -105 -86 -9.24366 0.236
NP_442849.1_6 Reverse -309 -323 14.0609 0.242
NP_440708.1_6 Forward -101 -82 -10.6203 0.282
NP_442346.1_5 Reverse -339 -349 4.3066 0.291
NP_440545.1_3 Reverse -47 -64 3.67709 0.0804
NP_440545.1_3 Forward -64 -47 -5.56602 0.253
NP_442828.1_7 Forward -147 -128 -2.0655 0.276
NP_441948.1_4 Forward -152 -134 2.0841 0.128
NP_441502.1_1 Reverse -78 -97 19.0748 0.0979
NP_440224.1_5 Reverse -153 -172 18.0924 0.0862
NP_441973.1_1 Reverse -196 -211 -7.98491 0.293
NP_442073.1_6 Reverse -36 -55 7.66927 0.193
NP_442140.1_3 Reverse -252 -262 3.91327 0.271
NP_442021.1_3 Forward -109 -90 -6.98204 0.261
NP_440875.1_9 Reverse -240 -250 9.15072 0.233
NP_441239.1_9 Forward -62 -50 7.02048 0.173
NP_442691.1_2 Reverse -74 -93 20.944 0.0161
NP_440665.1_2 Forward -98 -79 -1.96717 0.211
NP_441617.1_6 Reverse -193 -212 -4.91709 0.274
NP_442138.1_9 Reverse -100 -119 10.4217 0.21
NP_440546.1_2 Forward -109 -90 14.4541 0.219
NP_440546.1_4 Forward -247 -237 8.59164 0.181
NP_441509.1_2 Forward -130 -112 7.98396 0.245
NP_442611.1_1 Forward -157 -138 1.57275 0.236
NP_442402.1_4 Reverse -307 -326 -6.58946 0.259
NP_440825.1_6 Forward -246 -227 7.7676 0.285
NP_440505.1_3 Forward -249 -239 4.79825 0.266
NP_440914.1_1 Reverse -7 -17 7.24882 0.242
NP_442533.1_1 Forward -150 -131 -9.44032 0.223
NP_442533.1_6 Forward -10 -1 3.34298 0.216
NP_442541.1_10 Forward -60 -46 1.37564 0.287
NP_442232.1_3 Forward -68 -49 -11.2103 0.281
NP_441028.1_6 Forward -55 -45 13.5492 0.158
NP_441028.1_6 Forward -106 -96 10.4026 0.203
NP_441028.1_6 Reverse -174 -184 6.27276 0.23
NP_441028.1_6 Reverse -128 -138 6.27276 0.23
NP_441028.1_6 Reverse -173 -183 5.97777 0.234
NP_441028.1_6 Reverse -316 -326 5.48612 0.255
NP_441028.1_6 Reverse -129 -139 4.30615 0.278
NP_441028.1_6 Reverse -197 -207 3.51951 0.292
NP_442664.1_3 Reverse -358 -372 15.8309 0.246
NP_441972.1_3 Forward -191 -172 14.9458 0.185
NP_442674.1_3 Reverse -142 -161 12.1917 0.174
NP_441705.1_3 Forward -396 -377 -4.72043 0.291
NP_442614.1_2 Forward -247 -233 9.14437 0.242
NP_442614.1_2 Forward -134 -120 8.75105 0.248
NP_440205.1_3 Forward -255 -236 4.71934 0.282
NP_441463.1_3 Forward -26 -7 -6.39206 0.245
NP_441962.1_4 Reverse -46 -65 -5.40875 0.168
NP_442084.1_6 Forward -161 -143 4.44404 0.294
NP_442224.1_1 Forward -374 -355 -4.6221 0.236
NP_441174.1_1 Reverse -42 -57 17.3845 0.231
NP_440358.1_8 Forward -206 -187 -0.688862 0.272
NP_440814.1_8 Reverse -1 -20 0.491109 0.269
NP_442323.1_7 Reverse -380 -399 1.37531 0.281
NP_441510.2_2 Forward -64 -45 9.04509 0.182
NP_440287.1_6 Reverse -31 -50 3.53937 0.219
NP_442278.1_4 Reverse -69 -88 20.4523 0.0765
NP_440457.1_1 Forward -189 -177 4.75886 0.154
NP_442940.1_2 Forward -381 -362 -0.0988766 0.296
NP_440054.1_2 Reverse -226 -245 12.1917 0.197
NP_441332.1_6 Forward -50 -40 12.1308 0.236
NP_441332.1_6 Reverse -178 -188 11.9372 0.239
NP_441159.1_1 Forward -41 -22 -3.44213 0.286
NP_440554.1_4 Reverse -295 -305 2.53664 0.261
NP_441885.1_5 Reverse -82 -92 -1.78992 0.284
NP_442341.1_7 Reverse -279 -293 5.50613 0.154
NP_441756.1_5 Reverse -132 -151 9.24257 0.128
NP_441173.1_9 Reverse -377 -385 10.2454 0.261
NP_441173.1_9 Reverse -317 -325 9.75379 0.284
NP_441902.1_1 Forward -275 -256 11.6017 0.282
NP_441902.1_1 Reverse -119 -138 9.7334 0.282
NP_440679.1_10 Forward -254 -235 -10.7186 0.182
NP_442451.1_2 Forward -67 -48 -11.2103 0.287
NP_440175.1_7 Forward -101 -83 8.77756 0.288
NP_442495.1_4 Forward -196 -186 12.6647 0.218
NP_441105.1_3 Reverse -77 -96 -1.27885 0.147
NP_440216.1_9 Reverse -3 -12 11.3078 0.269
NP_440216.1_9 Reverse -90 -99 5.50626 0.292
NP_442379.1_3 Reverse -76 -90 19.2725 0.202
NP_443052.1_9 Reverse -133 -152 4.916 0.149
NP_443052.1_9 Reverse -240 -259 1.47442 0.185
NP_443052.1_9 Forward -261 -242 -6.98204 0.291
NP_440072.1_5 Forward -253 -235 -2.43913 0.271
NP_442403.1_8 Forward -205 -186 0.294447 0.241
NP_442154.1_1 Forward -151 -133 -15.5171 0.22
NP_442226.1_8 Forward -164 -154 16.6963 0.164
NP_440988.1_10 Forward -345 -331 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCCAGTGAGAACCATTTGGGAAATTTCCGATACCAGCAAAGTGGCAATTAAACCATCGTCAATCCAACCAAGTACGGGGAAAACGTCGGGCAGAAAATCGATGGGACTGAGGAGATACACCAAGGAGCCGAGGACAATCCACCAACGGTACCGGGGATGGTTCAGCATTTGACGGTACCAACCATAGAGAGACTCGAGGGAAAATTTCATGGGGTGCGGGGGGAAAGAACAATTTAATTTTGGCAGATCCAATGGGGGCTCCGGGGGGGAAAACTCCCAGGCTTGGGGACGGATTTCCCTCTAGCCTTGGGTTTAGCCAGCAGTTTCTCTTTTGAGCGCTGACATTGCCCCCCAGTCGGCAATAATGTATCTGTCGTTAACCTTGTCTTTGCCAGGCCC

CDS

ATGCTGATTTCCCGTGCCCCTGTCCGCATTAGTTTTTTTGGTGGGGGAACCGATTATCCTGAGTATTTTCTCCAGCATGGTGGTGCGGTTCTAGCTACGGCAATCGACAAATTTTCCTACGTTACTGCTAGTCCTTTTCTGAGTCATTTATTTGACTATTCCATTCGCGTTTCCTACCGCAAAGTGGAATTGGTTAAAAATCCTAGCGAAATGGAGCACGTGGTTTTTCGGGAATGCTTGAAATTCTGTGGTTTAGAAAAAGATATTGAGCTTCATAACGTGGCGGATTTACCAGCTTTTACCGGTCTGGGGTCTTCCTCTGCTTTTACGGTTTCCTTGCTCCAGGCTCTGCACTCTTTTAAAGGGGAATTTATCCGTCCTTTGGATTTAGCCTATGAAGCCATTTATGTCGAAAGGCATTTGGTCAAAGACAAGGTGGGTTGTCAGGATCAACTAATGGCCGCCATGGGGGGATTTAACTTGGTGGAATTTCGCAAGGAAGACGATATTGTGGTCAGTCGGGTCACCATGGCCCCGGAAAGGATGGCGGAGTTTGAAGAACATATTTTTATTGTTTTTACCGGCATTAAACGGCGGGCAGCCAATGTGGTGGAAAAGCAATTAAAAAGGGTGGGTGATAATCGAGAAACCCTGAAACTGATGCGTGCCATGGTGGACAAAGGTTGGGACATTTTAACTAGTAACCAATGTTTGTCAGCCTTCGGAGAATTATTGGATCAAGCCTGGCAGGCAAAGCGAAGTTTAGATGTGGGCATTTCCAATGGCGACATTGACCGCATTTACCAACAGGGAAGGGAAGCCGGGGCCTGGGGCGGTAAATTGCTGGGGGCTGGAGCAGGGGGTTTTATGTTATTTTTTGCCCCCCCATCAGTGCATCCCCGTTTGGCGGAAACTTTTAAGGATCATCAAGTCTTGTCGGTAAAAATTAATGCCCCTGGTTCCCAGATCATCTTCTCTTAG

Protein

MLISRAPVRISFFGGGTDYPEYFLQHGGAVLATAIDKFSYVTASPFLSHLFDYSIRVSYRKVELVKNPSEMEHVVFRECLKFCGLEKDIELHNVADLPAFTGLGSSSAFTVSLLQALHSFKGEFIRPLDLAYEAIYVERHLVKDKVGCQDQLMAAMGGFNLVEFRKEDDIVVSRVTMAPERMAEFEEHIFIVFTGIKRRAANVVEKQLKRVGDNRETLKLMRAMVDKGWDILTSNQCLSAFGELLDQAWQAKRSLDVGISNGDIDRIYQQGREAGAWGGKLLGAGAGGFMLFFAPPSVHPRLAETFKDHQVLSVKINAPGSQIIFS